Residentia Support
User Manual for Esatto models including: EBTDW2D, Benchtop Dishwasher, EBTDW2D Benchtop Dishwasher
Dec 8, 2021 — Electric indicator on control panel (if provided). Check the rinse aid level. Load the baskets. Select a program. Running the dishwasher.
File Info : application/pdf, 32 Pages, 4.62MB
DocumentDocumentProduct: Benchtop Dishwasher Model Code/s: EBTDW2D User Manual Exactly what you need Version: V2 1021 Online: esatto.house User Manual 02 03 Contents esatto.house 04 Welcome 05 Quick Start Guide 06 Safety Information 08 Disposal 09 Operation Instructions 10 Getting Started 12 Loading the Dishwasher 15 Starting a Wash Program 16 Maintenance & Cleaning 19 Installation Instructions 23 25 Troubleshooting Technical Information 26 Purchase Details 28 Warranty Information Welcome Residentia Group -- Head Office 165 Barkly Avenue Burnley, Victoria Australia 3121 -- ACN 600 546 656 -- Online residentia.group www.esatto.house @esatto.house -- Postage PO Box 5177 Burnley, Victoria Australia 3121 -- Telephone 1300 11 4357 User Manual 04 Congratulations on purchasing your new dishwasher. The Esatto brand is proudly distributed within Australia by Residentia Group Pty Ltd. Please refer to the warranty card at the rear of this manual for information regarding your product's parts and labour warranty, or visit us online at: www.residentia.group At Residentia Group, we are customer obsessed and our Support Team are there to ensure you get the most out of your appliance. Should you want to learn more about your dishwasher such as the various programs or importantly taking care of the appliance, our Support Team are here to help. You can use our online Support Centre at anytime by visiting: http://support.residentiagroup.com.au Or you can contact us via phone by dialing: 1300 11 HELP (4357). It is important that you read through the following use and care manual thoroughly to familiarise yourself with the installation and operation requirements of your appliance to ensure optimum performance. Again, thank you for choosing an Esatto appliance and we look forward to being of service to you. Kind Regards, The Residentia Team 05 esatto.house Quick Start GQuuiidckeoperation guide For more dFeotarildseotnaoilpeedraotipoen,raplteinasgemreeatdhtohde rreeleavdantht ecocnoternret sinptohnisdminagnucaol.ntent on the instruction manual. Switch on the appliance Press the Power switch button to switch on the appliance, Open the door. Fill the detergent dispenser Compartment A: With each wash cycle. Compartment B: For programmes with pre-wash only. (Follow the user instructions!) Check the rinse aid level Mechanical indicator C. Electric indicator on control panel (if provided). C AB Load the baskets Select a program Scrape off any large amount of leftover food. Soften remnants of burnt food in pans, then load the baskets. Refer to the dishwasher loading instructions. Close the doorPress the program button until the selected program lights up. ( See the section entitled"Operation instruction") Running the dishwasher T urn on the water tap and press the Start/Pause button. The machine will start working after about 10 seconds. Changing the programme Add forgotten dishes in the dishwasher. If the appliance is switched off during a wash cycle. 1. A running cycle can only be modified if it has been running for a short time. Otherwise the detergent may have already been released and the water already drained. If this is the case, the detergent dispenser must be refilled. 2. Press the Start/Pause button ,than press the program button more than 3 seconds to cancel the running programme. 3. Select a new programme. 4. Restart the dishwasher. WARNING! 1.Press the start/pause button to stop the machine. 2.Open the door. 3.Add the forgotten dishes. 4.Close the door, then press the start/pause button, the dishwasher will start running again . Open the door carefully. Hot steam may escape when the door is opened! If the appliance is switched off during a wash cycle, when switched on again, please re-select the washing cycle and operate the dishwasher according to the original Power-on state ). Switch off the appliance When the working cycle has finished, the buzzer of the dishwasher will sound 8 times, then stop. Turn off the appliance using the Power button. Since the appliance is standing by, it will power off automaticly after 30 minutes without any operation. Turn off the water tap, unload the baskets Warning: wait a few minutes (about 15 minutes) before unloading the dishwasher to avoid handling the dishes and utensils while they are still hot and more susceptible to break. They will also dry better.Unload the appliance, starting from the lower basket. User Manual 06 Safety Information 1.IMPORTANT SAFETY INFORMATION WARNING! When using your dishwasher, follow the precautions listed below: This appliance is intended to be used in household and similar applications such as: -staff kitchen areas in shops, offices and other working environments; -farm houses; -by clients in hotels, motels and other residential type environments; -bed and breakfast type environments. This appliance can be used by children aged from 8 years and above and persons with reduced physical, sensory or mental capabilities or lack of experience and knowledge if they have been given supervision or instruction concerning use of the appliance in a safe way and understand the hazards involved. Children shall not play with the appliance. Cleaning and user maintenance shall not be made by children without supervision. For EN60335-1 This appliance is not intended for use by persons(including children )with reduced physical, sensory or mental capabilities, or lack of experience and knowledge ,unless they have been given supervision or instruction concerning use of the appliance by a person responsible for their safety. For IEC60335-1 This appliance is for indoor use only, for household use only. To protect against the risk of electrical shock, do not immerse the unit, cord or plug in water or other liquid. Please unplug before cleaning and maintenance the appliance .Use a soft cloth moisten with mild soap, and then use a dry cloth to wipe it again . EARTHING INSTRUCTIONS This appliance must be earthed. In the event of a malfunction or breakdown, earthing will reduce the risk of an electric shock by providing a path of least resistance of electric current. This appliance is equipped with a cord having an equipment-earthing conductor and a earthing plug. The plug must be plugged into an appropriate outlet that is installed and earthed in accordance with all local codes and ordinances. Improper connection of the equipment-earthing conductor can result in the risk of an electric shock. Check with a qualified electrician or service representative if you are in doubt whether the appliance is properly earthed. Do not modify the plug provided with the appliance; If it does not fit the outlet. Have a proper outlet installed by a qualified electrician. 1-1 07 esatto.house Do not abuse, sit on, or stand on the door or dish rack of the dishwasher. Do not operate your dishwasher unless all enclosure panels are properly in place. Open the door very carefully if the dishwasher is operating, there is a risk of water squirting out. Do not place any heavy objects on or stand on the door when it is open. The appliance could tip forward. When loading items to be washed: 1) Locate sharp items so that they are not likely to damage the door seal; 2) Warning: Knives and other utensils with sharp points must be loaded in the basket with their points down or placed in a horizontal position. Check that the detergent powder is empty after completion of the wash cycle. Do not wash plastic items unless they are marked dishwasher safe or the equivalent. For plastic items not so marked, check the manufacturer's recommendations. Use only detergent and rinse additives designed for an automatic dishwasher. Never use soap, laundry detergent, or hand washing detergent in your dishwasher. Children should be supervised to ensure that they do not play with the appliance. The door should not be left open, since this could increase the risk of tripping. If the supply cord is damaged, it must be replaced by the manufacturer or its service agent or a similarly qualified person in order to avoid a hazard. During installation, the power supply must not be excessively or dangerously bent or flattened. Do not tamper with controls. The appliance is to be connected to the water mains using new hose sets and that old hose-sets should not be reused. The maximum number of place settings to be washed is 8. The maximum permissible inlet water pressure is 1MPa. The minimum permissible inlet water pressure is 0.04MPa. 1-2 User Manual 08 Disposal Disposal This appliance's packaging materials are recyclable. Dispose of the packaging into a suitable waste collection container to recycle it. It is prohibited to dispose of this appliance as household waste.Correct Disposal of this product: this symbol on the product or in its packing indicates that this product may not be treated as household waste. Instead, it should be taken to the appropriate waste collection point for the recycling of electrical and electronic equipment. By ensuring this product is disposed of correctly, you will help prevent potential negative consequences for the environment and human health, which could otherwise be caused by the inappropriate waste handling of this product.For more detailed information about the recycling of this product, please contact your local council your household waste disposal service, or the shop where you purchased the product. WARNING! For disposing of package and the appliance please go to a recycling centre. Therefore cut off the power supply cable and make the door closing device unusable. Cardboard packaging is manufactured from recycled paper and should be disposed in the waste paper collection for recycling. By ensuring this product is disposed of correctly, you will help prevent potential negative consequences for the environment and human health, which could otherwise be caused by inappropriate waste handling of this product. For more detailed information about recycling of this product, please contact your local city office and your household waste disposal service. DISPOSAL: Do not dispose this product as unsorted municipal waste. Collection of such waste separatelyfor special treatment is necessary. 2 09 esatto.house O3.OppeerartaiontiIonsntrucItnionstruction IMPORTANT To get the best performance from your dishwasher, read all operating instructions before using it for the first time. Control Panel 3 45 1 2 6 1 Power Button: To turn on/off the power supply. 2 Delay Button : To press the button to delay. 3 Rinse Aid Warning Light : To be on when the rinse aid dispenser needs to be refilled.. 4 P. rogram ending Light : To be on when the washing program is finished. W. ater failure indication, the faucet maybe not open Dishwasher Features Front view 5 4 6 ECO 7 8 9 Delay setting indications 7 Program Selector: Press the button to select wash cycles 8 Start/Pause Button: Press this button to start or pause the dishwasher. 9 Program indications. Back View 1 24 3 1 3 5 Detergent Dispenser Rinse Aid Dispenser Cup Shelf 2 Filter assembly 4 Spray Arms 6 Basket 3 7 Inlet pipe connector 8 Drain pipe connector 78 User Manual 10 Getting Started 44..PPrriioorr uussiinngg ffoorr tthhee ffiirrsstt ttiimmee BBeeffoorreeuussininggyyoouurrddisishhwwaasshheerrffoorrtthheeffirirssttttimimee:: AA.. RRininsseeaaididddisisppeennsseerr BB.. DDeetteerrggeenntt AA.. RRiinnsseeAAiiddDDiissppeennsseerr RRiinnsseeAAiidd DDiissppeennsseerr TThheerrininsseeaaididisisrreeleleaasseedddduurrininggththeefifninaal lrrininsseetotopprreevveennttwwaateterrfrfroommfoforrmmininggddrrooppleletstsoonnyyoouurrddisishheess,,wwhhicichhccaann leleaavveessppootstsaannddsstrtreeaakkss..ItItaalslsooimimpprroovveessddrryyininggbbyyaallolowwininggwwaateterrtotorrooll loofffththeeddisishheess..YYoouurrddisishhwwaasshheerrisis ddeessigignneeddtotouusseelilqiquuididrrininsseeaaididss..TThheerrininsseeaaididddisisppeennsseerrisisloloccaateteddininssidideeththeeddoooorrnneexxtttotoththeeddeeteterrggeennttddisisppeennsseer.r. TToofiflil lththeeddisisppeennsseer,r,ooppeennththeeccaappaannddppoouurrththeerrininsseeaaididinintotoththeeddisisppeennsseerruunntitlilththeelelevveel lininddicicaatotorrtuturrnnssccoommppleletetelyly bblalacckk..TThheevvoolulummeeooffththeerrininsseeaaididccoonntatainineerrisisaabboouutt111100mml.l. FFuunnccttiioonn ooff RRiinnsseeAAiidd RRininsseeaaididisisaauutotommaatitcicaallylyaaddddeedddduurrininggththeelalassttrrininssee,,eennssuurrininggththoorroouugghhrrininssiningg,,aannddssppoottaannddsstrtreeaakkfrfreeeeddrryyiningg.. AAtttteennttiioonn!! OOnnlylyuusseebbrraannddeeddrrininsseeaaididfoforrddisishhwwaasshheer.r.NNeevveerrfiflil lththeerrininsseeaaididddisisppeennsseerrwwitihthaannyyooththeerrssuubbsstatanncceess ((ee.g.g..DDisishhwwaasshheerrccleleaannininggaaggeennt,t,lilqiquuididddeeteterrggeennt)t)..TThhisiswwoouuldldddaammaaggeeththeeaapppplilaiannccee.. WWhheenn ttoo RReeffiill l tthhee RRiinnsseeAAiidd DDiissppeennsseerr IIfftthheerreeisisnnoorrininssee--aaididwwaarrnniningglilgighhttinintthheeccoonnttrroollppaanneel,l,yyoouuccaannjujuddggeetthheeaammoouunnttooffrrininssee--aaididbbyytthhee ccoololorroofftthhee oopptticicaalllelevveellininddicicaattoorr ""CC"" loloccaatteeddnneexxttttootthheeccaapp..WWhheenntthheerrininssee--aaididccoonnttaainineerrisisffuull,l,tthheewwhhooleleininddicicaattoorrwwilillbbee ddaarrkk..AAsstthheerrininssee--aaididddimimininisishheess,,tthheessizizeeoofftthheeddaarrkkddoottddeeccrreeaasseess..YYoouusshhoouuldldnneevveerrleletttthheerrininsseeaaididggeettbbeeloloww 11//44ffuull.l. AAsstthheerrininsseeaaididddimimininisishheess,,tthheessizizeeoofftthheebblalacckkddoott oonntthheerri ni nsseeaai di dl el evveel li ni nddi ci caattoorrcchhaannggeess,,aassi lil ul ussttrraatteeddbbeel ol oww.. FFuul l l 33//44ffuul l l 11//22ffuul l l 11//44ffuul l l--SShhoouul dl drreeffi lil lttooeel ilmi mi ni naatteessppoott ti ni ngg EEmmpptyty CC((RRininssee--AAididininddicicaattoorr)) HHooww ttoo ffiillll tthhee RRiinnsseeAAiidd DDiissppeennsseerr 11 22 33 11 TTooooppeennththeeddisisppeennsseer,r,tuturrnnththeeccaapptotoththee ""ooppeenn""((leleftf)t)aarrroowwaannddlilfitftititoouut.t. 22 PPoouurrththeerrininsseeaaididinintotoththeeddisisppeennsseer,r,bbeeininggccaarreefuful lnnootttotooovveerrfiflil.l. 33 RReepplalacceeththeeccaappbbyyininsseerrtitninggititaalilgignneeddwwitihth ""ooppeenn""aarrroowwaannddtuturrnnininggitittotoththeecclolosseedd((rrigighht)t)aarrrooww.. BBeeccaarreefuful lnnootttotooovveerrfiflil lththeeddisisppeennsseer,r,bbeeccaauusseeththisisccoouuldldccaauusseeoovveerrssuuddssiningg..WWipipeeaawwaayyaannyyssppililsls wwitihthaaddaammppcclolothth..DDoonn't'tfoforrggeetttotorreepplalacceeththeeccaappbbeefoforreeyyoouucclolosseeddisishhwwaasshheerrddoooor.r. AAttetenntitoionn!! CCleleaannuuppaannyyrrininsseeaaididssppilil ldduurrininggfiflililninggwwitihthaannaabbssoorrbbeennttccloloththtotoaavvooidideexxcceessssfofoaamminingg dduurrininggththeenneexxttwwaasshh.. 44 11 esatto.house NOTE: Clean up any rinse aid spilled while during filling with an absorbent cloth to avoid excessive foaming during the next wash. Don't forget to replace the cap before you close dishwasher door. Adjusting Rinse Aid Dispenser MAX Adjust lever (Rinse) The rinse aid dispenser has six or four settings. Always start with the dispenser set on "4". If spots and poor drying are a problem, increase the amount of rinse aid dispensed by removing the dispenser lid and rotating the dial to "5". If the dishes still are not drying properly or are show spots, adjust the dial to the next higher lever until your dishes are spot-free. The recommended setting is "4". (Factory value is "4".) NOTE: Increase the dose if there are drops of water or lime spots on the dishes after washing. Reduce it if there are sticky whitish stains on your dishes or a bluish film on glassware or knife blades. B. Detergent Detergents have chemical ingredients that are necessary to remove dirt, crush dirt and transport it out of the dishwasher. Most of the commercial quality detergents are suitable for this purpose. Detergents There are 3 sorts of detergents 1.With phosphate and with chlorine 2.With phosphate and without chlorine 3.Without phosphate and without chlorine Normally new pulverised detergent is without phosphate. Thus the water softener function of phosphate is not given. If detergents without phosphate are used in the case of hard water often white spots appear on dishes and glasses. In this case please add more detergent to reach better results. Detergents without chlorine do only bleach a little. Strong and coloured spots will not be removed completely. In this case please choose a program with a higher temperature. Concentrated Detergent Based on their chemical composition, detergents can be split in two basic types: Conventional, alkaline detergents with caustic components Low alkaline concentrated detergents with natural enzymes The use of"normal" washing programs in combination with concentrated detergents reduces pollution and is good for your dishes; these wash programs are specifically matched to the dirt-dissolving properties of the enzymes of the concentrated detergent. For this reason "normal"wash programs in which concentrated detergents are used can achieve the same results that can otherwise only be achieved using "intensive" programs. Detergent Tablets Detergent tablets of different brands dissolve at different speeds. For this reason some detergent tablets cannot dissolve and develop their full cleaning power during short programs. Therefore please use long programs when using detergent tablets, to ensure the complete removal of detergent residuals. Detergent Dispenser The dispenser must be refilled before the start of each wash cycle following the instructions provided in the wash cycle table . Your dishwasher uses less detergent and rinse aid than Conventional dishwasher. Generally, only one tablespoon of detergent is needed for a normal wash load. More heavily soiled items need more detergent. Always add the detergent just before starting the dishwasher, otherwise it could get damp and will not dissolve properly. Proper Use of Detergent Use only detergent specifically made for the use in dishwashers. Keep your detergent fresh and dry. Don't put powdered detergent into the dispenser until you're ready to wash dishes. 5 User Manual 12 AAddddininggddeeteterrggeenntttotoddisisppeennsseerr 11 PPusuhshlaltacthchtotoopoepnen 22 AA BB FFilil lininDDeeteterrggeenntt FFilliltlhtehededteetregregnetndt idsipsepnesnesrewr withithdedteetregregnetn.t. TThehemmarakriknignginidnidciactaetsesthtehedodsoisnignglelveevlesls, a, sas illiullsutsrtartaetdedononthteherirgihgth:t: AAFForomr maianinwwasahshdedteetregregnetn.t. BBFForopr rper-ew-wasahshdedteetregregnetn.t. PPlelaesaeseobosbesrevrevethtehemmanaunfuafcatcutruerresrsdodsoisnignganadndstsotroargaege RReceocmommmenednadtaiotinosnsasasstsattaetdedononthtehededteetregregnetnpt apcakcakgaignign.g. CCl olsoes et hteh el i dl i da nadn dp rpersess su nutni lt iilt iltolcokcsk si ni np lpalcaec.e . IdfeIdtfhteteehtreegdregidsneihstnehdtseodsasoreasereienhinehthaetehvaeivplyirpleysr-eosw-iowlaeilsadehs,dhpd, lpedaltecaetecregeraegnanenatndatcddhcidtahiiomtainombaneblare.lrT. Thihsisdedteetregregnetnwt williltlatkaekeefeffefcetcdt udruirnigngthteheprper-ew-wasahshphpahsaes.e. NNOOTTEE: : IfItfhtehelidlidisisclcolsoesde:dp: upsuhshthtehelaltacthchtotoopoepne.n. AAlwlwayasysadadddthtehededteetregregnetnjtujsutsbt ebfeofroerestsatratrintigngeaecahchwwasahshcyccylcel.e. OOnlnylyusuesebrbarnadneddeddedteetregregnetnat nadndrirnisneseaiadidfofrodr idsihswhwasahsehre.r. YoYuouseseeeinifnofromrmataiotinonabaobuotutthteheamamouonutnot fodf edteetregregnetnftofrotrhtehesisnignlgeleprporgorgarmammmeeononthtehelalsatspt apgaeg.e. PPlelaesaesebebeawawaraerethtahtast osioliinlignglelveevleslsanadndwwataetrehr ahradrndensessscacnanefeffefcetcwt wasahshrerseuslutslt.s. PPleleaaseseoobbseservreveththeemmaannuufafactcuturerer'rs'srerecocommmmeennddaatitoionns soonnththeeddeetetergrgeennt pt paackcakagginingg. . WWAARRNNININGG! ! DDisishhwwaasshheerrddeetetergrgeennt tisisccoorrrorossivivee! ! TTaakkeeccaareretotokkeeeeppititoouut toof frereaacchhoof fcchhilidldrerenn. . 5L5..LoLooaaadddiniingngtgthheetDDhisieshhwwDaassihsheehrrBwBaasaskkseethtsser RReeccoommmmeennddaatitoionn CConosnisdiedrebr ubyuiynigngutuetnesnislsilswwhihcihcharaereidiednetniftiiefidedasasdidsihswhwasahsehre-rp-rporoofo.f. UUseseaammildilddedteetregregnetntthtahtaitsisdedsecsrcirbiebdedasas'k'iknidndofodf idsihsehse's. 'I.fInf enceecsessasrayr,ys, eseekekfufrutrhtehrer iFniFofnorofroprmrapmarattariictotiuicnoluanflrraforirtmoeitmmedmedst,esest,reesgrleegelnecettncmatt maparpnaorungofuargfacarmatcumtmruemrereeswr.swit.hithasaslolwowaatetmempepreartautruer.e. ToToprperveevnetndt admamagaeg,ed, odonontottatkaekeglgalsasssanadndcuctuletlreyryouotuot fotfhtehedidsihswhwasahsehreirmimmmedeidaitaetleyly a fatfetretrhteh ep rporgorgarma mmme eh ahsa se nednedde.d . FFoorrwwaasshhininggininththeeddisishhwwaasshheerrththeefofollolowwininggccuutltelerryy/d/disishheess AArreennoottssuuitiatabblele CCutuletlreyrywwithithwwooodoedne,nh, ohronrnchcihnianaoror mPOmPOlloadlltosaedhttsreehictcrreic-uicrot-tueiflotet-meflpre-msyeprsyaetwhratwilahtrhhitlatahhatgnaralgeudnrleeuldnedelonsedtopshtapehrataersttastrthetrahsetaissitistsiasntnaontntott tBPetBPoemenwoempdnwteepedtrreedeaorrdctarouuctcrrutueolcretepolrreeppyrrseepyiitsreseiitirtsmteaeitmtnasmetnsmostrosdr idsihsehses cSrcStyertsyeetsleatillateigltmelgamlssasssssusbujbejcetcttotorursutsintigng WWooodoednenplpaltattetresrs ItIetmems smmadaedefrformomsysnytnhtehteicticfibfirberses AArreeoofflilmimitieteddssuuitiatabbiliiltiyty SduSdolumol lamlefaettefyttrpeyaerpsaelasolrafgorgefglgeanlsuansmsuesmbseebscreacornafonbwf ebwacesaochsmoehmseese StetSinelvidnlevedrenearcnnaycdnytdoatoladulidmusimcsinociinlouoilmuuomrupdrapudrarutirsrntishgnahgwvawaevsaeahsaihnigng GwGwalasalzahsezehdededpdfarpfetartqetetuqreeunrnesntnsmlytmlayyayfafdaedeifimf macahcihniene 66 13 esatto.house Attention before or after loading the Dishwasher Baskets (For best performance of the dishwasher, follow these loading guidelines. Features and appearance of baskets and cutlery baskets may vary from your model.) Scrape off any large amounts of leftover food. Soften remnants of burnt food in pans It is not necessary to rinse the dishes under running water. Place objects in the dishwasher in following way: 1.Items such as cups, glasses, pots/pans, etc. are face down. 2.Curved items, or those with recesses, should be loaded at a slant so that water can run off. 3.All utensils are stacked securely and can not tip over. 4.All utensils are placed in the way that the spray arms can rotated freely during washing. NOTE: Very small items should not be washed in the dishwasher as they could easily fall out of the basket. Load hollow items such as cups, glasses, pans etc. With the opening downwards so that water cannot collect in the container or a deep base. Dishes and items of cutlery must not lie inside one another, or cover each other. To avoid damage to glasses, they must not touch. Load large items which are most difficult to clean into the basket. Long bladed knives stored in an upright position are a potential hazard! Long and/or sharp items of cutlery such as carving knives must be positioned horizontally in the basket. Please do not overload your dishwasher. This is important for good results and for reasonable energy consume. Loading the baskets according to AS/NZS 2007:1: 1.Upper basket: Down Shelf 2.Lower basket: 1 1 2 6 4 5 IN 1 Cups 1 2 Saucers Up Shelf 3 Glasses 4 Dessert dishes 3 24 5 Dinner plates 6 Soup plates 7 User Manual 14 Note: Please place the light flat wares on the up shelf. The total weight is less than 2kg. 5 4 4 2 1 Up Shelf IN 3 Down Shelf IN 1 Soup spoons 2 Forks 3 Knives 4 Teaspoons 5 Dessert spoons Information for comparability tests in accordance with (*AS/NZS 2007.1) Voltage:220~240V/50Hz Capacity: 8 place settings Programme: ECO Detergent(Pre/main): 5 g/20g Rinse aid setting: 6 Door is open at the end of the drying cycle for the drying performance test (Door position: Open 50 mm) WARNING! Do not let any item extend through bottom. Always load sharp utensils with the sharp point down! For personal safety and a top quality clean, place the silverware in the basket: They do not nest together. Place silverware with handles-down. But place knives and other potentially dangerous utensils handles-up. 8 15 esatto.house Starting a Wash Program 6.Starting a washing programme Wash Cycle Table Program Cycle Selection Information Description of Cycle Detergent Running pre/main time(min) Intensive Pre-wash(50) For heaviest soiled crockery soiled potspansdishes etc with dried on soiling. Wash (65 ) Rinse Rinse Rinse (70 ) 5/20g (Or 1 piece) 155 Drying Heavy For heavily soiled loads, such as pots, plates, glasses and lightly soiled pans. Pre-wash(45 ) Wash (60 ) Rinse Rinse (68 ) 5/20g 150 Drying (*AS/NZS 2007.1) This is standard program, it is suitable to clean normally soiled tableware and it is the most efficient programme in terms of its combined energy and water consumption for that type of tableware. Pre-wash Wash (50 ) Rinse (50 ) Drying 5/20g 160 Energy (Kwh) 1.25 1.05 0.54 Water Rinse (l) Aid 12 12 9.16 Glass 90 min For lightly soiled loads, such as glasses, crystal and fine china. For lightly soiled crockery and glass. Pre-wash Wash (45 ) Rinse Rinse (60 ) WDraysinhg(55 Wash(65 ) ) Rinse(68 ) Drying 5/20g 95 25g 90 0.7 12 1.15 10 Wash (45 ) A shorter wash for lightly soiled Rinse 15g 35 0.52 7 Rapid loads and quick wash. Rinse (55) NOTE: *AS/NZS 2007.1 : This programme is the test cycle. The information for comparability test in accordance with AS/NZS 2007.1 , as follows: Capacity: 8 settings Rinse aid setting: 6 The power consumption of off-mode is 0.45W left-on mode is 0.49W Turning On the Appliance Starting a wash cycle Draw out the basket(see the section entitled "Loading the Dishwasher"). Pour in the detergent (see the section entitled "Detergent and Rinse Aid"). Insert the plug into the socket. The power supply is 220-240 VAC 50 HZ, the specification of the socket is 10 A 250 VAC. Make sure that the water supply is turned on to full pressure. Press the program button , the wash program will be changed as follows direction ECO->Glass->90 min->Rapid->Intensive->Heavy; If a program is selected, the response light will light. Then press the Start/Pause button, the dishwasher begins to start. NOTE: When you press the Start/Pause button to pause during washing, the program light will stop blinking and the dishwasher will mooing every minute unless you press the Start/Pause button to start. 9 User Manual 16 M7.MaaiinntetneanncaenancdeCl&eanCinlgeaning Filtering System The filter prevent larger remnants of food or other objects from getting inside the pump. The filter system consists of a coarse filter, a flat (Main filter) and a micro filter (fine filter). C A Main filter Food and soil particles trapped by this filter are pulverized by a special jet on the spray arm and washed down to drain. B B Fine filter This filter holds soil and food residue in the sump area and prevents it from being deposited on the dishes during wash cycle. A Filter assembly C Coarse filter Larger items, such as pieces of bone or glass, that could block the drain are trapped in the coarse filter. To remove the items caught by the filter, gently squeeze the tap on the top of this filter and lift out. The filter efficiently removes food particles from the wash water, allowing it to be re-cyclated during the cycle. For best performance and results, the filter assembly must be regularly. For this reason, it is a good idea to remove the larger food particles trapping in the filter after each wash cycle by rinsing the filter and cup under running water. To remove the filter assembly, pull on the cup handle in the upward direction. WARNING! Never run the dishwasher without the filters in place. The dishwasher must never be used without the filters. Improper replacement of the filter may reduce the performance level of the appliance and damage dishes and utensils. Open Step1contrarotate the filter assembly(A,B and C), then lift it all up. C B Step2: lift B and C up from A; A C B The End. A NOTE: If do it from step1 to step 3, the filter system will be removed; while if do it from Step 3 to Step 1, the filter system will be installed. 11 17 esatto.house Change the Program Premise: You can modify the washing program, When the dishwasher just runs for a short time. Otherwise, the detergent may have already been released, and the appliance may have already drained the wash water. If this is the case, the detergent dispenser must be refilled (see the section entitled " Loading the Detergent " ). Press Start/Pause Button to pause the machine when the door is closed ,Press Program Button more than three seconds the machine will be in stand by state , then you can change the program to the desired cycle setting (see the section entitled " Starting a wash cycle" ). NOTE: If you open the door during washing, the machine will pause. When you close the door , the machine will keep on working after 10 seconds. The program lights show the state of the dishwasher: a) One of the program lights on----------stand by or pause b) One of the program lights blinking----- run NOTE: If you open the door when washing, the machine will pause. When you close the door , the machine will keep on working after 10 seconds. Forget to Add a Dish A forgotten dish can be added any time before the detergent cup opens. 1 Press the Start/Pause button 4 Add forgotten dishes. 2 Open the door a little to stop the washing. 5 Close the door 3 After the spray arms stop working,you can open the door completely. 6 Press the Start/Pause button, the dishwasher will run after 10 seconds. At the end of the Wash Cycle When the working cycle has finished, the buzzer of dishwasher will sound 8 seconds, then stop. Turn off the appliance using the ON/OFF button, shut off the water supply and open the door of the dishwasher. Wait a few minutes before unloading the dishwasher to avoid handling the dishes and utensils while they are still hot and more susceptible to breakage. They will also dry better. Switch Off the Dishwasher 1.Switch off the dishwasher by pressing the ON/OFF button. 2.Turn off the water tap! Open the door carefully. Hot dishes are sensitive to knocks. The dishes should therefore be allowed to cool down around 15 minutes before removing from the appliance. Open the dishwasher's door, leave it ajar and wait a few minutes before removing the dishes. In this way they will be cooler and the drying will be improved. Unloading the dishwasher It is normal that the dishwasher is wet inside. WARNING! It is dangerous to open the door when washing, because the hot water may scald you. 10 User Manual 18 Remarks: - Inspect the filters for blocking every time the dishwasher has been used. - By unscrewing the coarse filter.you can remove the filter system.Remove any food remnants and clean the filters under running water. NOTE: The entire filter assembly should be cleaned once a week. Cleaning The Filter To clean the coarse filter and the fine filter, use a cleaning brush. Reassemble the filter parts as shown in the figures in the last page and reinsert the entire assembly in the dishwasher, positioning in its seat and pressing downward. WARNING! When cleaning the filters, don't knock on them. Otherwise, the filters could be contorted and the performance of dishwasher could be debased. Caring for the Dishwasher The control panel can be cleaned by using a lightly dampened cloth and dry thoroughly. The exterior use a good appliance polish wax. Never use sharp objects, scouring pads or harsh cleaners on any part of the dishwasher. Cleaning The Door To clean the edge around the door, you should use only a soft warm, damp cloth. To avoid penetration of water into the door lock and electrical components, do not use a spray cleaner of any kind. WARNING! n Never use a spray cleaner to clean the door panel as it may damage the door lock n and electrical components. Abrasive agent or some paper towel should not be used because of the risk of scratching or leaving spots on the stainless steel surface. Protect Against Freezing please take frost protection measures on dishwasher in winter. Each time after washing cycles, please operate as follows 1.Cut off electrical power to the dishwasher. 2.Turn off the water supply and disconnect the water inlet pipe from the water valve. 3.Drain water from the inlet pipe and water valve. (Use a pan to catch the water) 4.Reconnect the water inlet pipe to the water valve. 5.Remove the filter at the bottom of the tub and use a sponge to use up water in sump. NOTE: If your dishwasher cannot work because of the ice, please contact professional service persons. 12 19 esatto.house Cleaning the Spray Arms It is necessary to clean the spray arms regularly for hard water chemicals will clog the spray arm jets and bearings. CTo rleemaovne tihne ugpptehr sepraSy aprmr,ahoyld Atherms nut, rotate the arm clockwise to remove it. It is necessary to clean the spray arms regularly for hard wToatrermcohveemtihcealsowweilrl cslporgaythaermsp,rpauyllaormut jtehtes sapnrdaybeaarmrinugpsw. ard. TcWcolloearcaseknhmwtthohiseveeejaettorthmsre.esRumipneoppsveloearacisptep.yrthaaeynmdarwamaft,rehmrorwlidnasttiehnregantnhudet,mursotethaoatresootuhfgtehbalryru.msh to To remove the lower spray arm, pull out the spray arm upward. Open Open Wash the arms in soapy and warm water and use a soft brush to Hcleoanwthetjeots.KReepleacpe thYemoaufterr Drinsiisnghthwemathsohroueghrlyi.n Shape After Every Wash When it is not in need for a long time How to Keep Your Dishwasher in Shape After every wash, turn off the water supply to the appliance and leave the door slightly open so that moisture and odors are not trapped inside. RAfetemroEvveetrhyeWPalusgh AamBrepfeotmpefiosloritraveuenevrcceetlehreayeaanwnndpdialnouslgdgehoaof,rrvrtsouepmaretnrhrtefoheonfedrfomtsothooitencrragkwspelmaiptgt.aeehidrtnlsytineuosnppiapdenleync.etso,oatthlhweaat ys RNeomSoovlveetnhtes PorluAgbrasive Cleaning It is recommend that you run a wash cycle with the dishwasher empty and then remove the plug from the socket, turn off the water supply and leave the door of IdstswMWthoeiiisetscaohhhkalriwsveneepatticpton,nsholtihaemguaiestrnamnttrciphlseeoeopmenfnlsnfidgapltAiohegntthyetrphcaaaetiwpltnnn.yaylddiotonaetppuhernerreesenucnuv.ndeepTraenphfmtlowiysooaradwvsnoaeihdlultlcrlhhoseyeeacnflrvlppogeeltmuwhttgheiiftmoefhdrrodomtehmooieorntrghoef tIhf ethaepapplipalniacnecselimghutslyt boepemno. vTehdis, twryilltoheklepetpheit dinotohre sveeartlsictaol apsotsliotinogne. rIfaanbdsporluetveelyntnoedcoeusrssafrryo, mit cfoarnmbieng TdOBreoonemcnlfyolooeruvteaseuncestltheeaheaescnopleoillnxvuthgtegenwofrtririsootphrmoearwrtnafhaodberrmrrmsauossibnciobvgkaeeemprctyp.aleawinarattnsetiennoragf. ntphcreeo,ddaiuslcwhtwsa.yassher, wpiothsiitniothneedapopnliitasnbcaec. k. MSeoavlisng the Appliance TNooreSmoovlveespnottss oorrsAtabinrsafsroimvethCe sleurafancienogf the OIf ntheeoaf pthpeliafanccteormsuthstabt ecamuosveeodd,otrys to kfoeremp iint itnhethe Tdivdnoiointsecnehrlogweiotaaarurn,s,suhotehsereesrasoae.clxvlceteleoanrtntihsoinrdogaar pnmardbporredaunusbecibvdteemwrcapiltedahaerwtnssaipnotegef crtphiwfreiocitddahiulslacyhtlfwsiot.tarlesher, Only use a cloth with warm soapy water. dveisrhtiwcaalsphoesriitsiofno.oIdf athbastorleumtealyinnsetcreaspspaerdy,init tchaensbeeals. Ppoesriotidoincecdleoanniitnsgbwacitkh. a damp sponge will prevent this fSroemaolcscurring. To remove spots or stains from the surface of the One of the factors that cause odors to form in the I8n.InssttaalllalatiotnioinnstruInctisotnructions interior, use a cloth dampened with water with a little vinegar, or a cleaning product made specifically for dishwashers. dishwasher is food that remains trapped in the seals. Periodic cleaning with a damp sponge will prevent this from occurring. 8.Installation instruction Attention: The installation of the pipes ashnodAueltldetbectenridctoiaonl eneq:buyippmroefenstssionals. The installation of the pipes and electrical equipments should be done by professionals. Installation preparation Warning Electrical Shock Hazard Warning Disconnect electrical power before installing dishwasher. Electrical Shock Hazard DFaisilcuornenteocdtoesleocctraicnarlepsouwlteinr bdefaotrheoirnestleaclltinrigcadlishwocaks.her. Failure to do so can result in death or electrical shock. The installation position of dishwasher should be near the existing inlet and drain Inhossteaslalandtipoonwepr rceorpd.aration One side of the cabinet sink should be chosen to facilitate the connection of drain Thohseeinssotfatlhlaetidoinshpwosaistihoenr.of dishwasher should be near the existing inlet and drain hoses and power cord. One side of the cabinet sink should be cho1s3en to facilitate the connection of drain hoses of the dishwasher. 13 User Manual 20 Positioning the Appliance Position the appliance in the desired location. The back should rest against the wall behind it, and the sides, along the adjacent cabinets or wall. The dishwasher is equipped with water supply and drain hoses that can be positioned to the right or the left to facilitate proper installation. About Power Connection WARNING! n For personal safety: Do not use an extension cord or an adapter plug n wDiothntohtiscuatpoprliarenmceo.ve the earthing connection from the power cord under any circumstances. Electrical Requirements Please look at the rating label to know the rating voltage and connect the dishwasher to the appropriate power supply. Use the required fuse 10 amp, time delay fuse or circuit breaker recommended and provide separate circuit serving only this appliance. Electrical Connection Insure proper ground exists before use Ensure the voltage and frequency of the power being corresponds to those on the rating plate. Only insert the plug into an electrical socket which is earthed properly. If the electrical socket to which the appliance must be connected is not appropriate for the plug , replace the socket, rather than using a adaptors or the like as they could cause overheating and burns. Water Connection Cold Water Connection Connect the cold water supply hose to a threaded 3/4(inch) connector and make sure that it is fastened tightly in place. If the water pipes are new or have not been used for an extended period of time, let the water run to make sure that the water is clear and free of impurities. If this precaution is not taken, there is a risk that the water inlet can get blocked and damage the appliance. WARNING! please close the hydrant after using. 14 21 esatto.house Connection of drain hoses Insert the drain hose into a drain pipe with a minimum diameter of 4cm, or let it run into the sink, making sure to avoid bending or crimping it. Use the special plastic support that comes with the appliance. The free end of the hose must be at a height lower than75cm and must not be immersed in water to avoid the back flow of it. Attention: The special plastic hose support must be solidly fastened to the wall to prevent the drain hose from moving and allowing water to spill outside the drain. PLEASE HANG UP THE DRAIN HOSE EITHER WAY OF A, B NOTE The top of the hose must be less than 750mm. Front A Drain pipe B MAX 750mm Counter 40mm 15 User Manual 22 How to Drain Excess Water From Hoses If the sink is 1000 higher from the floor, the excess water in hoses cannot be drained directly into the sink. It will be necessary to drain excess water from hoses into a bowl or suitable container that is held outside and lower than the sink. Water Outlet Connect the water drain hose. The drain hose must be correctly fitted to avoid water leaks. Ensure that the water drain hose is not kinked or squashed. Extension Hose If you need a drain hose extension, observe to use a similar drain hose. It must be no longer than 4 metres; otherwise the cleaning effect of the dishwasher could be reduced. Start of dishwasher The following things should be checked before starting the dishwasher. 1 The dishwasher is level and fixed properly 2 The inlet valve is open 3 Inlet hose connections are fully tightened and not leaking 4 The wires are tightly connected 5 The power is switched on 6 The inlet and drain hoses are knotted 7 All packing materials and printings should be taken out from the dishwasher Attention: After installation, please make sure to keep this manual. The content of this manual is very helpful to the users. 16 23 esatto.house Troubleshooting 9.Troubleshooting Tips Before Calling for Service Review the charts on the following pages may save you from calling for service. Problem Dishwasher doesn't start Possible Causes Fuse blown, or the circuit breaker tripped. Power supply is not turned on. What To Do Replace fuse or reset circuit breaker. Remove any other appliances sharing the same circuit with the dishwasher Make sure the dishwasher is turned on and the door is closed securely. Make sure the power cord is properly plugged into the wall socket. Technical problems Water not pumped from dishwasher Door of dishwasher not properly closed. Kink in drain hose Filter clogged. Kitchen sink clogged. Suds in the tub Improper detergent Stained tub interior White film on General inside surface problems Spilled rinse-aid Detergent with colourant was used. Hard water minerals Noise There are rust stains on cutlery The affected items are not corrosion resistant. A programme was not run after dishwasher salt was added. Traces of salt have got into the wash cycle. Knocking noise in the wash cabinet Rattling noise in the wash cabinet The lid of softer is loose. The spray arm is knocking against an item in a basket. Item of crockery are insecure in the wash cabinet. Knocking noise in the water pipes This may be caused by on-site installation or the cross-section of the piping. Closed dishwasher making sure that door latches. Check drain hose. Check the coarse filter. (see section titled " Cleaning The Filter ") Check kitchen sink to make sure it is draining well. If problem is kitchen sink not draining ,you may need a plumber rather than a serviceman for dishwasher. Use only the special dishwasher detergent to avoid suds. If this occurs, open the dishwasher and let suds evaporate. Add 1 gallon of cold water to the tub. Close and latch the dishwasher, then Start any wash cycle to drain out the water . Repeat if necessary. Always wipe up rinse-aid spills immediately. Make sure that the detergent is the one without colourant. To clean the interior, use a damp sponge with dishwasher detergent and wear rubber gloves. Never use any other cleaner than dishwasher detergent for the risk of foaming or suds. Always run the Quick wash programme . without any crockery in the dishwasher and without selecting the Turbo function (if present), after adding dishwasher salt. Check the lip .Ensure the fix is fine. Interrupt the programme, and rearrange the items which are obstructing the spray arm. Interrupt the programme, and rearrange the items of crockery. This has no influence on dishwasher function. if in doubt, contact a suitably qualified plumber. 17 User Manual 24 Problem The dishes are not clean Unsatis -factory washing result Cloudiness on glassware Black or gray marks on dishes Detergent left in dispenser cups The dishes are not drying Unsatis -factory drying result Possible Causes The dishes were not loaded correctly. The programme was not powerful enough. Not enough detergent was dispensed. Item are blocking the path of spray arms. The filter combination in the base of wash cabinet is not clean or is not correctly fitted. This may cause the spray arm jets to get blocked. Combination of soft water and too much detergent. Aluminum utensils have rubbed against dishes. Dishes block detergent cups. Improper loading What To Do See notes in " Loading the Dishwasher Baskets ". Select a more intensive programme. See" Wash Cycle Table ". Use more detergent, or change your detergent. Rearrange the items so that the spray can rotate freely. Clean and/or fit the filter combination correctly. Clean the spray arm jets. See "Cleaning the Spray Arms". Use less detergent if you have soft water and select a shortest cycle to wash the glassware and to get them clean. Use a mild abrasive cleaner to eliminate those marks. Re-loading the dishes properly. Load the dishwasher as suggested in the directions. Too little rinse-aid Dishes are removed too soon. Wrong programme selection Using cutlery with a low-quality coating Increase the amount of rinse-aid/Refill the rinse-aid dispenser. Do not empty your dishwasher immediately after washing. Open the door slightly so that the steam can escape. Begin unloading the dishwasher only once t he dishes are barely warm to the touch. Empty the low basket first. This prevents water form dropping off dishes in the upper basket. In short programmes the washing temperature is lower. This also lowers cleaning performance. Choose a programme with a long washing time. Water drainage is more difficult with these items. Cutlery or dishes of this type are not suitable for washing in the dishwasher. Error Codes When some malfunctions come on, the appliance will display error codes to warn you: Codes The Rapid light flicker fleetly Meanings Longer inlet time. Possible Causes Faucets is not opened, or water intake is restricted, or water pressure is too low. The Rapid and 90min light flicker fleetly Not reaching required temperature. Malfunction of heating elenent. The Glass light flicker fleetly Overflow. Some element of dishwasher leaks . WARNING! n n If overflow occurs, turn off the main water supply before calling a service. If there is water in the base pan because of an overfill or small leak, the water should be removed before restarting the dishwasher. 18 25 esatto.house Technical Information Technical Information 550mm 590mm 500mm 964mm Height : Width : Depth : Voltage connected Load : Water pressure: Power supply: Capacity: 590mm 550mm 500mm see rating label 0.04-1.0MPa see rating label 8 Place settings User Manual 26 Purchase Details For future reference, please record the following information which can be found on the rating plate and the date of purchase which can be found on your sales invoice. STORE DETAILS STORE NAME | ADDRESS | TELEPHONE | PRODUCT DETAILS MODEL NO. | SERIAL NO. | PURCHASE DATE | 27 esatto.house Attach your receipt to this page User Manual 28 Warranty Information AUSTRALIA WARRANTY TERMS & CONDITIONS DISHWASHERS This document sets out the terms and conditions of the product warranties for Residentia Group Appliances. It is an important document. Please keep it with your proof of purchase documents in a safe place for future reference should you require service for your Appliance. 1. IN THIS WARRANTY (a) `acceptable quality' as referred to in clause 10 of this warranty has the same meaning referred to in the ACL; (b) `ACL' means Trade Practices Amendment (Australian Consumer Law) Act (No.2) 2010; (c) `Appliance' means any Residentia Group product purchased by you accompanied by this document; (d) `ASR' means Residentia Group authorised service representative; (e) `Residentia Group' means Residentia Group Pty Ltd of 165 Barkly Ave, Burnley VIC 3121, ACN 600 546 656 in respect of Appliances purchased in Australia; (f ) `major failure' as referred to in clause 10 of this warranty has the same meaning referred to in the ACL and includes a situation when an Appliance cannot be repaired or it is uneconomic for Residentia Group, at its discretion, to repair an Appliance during the Warranty Period; (g) `Warranty Period' means: (i) where the Appliance is used for personal, domestic or household use (i.e. normal single family use) as set out in the instruction manual, the Appliance is warranted against manufacturing defects for 24 months, following the date of original purchase of the Appliance; (h) `you' means the purchaser of the Appliance not having purchased the Appliance for re-sale, and `your' has a corresponding meaning. 2. This warranty only applies to Appliances purchased and used in Australia and is in addition to (and does not exclude, restrict, or modify in any way) any non-excludable statutory warranties in Australia. 3. During the Warranty Period Residentia Group or its ASR will, at no extra charge if your Appliance is readily accessible for service, without special equipment and subject to these terms and conditions, repair or replace any parts which it considers to be defective. Residentia Group or its ASR may use remanufactured parts to repair your Appliance. You agree that any replaced Appliances or parts become the property of Residentia Group. This warranty does not apply to light globes, batteries, filters, seals or similar perishable parts. 4. Parts and Appliances not supplied by Residentia Group are not covered by this warranty. 29 esatto.house 5. You will bear the cost of transportation, travel and 10. For Appliances and services provided by Residentia delivery of the Appliance to and from Residentia Group Group in Australia, the Appliances come with a or its ASR. If you reside outside of the service area, guarantee by Residentia Group that cannot be you will bear the cost of: excluded under the Australian Consumer Law. You (a) travel of an authorised representative; are entitled to a replacement or refund for a major (b) transportation and delivery of the Appliance to and failure and for compensation for any other reasonably from Residentia Group or its ASR, in all instances, foreseeable loss or damage. You are also entitled unless the Appliance is transported by Residentia to have the Appliance repaired or replaced if the Group or its ASR, the Appliance is transported at Appliance fails to be of acceptable quality and the the owner's cost and risk while in transit to and from failure does not amount to a major failure. The benefits Residentia Group or its ASR. to you given by this warranty are in addition to your other rights and remedies under a law in relation to the 6. Proof of purchase is required before you can make Appliances or services to which the warranty relates. a claim under this warranty. 11. At all times during the Warranty Period, Residentia 7. You may not make a claim under this warranty unless Group shall, at its discretion, determine whether repair, the defect claimed is due to faulty or defective parts replacement or refund will apply if an Appliance has a or workmanship. Residentia Group is not liable in the valid warranty claim applicable to it. following situations (which are not exhaustive): (a) the Appliance is damaged by: (i) accident (ii) misuse or abuse, including failure to properly maintain or service 12. Missing parts are not covered by warranty. Residentia Group reserves the right to assess each request for missing parts in a case by case basis. Any parts (iii) normal wear and tear that are not reported missing in the first week after (iv) power surges, electrical storm damage or purchase will not provide free of charge. incorrect power supply (v) incomplete or improper installation 13. To enquire about claiming under this warranty, please (vi) incorrect, improper or inappropriate operation follow these steps: (vii) insect or vermin infestation (a) carefully check the operating instructions, user manual (viii) failure to comply with any additional instructions and the terms of this warranty; supplied with the Appliance; (b) have the model and serial number of the Appliance (b) the Appliance is modified without authority from available; Residentia Group in writing; (c) have the proof of purchase (e.g. an invoice) available; (c) the Appliance's serial number or warranty seal has (d) telephone the numbers shown below. been removed or defaced; (d) the Appliance was serviced or repaired by anyone 14. You accept that if you make a warranty claim, other than Residentia Group, an authorised repairer Residentia Group and its ASR may exchange or ASR. information in relation to you to enable Residentia Group to meet its obligations under this warranty. 8. This warranty, the contract to which it relates and the relationship between you and Residentia Group are IMPORTANT governed by the law applicable where the Appliance Before calling for service, please ensure that the steps was purchased. in point 13 have been followed. 9. To the extent permitted by law, Residentia Group excludes all warranties and liabilities (other than as contained in this document) including liability for any loss or damage whether direct or indirect arising from your purchase, use or non use of the Appliance. Service: Please call 1300 11 HELP (4357) Spare parts: Please call 1300 11 SPARE (7727) The Australian Consumer Law requires the inclusion of the following statement with this warranty: Our goods come with guarantees that cannot be excluded under the Australian Consumer Law. You are entitled to a replacement or refund for a major failure and for compensation for any other reasonably foreseeable loss or damage. You are also entitled to have the goods repaired or replaced if the goods fail to be of acceptable quality and the failure does not amount to a major failure. User Manual 30 This page is intentionally left blank 31 This page is intentionally left blank esatto.house This page is intentionally left blank Appliances Exactly what you need A RESIDENTIA GROUP INITIATIVE