Kitchen Appliances, Sinks, Taps & Kitchen Furniture | Caple
Manual-Hub.com - Free English product PDF Documents!
Instruction Manual for caple models including: DI631 Dishwasher, DI631, Dishwasher
CAPLE DI631 (01) PDF MANUAL - MANUAL-HUB.COM
CAPLE DI631 (01) - Google Drive
File Info : application/pdf, 25 Pages, 5.78MB
DocumentDocumentDishwasher Instruction Manual DI631 Contact Caple on 0117 938 7420 for spare parts or www.caple.co.uk https://manual-hub.com/ CONTENTS Warnings 3 Environmental Protection 8 Quick Operation Guide 9 Control Panel 10 Dishwasher Features 11 Loading the Dishwasher Baskets 19 Programming the Dishwasher 25 Cleaning and Maintenance 28 Installation Instruction 32 Troubleshooting 41 Technical Information 44 Caple Contact Details 48 2 Instruction manual DI631 Please keep this instruction manual for future reference SAFETY INSTRUCTIONS - This product is not designed for commercial use, it is a household appliance only. It is not intended to be used in: · Staff kitchen areas in shops, offices and other working environments. · Bed and breakfast type environments. · By clients in hotels, motels and other residential type environments. - This appliance can be used by children aged from 8 years and above and persons with reduced physical, sensory or mental capabilities or lack of experience and knowledge if they have been given supervision or instruction concerning use of the appliance in a safe way and understand the hazards involved. Children shall not play with the appliance. Cleaning and user maintenance shall not be made by children without supervision. - This appliance is not intended for use by persons (including children) with reduced physical, sensory or mental capabilities, or lack of experience and knowledge, unless they have been given supervision or instruction concerning use of the appliance by a person responsible for their safety. - This appliance is for indoor household use only. - To protect against the risk of electrical shock, do not immerse the unit, cord or plug in water or other liquid. - Please unplug before cleaning or performing maintenance on the appliance. Please keep this instruction manual for future reference Instruction manual DI631 3 https://manual-hub.com/ - Use a slightly moistened soft cloth with mild soap, and then use a dry cloth to wipe it again. - This appliance must be earthed. In the event of a malfunction or breakdown, earthing will reduce the risk of an electric shock by providing a path of less resistance of electric current. This appliance is equipped with a cord having an equipment-earthing conductor and a grounding plug. - The plug must be plugged into an appropriate outlet that is installed and earthed in accordance with all local codes and regulations. - Improper connection of the equipment-earthing conductor can result in the risk of an electric shock. - Check with a qualified electrician or Caple service representative if you are in doubt whether the appliance is properly grounded. - Do not modify the plug provided with the appliance; If it does not fit the outlet. - Have a proper outlet installed by a qualified electrician. - Do not abuse, sit on, or stand on the door or dish rack of the dishwasher. - Do not operate your dishwasher unless all enclosure panels are properly in place. - Open the door very carefully when the dishwasher is operating, there is a risk of water squirting out. - Do not place any heavy objects on or stand on the door when it is open. The appliance could tip forward. - When loading items to be washed: · Locate sharp items so that they are not likely to damage the door seal. · Warning: Knives and other utensils with sharp points must be loaded in the basket with their points down or placed in a horizontal position. - Check that the detergent powder is empty after completion of the wash cycle. - Do not wash plastic items unless they are marked dishwasher safe or the equivalent. - For plastic items not marked, check the manufacturer's recommendations. - Use only detergent and rinse additives designed for an automatic dishwasher. - Never use soap, laundry detergent, or hand washing detergent in your dishwasher. - Children should be supervised to ensure that they do not play with the appliance. - The door should not be left open, since this could increase the risk of tripping. - The appliance may only be used with correctly adjusted door springs. 4 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 5 - If the supply cord is damaged, it must be replaced by Caple, its service agent or a similarly qualified person in order to avoid a hazard. - During installation, the power supply must not be excessively or dangerously bent or flattened. - The dishwasher must not be installed under a hob. - Do not tamper with controls. - The appliance is to be connected to the water mains using new hose sets and that old hose-sets should not be reused. - The maximum permissible inlet water pressure is 1MPa. - The minimum permissible inlet water pressure is 0.04MPa. WARNINGS: - Packaging material could be dangerous for children! - For disposing of package and the appliance please go to a recycling centre. Therefore cut off the power supply cable and make the door closing device unusable. - Cardboard packaging is manufactured from recycled paper and should be disposed in the waste paper collection for recycling. - By ensuring this product is disposed of correctly, you will help prevent potential negative consequences for the environment and human health, which could otherwise be caused by inappropriate waste handling of this product. - For more detailed information about recycling of this product, please contact your local council office and your household waste disposal service. - DISPOSAL: Do not dispose this product as unsorted municipal waste. Collection of such waste separately for special treatment is necessary. 6 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 7 For detailed operating m ethod read the corresponding content on the instruction manual. QUICK OPERATION GUIDE Switch on the ap pliance OFpoenr dtheetadiloeodr,oppreesrsattihneg Omne/tOhfofdbruettaodn tthoescwoitrcrhesopnotnhdeinagppcloianntceent. on the instruction manual. For detaiSlweidtchoonpteheraaptpinliagncemethoOdpernetaheddotohr,perecssotrhreeOsnp/Ooffnbudttionn gto scwoitcnhtoennthte oapnpliatnhcee . instruction manual. ENVIRONMENTAL PROTECTION Switch on the appliance Open the door,press the On/Off button to switch on the appliance Waste electrical products should not be disposed of with household waste. Please recycle where facilities exist. Check with your Local Authority or retailer for recycling advice. This appliance is With each waCsohmcypcaler.tment A: Fill the dete rgent dispeFnillstehre dFeitllethrgeCedonetmte rpgeanrttmdisepnentWseirth eachWiwthaesahchcwyacsleh.cycle. Compartment marked according to the European Directive on Waste Electrical and Electronic Equipment (WEEE). dispenser For programmCeosmwpitahrpFtmorer -pewrnoagtrsaBhm:moenslyw. ith pre-wash only. (Follow the usFeorr ipnrsotrgurc(aFtmoiollmonwse!ts)hewuistehr ipnsrteruwctaiosnhs!)only. AA BB (Follow the user instructions) By ensuring this product is disposed of correctly, you will help prevent potential negative consequences for the environment and human health, which could otherwise be caused by inappropriate waste handling of this product. The symbol on the product indicates that this Check the rinse aid lCAevhideelclekvtehl eCRheincEksletehcetrrinicseinadidicleavMEetloleercctorhnicacninoEidcnleiatccrltaoritIclonpinrdadoiniccneaatloct(rooiofnrnptcrCrooo:nlvtrpiodalepndaen)l.el (if provided). (On models with water softener system only.) product may not be treated as household waste. Instead it shall be handed over to the applicable collection point for the recycling of electrical and electronic equipment. Disposal must be carried out in accordance with local environmental regulations for waste disposal. For more detailed information about treatment, recovery and recycling of this product, please contact your local council, your household waste disposal service or the retailer where you purchased the product. Check the regeneraCstiaohlnet clekvtehleCrheeg(EceOklnetnshecaerlmttarrleietocgivdoeeinnneledlrsiactwiaoEntiltoehrcwtorniactceinorEI(tfhfdnlsoeetithroccrestosafrotriotlceefomtpinenirseaendoninermcnoraesotblyoscdy(rsaoeioflttlnthesnpwte)mcr,raooonyrnlouvontrmupiinodnalclbgeypnae.dla)nriegn)lo.heefltsc(tiinifymcptalhreoteesvicdtwheohdene)t.drnoislthopwafianllsethlheershaaltsinruton. salt level If there is no salt warning light in the control panel Load the basLk(tohefaotedsrthsseoobfmatsekenetemsrSloobcdaryadeptlthsehe)eo, fnybStfhcaouearnsamunkplyoeecbatloadesaf.fnrrthagReoneeeybffsaaleactsmrriykgmeteocotsaulae.mtntRhestoeeufotwenhdfrtheitolosefehtlfdehntwefiotsoavtdhvoseieshwrhrfewfifaolroalosoldthohh.deaSee.rdolSrofistonaehadfngatilnretsiegnnmiinsnrnrtustearotnrunmutc.csnttoiioaofnnbnstu.ssrnot ffoobduirnnptafnos,od in pans, then Load the Select baske ts a proSgerStleahccmetrnaamppleoreoagodraffmthameneP"ybroaelapsserskgreatehttsiaeo.P(mnPRSreoreeisoenusfgesntthrthrtaereutomoPscfermttolciehgoteiefrontanob"mdveu)minestetthritolBwefnoudat"otusodOnnh.tpeuiSenlrrtotaillhotfittoeahendenriesinnreqsegleturmcuiintrcenetsdiaodtpnrnu"rpotcsrg)otroiagomfrnabmsmue. rlminghtetfsoliuogpdh. tisnuppa.n(Sse, e the section entitled Running the dishwasher Close the door. The machine will start working at once. CE DECLARATIONS OF CONFORMITY This appliance has been manufactured to the strictest standards and complies with all applicable legislation, Low Voltage Directive (LVD) and Electromagnetic Compatibility (EMC). W A R R A N T Y: Your new appliance is covered by warranty. The warranty card is enclosed - if it is missing, you must provide the following information to your retailer in order to receive a replacement: date of purchase, model and serial number (placed on the inside of the appliance storage drawer). Registration can also be completed online by visiting www.caple.co.uk. Ensure you keep your warranty card safe, you may need to show it to Caple Service together with proof of purchase. If you fail to show your warranty card you will incur all repair charges. Spare parts are only available from Caple Service and spare parts authorised centres. 8 Instruction manual DI631 Please keep this instruction manual for future reference Select a programm e RunnPinrgetshse ( See tdthhiseehwPsaersohc1egt.riroAfaonmrreumannestnihtTilBnoeugurrdntt"cottoynimOnctlhepeue.encwOrtaaailttnethirtooehtnarnewplyisi,nsceblesolestertecuhmttceheoteddidodeiopnftio"reerodr.gg)Tirehfaneimttmhmmaacaehsiynlbieghewhaeivtlnlsesrtuaaurplntr.ewnaoinrdkgiyng a fter about 10 seconds. been released and the water already drained. If this is the Changing the programmecase, t1mh.aeAydrhueanvtneei nragglrceeyancdlteydcbiaesnepnoenrnelylsebeaers emmdouadnsifditetdbhieef iwtrehafateislrlbeaeldree.nadruyndnrianign for ed. a If shor t time. Otherwise the detergent this is the case, the detergent dispenser must be refilled. Runnin g the dishwasChhearnging theT urn on the w2a.tOerpteanp23th..,OPcelrpoedessnosetothhtre.ehdePorodor.ogroarm.mTehBeumttoancfhorinmeo rwe itlhlasnta3 rstewcoondrksitnogcaanfcteel rthaebroununtin1g0prsogercaomnmdes. . 4. Select a new prog ramme. programme 5. Restart the dishwasher. 3. Press the Programme Button for 3 seconds to cancel the Add forgotten dishwash er. dishe s in threunnin12g..OApfpteerrontghthereasmdporamoyr eaa.rlmittslesttoopstowportkhiengd,isyhowuacsahnero.pen the door co mpletely. Open the door care fully. Hot steam may esc ape Changing the programme W A R N I N G : 1m.aAyrhuanvneinaglrcey4ac.dlSeyecbleaecnet34noa..ACnrdnleoldyelseetwbhateehspefoemrdrodgoogooatdrrt,eanitnfhdmieedtmdidshhiieesefh.swiw.tahashateesrr wbiell setanrtrruunnnnininggagfaoinr already drain ed. Iaaf fsttehhriso1r0itstsitemhceoen.cdOas.sthewe,hrtewhneitshdeeetdtheoeorrgdiesenotetp ergnee dn!t If thediaspppeliannsceerismswuitscthebde refiIlflethde.app liance is switched off during a wash cycle, when switched off d2u.rinOgpaewnasth cey 3. Press the cdPleo5r.o.orC.glroasme oatmnchceaeogrddaBiiinnsgu,hpttwotleoatahnsseehforoereirrg-simdneaoleolocPrtroethwtetoehwrar-oaennssh3tsiantagrstteecty)ch.coleenaddnsidshtoowpecaraasthneecthere.l 4. Select a ne1w.Oprpoegnrathmemdeo.or a little to stop the dishwasher. dthishewraushnensritneOgamppemrnoatghyreaemdscoamopreec.awrheefunlltyh. eHodtoor 5. Restart the dishwasher. is opened! When the working cycle has finished, the buzzer of the Add forgotten dishwash er. dishe sAinddthfeorgoSttwe12intc..hOAdofiptsffeehtrhneetshthaepepslidapnor2caoe.yrcAaoaftmrlemi tprtsllteehdTstiutesetorohnlswypspo.atfwofrsahtphoyeerrtakhwairpeinmlplglsdisao,insuyscnhtoedowuup8asctisiwnmaghnoeetshror,ke.tpihOneegnnn/,OstytfohfopBeu.udtctooanon.r open the door co mpletely. in the dishwa3s.Ahedrd. the forgotten dishes. Open the door care fully. Hot steam may esc ape when the door is opened! If the app liance is switched TuunrI4lonf.aCtohdffleotthhseaeepbwatpahstlkeieeartntsdacop34e,o..rACi,sldtohsdsewetihdttWtTceihhshheaeheferodnywdiirsnwaoghgoilseoo:lfshafrwt,tlaesadetnoirhtundadweruridfyntiedelilwbgsniesshsamthtietaleswisnwrr.w.utUaathenrsisulslheohn(aetanhdrcbeiynotwyhucgeaitllera1lae5p,sgspmtwtlaaiilailihrnnnhtuecoterentau,safs)snnttebwdanerrmitifnitonocg1rgerhe0faeursongdumslosaecatichnedeopintnligobdwltehseetro.dbbiasrshekwaekat..sher to avoid handling off during a wash cycle. on again, please re-select the washing cycle and o perate the dishwasher If the appliaanccceoridsing switched off during a wash cycle When the to theIfotrhigeianpapl Pliaonwceeri-sonswstitacthee)d. off during a wash cycle, when switched on again, please re-select the washing cycle and operate the dishwasher according to the original Power-on workisntgatcey).cle has finished, the buzze5r of the Switch off the applianc e dishwasher will soun d 8 times, then stop . Turn off the appliance using th e On/Off Button. When the working cycle has finished, the buzzer of the dishwasher will sound 8 times, then Switch off the appliance stop. Turn off the appliance using the On/Off Button. Since the appliance is standing by, it will power off automatically after 30 minutes without any operation. Turn off unload the water the basket tap, sUnload the Wtheardniisnhge: swaanitdWaufteAewnRsmilNsinwuIthNeilseG(tah:beWoyuaatirt1e5asmfteilwilnhumotetinsa)untbdeesmfo(oarerbeousunutlos1ca5edmpintigbnlutehteetosd)bibsrhefwaokar.eshuenrlotoadaivnogidthheadnidslhinwgasher DTishhewyawsihllearlsotdoryavboeitdtehr.aUnndlloinagd tthhee daipsphleiasnacned, suttaerntsinilgs fwrohmileththeelyowareer sbtaillshkeott. and more susceptible to break. They will also dry better. Unload the appliance, starting from the lower basket. Please keep this instruction manual for future reference Instruction manual DI631 9 https://manual-hub.com/ To get the best performance from your dishwashe r, read all operatin g instructions C O N T R O L P A N E L before usin g it for the first time. DISHWASHER FEATURES 1 2 3 4 Front View Back View 1 To get the best performance from your dishwashe r, read all operatin g instructions 2 before usin g it for the first time. 1. D isp lay in dic ato rs :to sh ow th e e rror c od e, 2.Delay Button : To press the button to delay. 3 1. DisdRpeinllaasyyetAiinmideiinneddtciicc.aattoor:rs: to show the error codIned,icdaetelasywthiemnetheetdci.spenser needs to be refilled. Add salt indicator: 2.3.PwDraoesglharayPmrboBugurtatttomonn. :: To press the button to select a 4.OTPonr/teousrffsn oBtnhu/teotfofbnthu:ettpoownertosudppelyla. y. 4 5 Indicates when the dispenser needs to be refilled. 6 » RinDseelaAyitdimien:d3/i6c/a9tohor:urs option 3. Programme button: IndPicroagtreasmwinhdeicnatdorissp: enser needs to Press the button to select a 7 be refilled. wash programme. 8 9 10 11 12 » Add salt indicator: 4. On/off Button: 1Ibn.edDridcReisaefiipntllaellseaysedywtA.iimnihddeeiinncedadtcitico.saprsteo:ntro:sesrhnoewedthsetoerror c od e, To turn2o.fDf eTlhaey pBouwttoenr s:uTpopplyr.ess the button to delay. 3.Program Button : To press the button to select a wash Program. 1. Top Spray Arm Indicates when the dispenser needs to be refilled. 4.On/off Button: » DelaAInyddtdiicmsaaetel:ts3in/w6dh/ic9eanhtotohru:ersdiosppteionsne. r needs to be refilled. To turn on/off the power supply. 2. Cutlery Tray Delay time:3F/6ro/n9t hvoieuwrs option » ProgPrraomgmraemininddicicaattoorrss:: Back View 3. Upper Basket 7. Dispenser 8. Cup Shelf 9. Spray Arms 4. Inner Pipe 10. Filter Assembly 1 6 2 3 4 7 8 5 5. Lower Basket 6. Salt Container 11. Inlet Pipe Connector 12. Drain Pipe PRIOR TO USING FOR THE FIRST TIME Before using your dishwasher for the first time: Front view 9 Back View 10 » Set the water softener. 11 » Add 1.5Kg dishwasher salt and then fill the salt container with water. 1 1 Upper Basket 4 Salt Container 6 7 Spray arms 10 Drain pipe 2 Inner pipe 5 Dispenser 2 3 Lower Basket 6 Cup Shelf 8 Filter assembly 9 Inlet pipe connector 11 Adjuster 3 4 67 8 » Fill the Rinse Aid dispenser. » Fill in detergent. 10 Instruction manual DI631 Please keep this instruction manual for future reference 5 https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 11 WATER SOFTENER The water softener must be set manually, using the water hardness dial. The water softener is designed to remove minerals and salts from the water, which would have a detrimental or adverse effect on the operation of the appliance. The higher the content of these minerals and salts, the harder your water is. The softener should be adjusted according to the hardness of the water in your area. Your local Water Authority can advise you on the hardness of the water in your area. ADJUSTING SALT CONSUMPTION The dishwasher is designed to allow for adjustment in the amount of salt consumed based on the hardness of the water used. This is intended to optimise and customise the level of salt consumption. Please follow the steps below for adjustment in salt consumption: 1. Open the door and Switch on the appliance. 2. Press the Programme button for more than 5 seconds to start the water softener setting within 60 seconds after the appliance was switched on (The Salt and Rinse Aid warning lights will be on periodically when it is in this setting mode). 3. Press the Programme button to select the proper set according to your local environment, the sets will change in the following sequence: H1->H2->.H3->H4->H5->H6; 4. Press the Power button to end the set up model. °DH 0~5 6-11 12-17 18-22 23-34 35-55 WATER HARDNESS °FH °CLARKE 0~9 10-20 21-30 31-40 41-60 61-98 0~6 7-14 15-21 22-28 29-42 43-69 MMOL/L 0~0.94 1.0-2.0 2.1-3.0 3.1-4.0 4.1-6.0 6.1-9.8 Selector Position Salt consumption (gram/cycle) H1 0 H2 9 H3 12 H4 20 H5 30 H6 60 Contact your local water board for information on the hardness of your water supply. WATER SOFTENER The hardness of the water varies from place to place. If hard water is used in the dishwasher, deposits will form on the dishes and utensils. The appliance is equipped with a special softener that uses a salt container specifically designed to eliminate lime and minerals from the water. LOADING THE SALT INTO THE SOFTENER Always use salt intended for use with dishwashers. The salt container is located beneath the lower basket and should be filled as explained in the following: ATTENTION: » Only use salt specifically designed for the use in dishwashers. Every other type Alwayosfussaelt snaolt isnpteecnifdiceadllyfodreussigenwedithfodristhwe aussheeirns.a dishwasher, especially table salt, will damage The in th s e atfholtelclwoowantitenargins:oefrteisnelor.cInatceadseboefndeaamthagthees cloawuseerdbbaystkheet uasnedosf huonusulditabbelefilslaeldt tahse emxapnluafiancetdurer does not give any warranty nor is liable for any damages caused. Attention! Os»anltlOynnuolsyt esfiplsleawcltiitfshicpsaealclltyifjiducesatslbliygendfoeerdesifsgotnarertthdinefgouorsnteheeionufasthedeiisnchodwmisaphslewhteearsw, heaesshrpsien! gcEipavrelloyrgytraaombthlmeeerssta.ylTpth, eiwsoiwlflill damparegveentht eanwyagtrearinssooftfesnaeltr.oIrnsaclatysewoatfedr,awmhaicghems acyauhsaevedbbeyetnhsepuillseed,orfeumnasinuiintagbolne the saltbtohtetommaonfutfhaecmtuarechridneoefosrnaontygpievreioadnoyfwtiamrer,awnthyicnhomr iasylciaabulsee fcoorrraonsiyodn.amages caused. Only fill with salt just before starting one of the complete washing programs. This will prevent any grains of salt or salty water, which may have been spilled, remaining on the bottom of the machine for any period of time, which may cause corrosion. 1 2 NOTE: 1 °dH=1.25 °Clarke=1 1.78°fH=0.178mmol/l °dH: German degree °fH: French degree °Clark: British degree NOTE: 2 The manufactory setting: H3 (EN 50242) 12 Instruction manual DI491 Please keep this instruction manual for future reference A After the lower basket has been removed, unscrew and remove the cap from the salt container. B Place the end of the funnel (supplied) into the hole and insert about 1.5kg of dishwasher salt. C Fill the salt container with water,It is normal for a small amount of water to come out of the salt c ontainer. D After filling the container, screw the cap tightly back on, turning clockwise. E The salt warning light will turn off after the salt container has been filled with salt. F Immediately after filling the salt into the salt container, a washing program should be started (We suggest to use a sh program). Otherwise the filter sysPlteeasme k, epeputhmispinsotrrucotiothn emraniumalpfoor rfuttaurnetrepfearerntcse of Itnhsetmruaccthioinnemmaanyubael dDaIm49a1ged 13 by salty water. https://manual-hub.com/ » After the lower basket has been removed, unscrew and remove the cap from the salt container. (1) » Place the end of the funnel (supplied) into the hole and insert about 1.5kg of dishwasher salt. » Fill the salt container with water. It is normal for a small amount of water to come out of the salt container. (2) » After filling the container, screw the cap tightly back on, turning clockwise. » The salt warning light will turn off after the salt container has been filled with salt. » Immediately after filling the salt into the salt container, a washing programme should be started. Otherwise the filter system, pump or other important parts of the machine may be damaged by salty water. NOTE: 1. The salt container must only be refilled when the salt warning light in the control panel comes on. Depending on how well the salt dissolves, the salt warning light may still be on even though the salt container is filled. 2. If there are spills of the salt, a soak or a rapid programme should be run to remove the excessive salt. WHEN TO REFILL THE RINSE AID DISPENSER The Rinse Aid warning light in the control panel will illuminate when the dispenser needs re-filling. You can also estimate the remaining amount from the colour of the optical level indicator "C" located next to the cap. When the Rinse Aid container is full, the whole indicator will be dark. As the Rinse Aid diminishes, the size of the dark dot decreases. You should never let the Rinse Aid level fall 1 / 4 full. When to RefWillhtehne tRoi nRseefiAll itdh eDRisipnesensAeidr Dispe nse r As the Rinse Aid diminishes, the size of the black dot on the Rinse Aid level indicator changes, as illIoitunhffstdethtihcrreeaianrtetoseoF¾peirdsutawinlcfbiliuadolellllrlblelioenevvwsedeel:al-fraiankilddlIoit.n1fhAiwfctdest/ahaihc4rettreiohanrnfreeutosio"npleirClrsg.itnawi"nclisliiadooglellchlr-beliaatenevtiivsneeddeedltadl-fhrainainmekielddl.cix1Ainwcotis/antsao4tthtrohrntfeorehuis"nllerCl,pgi.ntca"hlaslinogeepech-s.laat,iWtiziynedehodtdeuohninmefcetatcixhnhnoteientseodhtrsraitenothrislsmke,pedtcaa-haoatneetpiedds.tl,hiWeczyeocehornaeuoetmnafactisoathnheuneeesCnred.trsiaiYsfn(trroRisofmkuueimdnal-slo,atsthetthiedohdte-uehecAcelocwdoirnadhelntomaoaeiuinsolvnereudeesnrir.ctlieYasfrtotfououmlrsl,)ththoheueclwdohlnooeulverer l ½ full As on the the rrii¼nnsseefuaaliildd-ldeSivmheiolnAoiuinsnsldhdttiehhcrseaee,trrfotiiihnnlrlesscetehsoiaaazniieeddglolideemfisvmt,iehnialneasiinsbtidhell alieuccsssakp,ttrotdoahrottecett ihsdnai zbgneegloeofswt,h.aesbi lack dot llustrate d below. FullEmpty Full 3 / 4 full 3 / 4 full 1 / 2 full 1 / 2 full 1 / 4 full - Should refil1l t/o4efluimll i-nSahteouslpdortetifnilgl to eliminate spotting Empty Empty 1 2 3 FILL THE RINSE AID DISPENSER RINSE AID DISPENSER The Rinse Aid is released during the final rinse to prevent water from forming droplets on your dishes, which can leave spots and streaks. It also improves drying by allowing water to roll off the dishes. Your dishwasher is designed to use liquid Rinse Aids. The Rinse Aid dispenser is located inside the door next to the detergent dispenser. To fill the dispenser, open the cap and pour the Rinse Aid into the dispenser until the level indicator turns completely black. The volume of the Rinse Aid container is about 110ml. FUNCTION OF RINSE AID Rinse Aid is automatically added during the last rinse, ensuring thorough rinsing, and spot and streak free drying. ATTENTION: Only use branded Rinse Aid for dishwasher. Never fill the Rinse Aid dispenser with any other substances (e.g. Dishwasher cleaning agent, liquid detergent). This would damage the appliance. 14 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ 1.1 2 2.3 TTPRoooeupoorplpatehceneenttrhhitenehsdceeiasappdideibsnyipns231teeionrn,stTPRhetsouoeereurpotrnidrp,lnaiettgsthhcnupieeeterttrhacnnhielnasiegsptedchenrtias,eoeappbdtideehcbwnieyainnsitgpteih"onorc,sttp"ahoteouerereprnttniefd"hnuintgs(lehl"pneieate"oftacrnt)orlastoiaogppewrnrerot,oeoavnbdwtnee"hrdwaiefnit(nitlgullh"de.rocnflp"aitiofner)tepgniefat"uiontr(llr"utneootaof.twtrt)rhtoaoewraorcnolavowndesrdaeflitnidlulfd.tr(nrliiiifgtnthgiott)ioutauttotr..rtohwe.clo sed (ri ght) a rrow. Pour the Rinse Aid into the dispenser, being careful not to overfill. 3. Replace thdCeulecriaannpgutbhpyeainnneysxretinrwtsiaensgahidC.diutDlesroaipannlinigl'gltuetfnhpdoeerawgdnnheeyiwtxlrettiointwdshruaeers"piahnloia.gdpcDfseeioplnltniihln"'lteegfdaocwrrawgirtphoehibtwlaeteonfdaorauenrbrepdisnlyoagtocrufbueirlelcntinhnliotegnscgcwelaoiditptthhisbtatheoonwfoaatarvhbesosehyiodeocrrbuelodexcsoncloeotescdrs.elsoidtvhiesthfoowaaavmsohiindegredxocoers.siv Ad(rjiguhst)tainrrogwR. iAndsejuAstiidnDg iRsipnesnesAeird Dispenser NOTE: The rinse ai d dispenser has s ix or four settings. Alway s sta rt w ith t The rinse ai d dispensseerthoans"s4i"x. Iof rsfpooutrssaentdtinpgoso.r Adlrwyianygsasrteaart wpriothbltehme ,diinscprenasserthe am Clean up any Rinse Aid spilled during safeiidltldoininsgp"4ew"n. isItfehsdpaboyntsraeambnaddsoiiosdvpihrodnbeoigsserptsdnhetretinylldsicaneilsrgodeptabenhrynoersttaedoemrpyaloirdnvvoigobanlpnigedrdmtohrep,oeexitndraclciytesripnesoegrsanisatvshereeetrhsdflheoiidaoaalawmtmnosodip"un5roong"tts.aoI,tffaintdrhigjneutsshetethdeiadl tia during the next wash. Don't forget todriesphelascsetilltahree cnaotpdrbyheiingfgoheprrerloeypvoeerurlyucnoltroilasyreoeusdrhidsoihswhwsepsaoasthrse,esarpdodjuto-sfotretrh.ee. Tdhiaelrteoctohmemnexntded set hig her lever unti l y ou(rFdai schtoersy avarelusepiost"-4fr"e.)e. Th e reco mm end ed setting is " 4". (Fac tor y value is " 4".) In crea se the do se if the re are d rops o f water or l ime sp ots on t he dishes af te In crea se the do se if thReerdeuacreeidt irfotphseroefawraetsetricokryl iwmheitsisphoststaoinn st hoen dyiosuhredsisahf teesrowraasbhliunigs.h fi lm on g Reduce i t i f there a re ksntiicfekyblwahdietiss.h stain s on your d ish es or a bluish fi lm on gl asswa re or kni fe bl ade s. Please keep this instruction manual for future reference Instruction manual DI631 15 Detergents with its ch emica l ingredients are necessary to remove dirt, crush dirt a nd tr anspo rt it out of the dish ADJUSTING RINSE AID DISPENSER Adjust lever (Rinse) The Rinse Aid dispenser has six settings. Always start with the dispenser set on "4". If spots and poor drying are a problem, increase the amount of Rinse Aid dispensed by removing the dispenser lid and rotating the dial to "5". If the dishes still are not drying properly or are showing spots, adjust the dial to the next higher lever until your dishes are spot-free. The recommended setting is "4". (Factory value is "4".) NOTE: Increase the dose if there are drops of water or lime spots on the dishes after washing. Reduce it if there are sticky whitish stains on your dishes or a bluish film on glassware or knife blades. FUNCTION OF DETERGENT Detergents with chemical ingredients are necessary to remove dirt, crush dirt and transport it out of the dishwasher. Most of the commercial quality detergents are suitable for this purpose. ATTENTION: Proper Use of Detergent: Use only detergent specifically made for the use in dishwashers. Keep your detergent fresh and dry. Don't put powdered detergent into the dispenser until you're ready to wash dishes. DETERGENTS There are 3 sorts of detergents 1.With phosphate and with chlorine 2.With phosphate and without chlorine 3.Without phosphate and without chlorine Normally new pulverised detergent is without phosphate. Thus the water softener function of phosphate is not given. In this case we recommend to fill salt in the salt container even when the hardness of water is only 6 dH. If detergents without phosphate are used in the case of hard water often white spots appear on dishes and glasses. In this case please add more detergent to reach better results. Detergents without chlorine do only bleach a little. Strong and coloured spots will not be removed completely. In this case please choose a programme with a higher temperature. CDODeNeteCterEgrNgeTenRntsAtsT E D D E T E R G E N T BT1a.hWsT1ee.hirWtedhiratpeohrheanpor3hsetops3hsohpesratohtiserratotascefnhodadfeendwtmdeeirtwtghieciertcaghnheltclsonhcrtloisonrmeinpe osition, detergents can be split in two basic types: 2.W2.iWthitphhpohsopshpahtea taenadnwdiwthiothuot ucthclohrlionreine »3.W3.CiWthoiotnhuotvupethnpothsioposhnpahateal,taeanadlnkwdaitwlhiniothueot ucdtheclotherlionrrgeineents with caustic components. NoNrmoramllaylnlyenwepwuplvuelvriesreisdeddedteertgeergnet nist wisitwhiothuot upthpohsopshpahtea.teT.hTuhsutshethweawteartesrosftoefnteenr efur nfucnticotnioonf of phpohsopshpahteaties nisont ogtivgeivne. nIn. Itnhitshcisacsaesweewreecreocmommemnedntdo tfoillfsilal sltailnt tinhethseasltacltocnotanitnaeinr eervevnewnhwehnen » Low alkaline concentrated detergents with natural enzymes. thethheahrdanrdensessosf owfawtearteisr oisnolyn6ly°6dH°d.HIf.dIfedteertgeergnetsnwtsitwhiothuot upthpohsopshpahteataerearuesuesdeidn itnhethceacsaesoef ohfahrdarwdawtearter oftoefntewnhwitheitsepsoptsotaspappepaer aornodnisdhisehseasnadngdlagslassese. sIn. Itnhitshcisacsaespelepalesaesaedaddmdomreordeedteertgeergnet ntot troearecahch bebtteetrterer sreusltusl.tsD.eDteertgeergnetsntwsitwhiothuot ucthclohrlionreindeodoonolynblylebalecahcahlaittlliett.leS.trSotnrognagnadncdocloouloreudredspsoptsowtsilwl nillont ot bebreemreomvoevdecdocmopmleptleeltye.lIyn. Itnhitshcisacsaespelepalesaescehcohoosoesaeparopgroragmramwitwhitahhaighhigehr eter mtepmepraetruarteu.re. DCECoTonEncRceGenEntNrtaTrateTtAeddBDLDeEetTetSergrgeennt t DBeaBtseaersdgeoednnotnhtetthiarecbirhlceehmtesimcoaiclfacdol cmifopfmeoprseoitsinoittnio,bndr,eadtenertdgeersgnedtsnitscsascnoalbnveebsepaslitpt lidintiitfnwfetowrboeanbsaitcssticyppteyepese:dss:. For this reason some detergent tablets cannot dissolve and develop their full cleaning cocnovnevnetinotnioanl,aal,lkaalklianleindeedteertgeergnetsntwsitwhitchacuasutisctcicocmopmopnoennetsnts lowloawlkaalklianleinceocnocnecnetrnattreadteddedteertgeergnetsntwsitwhitnhantuartaulraenl eznymzyemses power during short programmes. Therefore please use long programmes when using detergent tablets, to ensure the complete removal of dDetDeeretgeetnertgrrgeesenidntuaTt laTs.abbleletsts DeDteertgeergnet ntat btalebtlsetosf odfifdfeifrfenret nbtrabnradnsddsisdsisoslvoelvaet adtifdfeifrfenret nstpsepeedesd. sF.oFr othr itshrisearesaosnosnosmoeme D E T E R G E N T D I S P E N S E R dedteertgeergnet ntat btalebtlsetcsacnannont odtisdsisoslvoelvaenadnddedvevloeplotphethirefiur lflucllecalenainnginpgopwoewr edrudriunrginsghsohrtort propgroragmrasm. Ts.hTehrefroerfeorpelepalesaesuesuesleonlognpgropgroragmrasmwshwehneunsuinsgindgedteertgeergnet ntat btalebtlse,tsto, to enesnusreurtehethceocmopmleptleetreemreomvoavl aofl odfedteertgeergnet nret sreidsuidaulsa.ls. The dispenser must be refilled before the start of each wash cycle following the instructions pDroDevideteetdergirngethenentwDtaDsishispcypeclene sntaesberle.rYour dishwasher uses less detergent and Rinse Aid than cTohnTevhdeeisndpitseiponesnneasr elmrdumissuthsbtwebraeesfriehllfeeildlrebsd.ebfGoerfeeonrteheetrhasetlalsyrtt,aorotf noefalyecahocwhnaewsahtsachybclyleecslfeoplfoloolwloninwgiontfghedthieentsientrsrugtcrueticontnitosniss needed for a normal wash load. More heavily soiled items need more detergent. Always add propvroidveiddeidn tinhethweawsahschycyleclteabtaleb.leY.oYuor udrisdhiswhawsahsehr eursueselesslessdsedteertgeergnet natnadnrdinrsinesaeidaitdhathnan CoCnovnevnetinotnioanl adilsdhiswhawsahsehr.eGr.eGneenraelrlay,lloy,nolynolynoenteabtalebslepsopoonoonf odfedteertgeergnet nist niseneedeeddefdorfor the detergent just before starting the dishwasher, otherwise it could get damp and will not dissolve a naonrmoraml awlawsahslhoaloda. dM.oMreorheehaevailvyislyosiloeidleidteimtesmnseneedemdomreordeedteertgeergnet.nAt.lwAalwyasyasdaddtdhethe dedteertgeergnet njutsjut sbtebfoerfeorsetasrttainrtgintghethdeisdhiswhawsahsehr,eor,thoethrwerisweisitecitocuoldulgdegt edtadmapmapnadnwdilwl nilol nt ot properly. disdsisoslvoelvperopproeprleyr.ly. AAMAmOmoUouNunTnt otOofFDf DDeEeteTterEgrRgeGenEntNtoTtoUTUOsseUeS E NOTE: If tIhf ethleidlisd cislocsloesde: dp:repsressrselreealesaesbeubttuotnto. nT.hTehleidliwdilwl silpl sripnrginogpoepne. n. AlwAalwyasyasdaddtdhethdeedteertgeergnet njutsjut sbtebfoerfeorsetasrttainrtginegaecahcwhawsahschycylec.le. » If the lid is closedO:nOplynreulyssuessberreablnreadanedsdeeddebdteuerttgeterognnet na.tiTdahfidoerfodliridsdhiswwhaiwsllahssehrp.erri.ng open. » Always add the detergent just before starting each wash cycle. DDisishhwwaasshheer rddeetetergrgeennt tisisccoorrrorossivivee! ! » OTnTalyakukseeebcracanardeerdetdoettoekrgkeeenetepapiditfiotor oduisuthwtoaofshfreerr.eaacchhoof fcchhilidldrerenn. . 1010 16 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 17 WARNING: Dishwasher detergent is corrosive. Take care to keep it out of reach of children. FILL THE DETERGENT DISPENSER Fill the detergent dispenser with detergent. The marking indicates the dosing levels, as illustrated on the right: AB A The place of main wash cycle detergent placed. e B The place of pre-wash cycle detergent placed. ing. his detergent will take effect during the pre-wash phase. Please observe the manufacturers dosing and storage recommendations as stated on the detergent packaging. gent for the single programme on the last page. dgaatinodnsthoenCstplhoeescdeifeicttehhreagreldinndtepasasncdokfapgwrianegtse.sr duinffteirleintcleoscakrseipnopsslaibclee.. If the dishes are heavily soiled, place an additional detergent dose in the pre-wash detergent chamber. This detergent will take effect during the pre-wash phase. NOTE: » You find information about the amount of detergent for the single programme in the `Wash cycle table'. » Please be aware, that according to the level of soiling and the specific hardness of water, differences are possible. » Please observe the manufacturer's recommendations on the detergent packaging. LOADING THE DISHWASHER BASKETS RECOMMENDATION » Consider buying utensils which are identified as dishwasher-proof. » Use a mild detergent that is described as `kind to dishes'. If necessary, seek further information from the detergent manufacturers. » For particular items, select a programme with as low a temperature as possible. » To prevent damage, do not take glass and cutlery out of the dishwasher immediately after the programme has ended. THE FOLLOWING CUTLERY / DISHES: ARE NOT SUITABLE » Cutlery with wood, horn china or mother-of-pearl handles. » Plastic items that are not heat resistant. » Older cutlery with glued parts that are not temperature resistant. » Bonded cutlery items or dishes. » Pewter or copper items. » Crystal glass. » Steel items subject to rusting. » Wooden platters. » Items made from synthetic fibres. ARE OF LIMITED SUITABILITY » Some types of glasses can become dull after a large number of washes. » Silver and aluminium parts have a tendency to discolour during washing. » Glazed patterns may fade if machine washed frequently. 18 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 19 BEFORE OR AFTER LOADING THE DISHWASHER BASKET (For best performance of the dishwasher, follow these loading guidelines. Features and appearance of baskets and cutlery baskets may vary from your model.) Scrape off any large amounts of leftover food. Soften remnants of burnt food in pans. It is not necessary to rinse the dishes under running water. Place objects in the dishwasher in the following way: 1. Items such as cups, glasses, pots/pans, etc. are faced downwards. 2. Curved items, or ones with recesses, should be loaded aslant so that water can run off. 3. All utensils are stacked securely and can not tip over. REMOVING THE DISHES To prevent water dripping from the upper basket into the lower basket, we recommend that you empty the lower basket first and then the upper basket. LOADING THE UPPER BASKET The and upper basket tea cups and is designed saucers, as to hold well as pmlaotrees,dsemlicaalltTeabhnoaedwnuldlipsgplhaiegtnerhdrbtdeasirshskdaheliwlstohaiwswredapesrausenicgsshnua(ecashdsgtaloloashnsgogslleadasssm,sectohosr,efefcyedoeaeffrleiaecenandtoet too dirty). Position the dishes and cookware so thtaetatchuepyswainlldnsoatugceetrsm, aosvewdelbl yasthpelastepsra, ysmoaf lwl baotwerl.s and shallow pans (as long as they are not too dirty). Please be reminded that: Positio n the dishes and cookware so that they will not get moved by the spray of water. » Pots, serving bowls, etc., must always be placed top down. 4. All utensils are placed in the way that the spray arms can rotate freely during washing. » Deep pots should be slanted to allow water to flow out. NOTE: Very small items should not be washed in the dishwasher as they could easily fall out of the basket. » The Bottom Basket features folding spikes so that larger or more pots and pans can be loaded. Please be reminded that: Pots, serving bowls, etc, must always be pla ced top Deep pots should be slanted to allow water to flow o » Adj usting th e Upper Basket Load hollow items such as water cannot collect in the cups, glasses, pans etc. With container or a deep base. the opening facing downwards so thatTtaehnaedculuipgpphsetaernrbddaisssakheuwLWstcauieOsercrehsdAs,seuaDausgsscigIgphewNnosaeettGssldl,tghatpTolasaatHhnspyosslEoa,ledutlsieLdm,pssOc,lo,aosrsWcfemefeerdEavleeailRnlrlibaggcnoeaBdwdtiiAetsleshSmeKss aEannTdd The Bottom Basket features folding spikes so that thWe me soustgdgiefsfitcuthltatoyoculepalnaciteemlasrginetiotetmhes laonwdetrhbeamskoestt: bodbwiaflfssi,kcTaeuhstle:tsthhsoeuoicgcwlehntaaonisnf itptthehoemetsusf,pipgapaureernresbto,a(rlsbiigkdeehsptt,)lcs.aaeIcntrevibdsienipgnartdeodjfueitsshrahteebedllsoeiwantneoodrrder to la » Dishes and items of cutlery must not lie inside one another, or cover each other. and shallow pansp(lacselosnegrvainsgthdeisyhaerseannodt ltiodos doinrtyth).e side of thbeorwacclsrke,saaitsnesomhrodorweernstpionaacthveoefiodfirgblaulrogecekbiuentlgeonwtsh.ielIstrbiosotptahrteifoofner rtohafebtluehpetpoer P o s i t io not get n the di moved sbhytetoshpeasnspdprarcayoyoaokrmfwwa. aretesro. th at they w ill plac/elosweerrvbinagskdeist.hTehseahnediglhidt sofonthteheupspideer boafsktheet cranckbse in oraddejur stoteadvobyidpblaloccinkginthgethwehreoetlastoionndoiffethreenttohepigshptraoyf the » To avoid damage to glasses, they must not touch. armr.ails. Long items, serving cutlery, salad servers and knives should be placed on the shelf so that they do not obstruct the rotation of the spray arms.. » Load large items which are most difficult to clean into the lower basket. » The upper basket is designed to hold more delicate and lighter dishware such as glasses, coffee and tea cups. » Long bladed knives stored in an upright position are a potential hazard. » Long and/or sharp items of cutlery such as carving knives must be positioned horizontally in the upper basket. Please be reminded that: Pots, serving bowls, etc, must always be pla ced top down. Deep pots should be slanted to allow water to flow out. » Please do not overload your dishwasher. This is important for good results and for reasonable consumption of energy. 20 Instruction manual DI631 Please keep this instruction manual for future reference The Bottom Basket features folding spikes so that larger or more pots and pans can be loaded. Adjusting the Upper Basket Folding back the cup shelives The height of the upper basket can be adjusted in order to create more space for la rge utensils both for the upper /lower basket. The height of the upper basket can be adjusted by placing the wheels on different height of the For better stacking of pots and pans, tshheoswpCshiinpokuorettilohzseneorcysnpatssinachhltboopuuueorllesfddoirtbbliidogeeenhlpodtal.aatddctoheeweddnfisrneoatpnshateoracf uttehtlleey ry basket with the handl into the appropriate slo upper basket as shown rails. Long items, serving cutlery, salad servers and knives should be placed on the shelf so that they do not obstruct the rotation of the spray arms.. Do not le t any item Please keep this instruction manual for future reference Instruction manual DI631 21 https://manual-hub.com/ LOADING THE BASKETS: 1. Upper Basket Adj ustiAndgjtuhsetiUnpgptehreBUapspkeert BaFsokeldt ingFboaldc TtaPnaenohonadtesdgcisutlueiihpogptapnhmslelttaooerhnwvrebdedapddisssaisakbhnCheuywsuetctap(siehsasrreaessdns,selodpausnrscciagghowTtaPnynaeoanoahoeenoaksdtseslddfwlgctTtaPnigswuaathteluaenoiohoihlpsoneaagaprtdtesapehndythspmsgcielseoutsltlasluteaoiraoehirhlpeo.ogrpdtnwtvraebepsnehmsdtedmla,ehspdltntadoioecssrh,asoaionwsovrakbebshtrntdheefduemyatwtsfpdhedtoicessdstaiaa(esieosheakATbwbbsahenrlyrhheeluaoeeydswlhssdDabieettwcnicse,psethalr(nosieodhJahpeisatlausrladwyrfnelUaetlerssccisosdce)agiglnhoseg.,rssewSloynodpdoTc/arsthaautsaneeTlhanhokrtrhssodccihsoldageeeIgfdiwlohowjwtlenNgynwiuaashtfouaafuraoeleefsto.shetoatpkarsGehlsldehrehfyLtdwteptlsreteeeegaowabehtsolmiasaTborandgsllrtesueaa.onarrd/ihtteHWdpflroheepshloyiteisspogoedtghiaemb,prtofhsspntElknelaswfuneaerafcyieiloe,aoo.oelcrtdistsoeotorsageseistfurste,Uptouorntfebmfhmc,tl.tmhtplfsnbngtlhibohTc/arstaetPctaetdT,adeotglhoaahaheasoosrhoeodosehcdsPltehretlkaceesoyif,,ffloemwjiledtscelktfeutwEteunsoasabihssowtetlurheticsdeeehtaipr.nshoetoRgnoetdeethahficpltaehreel.rIldywopLtdeyetvalrtetlendattreTlae)vbitabirreonmiyihhBlwanitooicbsa.dgsitgrinoantlrgeepyfydaiiinAbteaeohpllodwhyossbgotlemghbstrwraste.S)udpnhtkelapgee.snyiahLsroiecfhoelKtsrpiseemoooadgeeafshuipftlerrknntjaEfchy.altmaeuputsltegefchottltaecoTbTssat.aehehlssbktteoe.lcdirshaetectesrmeosc,hlfienWdpflranydueteinoioteoasitdmrg.isaordu,stnfhputgeingnheshfunnflapnsispieocpboeopclrsr,aetsoattrtWdpflsdwelobpiruoivi,reauohhsuainddgtiialttwileerfegelbictnpbegetahflrseefuiyndtanatdrirfelemphrtgohcersrsdbeveotasoosgberwasileue,eeb,itstorotufsn,arrdgnoasrsclhharelonbwcgteahotytssisgsajtemlhtdesobreaetetgeuuhinsf.kfevonkotdeasdavalcroehrlseueIstsicokfdtee,tefvvntusoonlthscarritwtt.teesihksohg:ilseietttlnhtoooe.sedseeilehtin.natrteeotegdecwpyfrhdsaednhtreypIbtsocroeoviautinonemeauys,trstscglitudamhitocneih,fnnptaooahsnsipiishmihuecfontsnlgsrpnpyftoeaeneasdpbpkaahthiopobolssarrnttmadbistrlbyileaheaeoenudbthrsarpaesftpctaeecoesbsfgdiaefrhdfkosetesdrpnpeaeklparreastaehitnbetltdorrsmrnsrhudalhhpysrhadaaneretiaeyatteceisjavec.oejobrdsnartuyuesnfg,ckvtdellorroaeotspbsoekesetmahvlostanwrlortreretaheeiifd.soerdmtwnotendcegteerhldarrelopbsmoescorsibFtsen.wblgolr,haaittsyisddhaoantwoaheeucreoenespaongsrrelrkamtporsbkvlnewsdbnbvabs,oetsiprsdsnoapicheaudetevfketg:iisiatosietrdnnraetthnkkrvenwuthsdsgvesreibeeindtnuionvechsstlhtstmsrgoc:ihttoehodiihehlcnsowoeescdssekbutssauipntaisalhnmtlsocidahneigcchcnonpeFtskktbhtsdosatuhihoihnttsenaerosergenp,gfwsbtodohproetliesdingftk,t Saucers Lower Position Upper Position 28 28 2. Lower Basket Glasses Fo ldingFSopld For better stacFkoinrgboeftt the spike s cantbhe fsopldik Small serving bowl show in the picstuhroewring Please be reminded that: PleaPsleeabseerebme rinedmeidndtheadtt:hat: Pots, serving bowls, etc, mPuoststP,aosltwesra,vsyinesgrbvbeinopgwlablsco,ewedltscto,, epmtdcuo,smwt anul.swtaaylws abyespblaecpeldactoepd dtoopwdno. wn. Deep pots should be slantDeedetDpoepaeollpotswpsowhtsoautselhdrotbuoeldflsoblawenosteluadtn. ttoedaltloowalwloawtewratotefrlotowfloouwt.out. AdjMuTehsdeiutBmiontsteorgmvinBgtahbsokweeAtl feUdAatjupudrTephssjeufeoTtBlhdsiroeintnttBBoggimosntaptBoitkgamshesskBkteesatheosfketUtheeaattupfteUlraaepFrtsgupfereooerplsdrolifrednoBmgldriosinnarpeBgikgspseoapsktibsksseeoaaskntthdscaeoptWktalthanhaFrstegtechleoalasrFrneoglrebdomrecoilolornudraemdgippoenordetbs.sgpaohantbsdceapankladvcnsptekachnassntechbaecnelobuaecdpleoudas.dpehds.ehlveelvse /btTlolooyhwwceleirefehrtriaentbhtiggeaehLusmbatpkarooegtsfrthee.ktehTessebthep,aeruasvspcihimknepeegpeiftgolrytbhrobotplaalwouosrflclkg/btTllolokeoeytthwhhtwcielnueeeicref/Ttbltehrtaoloteuhrioyhhaennwtnpawbhceetiglsgpenebiraeefieuhedrtuelsmrisbapetrnlpktebheatpoiogbebgetaeaseufrotahhue.sskmrpttsebthphTkiekplsaooyaeebtheptof,sfrnthoaeatuae.skstdersdhciTpceFFihtmsktaijoeelpbthehouOope,nrpeaeienswuaftsgolrsLbt,bypctiheeumrokbeaeeDpetdrppeltanpealoipttuafotgIsidhoelrrnfeyldctNhkglerrobCshrktjeteotpuolsahhGpalotoriuusotsnueedrcafotrlckgttleeaicteulhkoBeeztthdreknhhnpatneioiArnueespnnbcsyntiuedagelCteuhtFsshptrlnhssnpaehaooeKepbebhhspnobrafleuoaiuedwcooelbsprptssTpurlhieuueokploeippyabHbtnetllofatesunoaddsesatstsErpiCshdtsrrhhdciahtibbtkplpseoteiaiyjanluhouoeoCoeeftlonnroadvbenasttwsnideUlcroetlp,dzbciepeeutoksltaaaijenllooPhaoudriproaanncnwtsyennspwtagaiddchntt.,sbedStnseeushe,eeoaaertjdorphhuoHtefbdndlhrptasooepiddhpEnetefdisoeeeuurnfortjLtooeoudorllsslVrddtspdndhaitetEaeebbenidtFsdrhorSeedhoacdefnorplpotuwtcobaewtFsahltuhenaahlloitnpeeetysnodrctt,easwrchutbeerhyhsiueepnddiseeptnbtptlfavebiossatrneecrheheoskstlsreetophinkthlncbwavbeaetgaeecea.orntksloasoaciwffnbcpkwtutgepaeieph.tonofllhtretoeyfbosaltrdepupahysieopnfnrdetosbidsptlaodhaheaptoeosaetanrwdhkwndnbnsdesedpnaol,aotalawsseiwntnpknsssiep,,attahhtrseoteasttphsphpreeesiicachhbttiouaeaorwnltseltdynol.ollmeitonssn.,taIghefteutsthpthpeeee basket as shown below: Lift the basket for LbaisftkPLbetatiuhsfatkleslettshhbhaaoesawnssnbhdokbawleecesnulotpkbwafees:onhloterdwlfv:oelsor cPwanuebPlrleuhfolalldnheddadlneodwalnenasdasnhloodwwlooenwrthee rright. upper pDoesssietritodnishes upfpuoeprrplopewor sepirotisopinotisointion forfloorwloewr peor spiotisointion Do notDleot naontylietet amneyxitemndetxhtre Dinner plates AlwaysAllowaadyshloaarpd ustheanrspilustweni point dpoowin!t down! FOLDING SPIFKEoSldOiFnLgOWSEpRikBAeSsFKoEoFTlfdLilnodgwinSegrpSBikpaeiskskeoesftoLfoLwoewreBraBsaksekt For better stackingtFhooefrsbppeoikttetsesracsnatdnacpbkeainnfogsl,dotefhdpedosotpswianknetFahdsoserpcssabahtFphnenoioektwsretbs,esbepreicsktaetneasrcbckseaitnnafogcbldkoeeifnfdopgldodootefswdpandonoatdswspansanhandoswsps,ahnows, folded down as shionwtheinptichtuerepitcotuthreertigoht.he rigihntt.heinptihcetupreictourtehetoritghhet.right. Soup plates Cutlery tray CuCtluetrlyertyratyray Oval plates 13 13 Arrange the cutlery in the traAyrraasAngsrrheaontwhgenecbthueetlloecwruy.tliTenortyhmienatktrhaeeyutanrasloysahadosinwsgnhmobwuenclohbwee.alToswoie.mrT,aockumetleaurknyelosuahndoliuonlagddmbineugcgmhroueucaphseiedra,isncieuzrto,lencreuystls,ehroyuslhdobueldgbroeugpreodupinedzoinezso,nes, one for knives, one for forkso, noeneofonfroekrfnsoiprvoekosnn,ivsoe,nsee,tcofo.nrSefpofoorkrosnfo, hrokensae,dofsonrseshfpooourolsdnpsbo,eoenptscla,. ceSetpcdo. ioSnnpcohooennatadhcset aswhdiotshuslahdtoblueeladpsbtlaeocnepedlaocinfetdchoeintcaocnt twaictht waitthleatstleoanset onf ethoef the serrated retainers on the basseerorasftetehrdrearcteeutdatliernereytarstirnaoeynrsttohoeennbtshauesreebaothsf aethtoewfcathuteetlrecrruuyntltesraroyfftrotahyeenmtosuferrneesetulhyra.et twhatewr arutenrsruonffsthoeffmthferemelfyr.eely. 22 Instruction manual DI631 Please keep this instruction manual for future reference Please keep this instruction manual for future reference Instruction manual DI631 23 Do not let anDyoDitnoeomntolet lteatnayniyteitmem https://manual-hub.com/ and shallow pans (as long as they are not too dirty). Positio n the dishes and cookware so that they will not get moved by the spray of water. CUTLERY BASKET bowls, as shown in the figure belo w. It is preferable to place serving dishes and lids on the side of the racks in order to avoid blocking the rotation of the top spray arm. Arrange the cutlery in the basket as shown below. To make unloading much easier, cutlery should be grouped in zones, one for knives, one for forks, one for spoons, etc. Spoon heads should be placed in contact with at least one of the serrated retainers on the base of the cutlery tray to ensure that water runs off them freely. PROGRAMMING THE DISHWASHER WASH CYCLE TABLE ( ) Means: need to fill rinse into the R inse-Aid Dispense r. ( ) Means: need to fill rinse into the R inse-Aid Dispense r. Programme Cycle Selection Information Description of cycle Detergent Pre/main Running time (min) Energy (Kwh) Water (L) Rinse Aid Please be reminded that: Pots, serving bowls, etc, must always be pla ced top down. Deep pots should be slanted to allow water to flow out. The Bottom Basket features folding spikes so that larger or more pots and pans can be loaded. Pre-wash(50°C) A dj usti ng th e U pper Basket FFoo llddiinngg bSapcikketsheofAcLudojpuwssethirnegBl iatvhseeksUept per Basket Fo ld in g b ac k t he cup shelive s For pTc/arstlhCearhdoheeiruojwelsuasruteolhs.otelertdLentreaboimyabgdtanieslhoosghbtrspnkeyiooaletoauefsfptfce.ltmpld1234htaeTtah....secdybhceTSFK,ieueeeonooasnsaprugnpeihfnpkvspoplrepsttreadverhhaisoscgirleeypnoatehboognwrsadtaogsphrchosinemenufeksqlusteefttlhut.ehlste.seareocnyoalcu,stinhuntsiplyatadsbpletliecebaftrflrhoydeaeebtrdbasheayjeanunsfdsorskitvoknrteheeetgntehrdtocs,iewgaitpanhuionntltophbabdorpsctedfkheteretnreuhritcevhthteoa5768esn.... DSSGdseeleireFtsFtslrrashhvvvhshvsooiieeeeynnoorrarrggswswLbbttwappetefssiihdoipipnanttkkltertooeeerekettooehhbssrsrnneeossccissttntppaataaoiinncccctmkkhttbbuuii.eeennrrIeeggfffbootrroohlaliiddgfgfeseephphkrddototae..ttdcdstskooaamwwhnnannaddskaappsissaanidnngTc/arsTtaPnesslaearhdonohho,,nesiabojweldtesuasduaugciessh.tutluslreeirhitdLepoegepktboPaimpnbhgdmseanlletelthoettaPDsTooeghrhsbtrapknwvrohebeeyi,aosletdetedeaatefesdpspttdhipscs.tmBps:,ialhbseakaTbshaponsheeecudehywocts,eitctuerretnotsao(veiseshpsagnehrmfimreapsonesredstthvnerghihsB,ieslngiodorlepeaunbsaadhnubrsgiccsowrsegatglaghokdwhwdchonyseeoaeaulfeebektostksluhtsdleeef,fltfwltaethelsgtweeathssatreaoocltsln:eyaaracoateu,shtytups,nnhnesiporslmsaltaraaesdbpleeo.rdttluiseedebsafettsfm,hrofhdsentatoocebt,a(orodIsahloeay*sdtraNjtelN((ufemnsfwitldtIIfE**9ornhlsonnektNNTEEvooadOa99rgNeteoe0hEEettweNNeyElEtny00ooeetelsrhRdsdlCCisbaocCwprriwN5nn55eciMMgbarintMommi00aaan0issktOhueOOoSlnwdyiin22tlteiiItaa2opbee)nnApdlbvvI44sNo.srpsr4llleeVe22dafksetLt2r))eotncorEuhrie)fevcttldhteooaFapoFapoTstpetTstpetFsgsFsgsFpsTsteictFnFnewstFtFttoaaaahhtouoooohhhftoeosuuuouonnnanarnrnoohhlloopfclbbooobbaaiirnrrooaaieaitriitlcicieeaas.cdndniirrcullsmrrFtsettdsadnnhssllssttreeggllrrssohWdbbpiai,waatrreeghuidnhheeoettobsshhowwoettnn.soonnaiolremggrrsspaiioennbbmfawwyyrniwmelarraassddonnlfpswteeelooaasyyaawsriilmmooeeicbbtallpphvqnrooykcspllta.mmaaeerrplssoeaaeerriidessppiittarrssspeaaeeuee.uuiddaatnneisdeonnrrrrrnemmttt,nieesk.mmrtilgvvmmttlltosmmnneeaaseoaasrcmt:aiirollggaaooooppaeeedt.sstgcyyi,idddnktddhnnneaanntgsleersrlseeaaffaooaaeoogo..nnseccevhhessaaddrsuewddrsrfllssscottssllwwnndlttoaoaciiillqqaddodelltaaanceenhptallllnnaaeeissoaliyyamndd..iivlrttyylletshaagptilleuuonpbbesspncyyceesllrraaohsasstttriowmnottdkiiiissahdddlltrbddesssiieeiahgnneettnggeeusdocctteeiosssinoo.seootenasooppyssctrrriippllrrgwwirhhbnnkk,yphttssooooemmrgthitiiafmiiaaniriirrlleccollccloopolleaanoottaaeaeellaaniotreeoonottniimllneeculaoosswwttyaiddsmhhllddrrcdrrfghsmwwyykttdtgggddpleeddnnnmmssseepkeeddlpa,eeooeeheeaampy,.errlsoilwiirpdssddoai..tntrnaccaaff,asssgllaafmtt.hysppmmsssaetroiduuoohhgduacndiirr,gmmhtseoall,llnttfhhsooeotmmllcooslioouaaaoottssitaiyyisethhllddwtmmdorntt..olecccysshddn,rappeeaassccsssfnidarrdlaedttbsrkkeeittssoobriinoooddgdsseaeeiieepo,,ee,,emmoonesiibssstaffpllddiil,arrnnffoeteeittnlbbtshyyPWRRDPWRDWRRDWRRRDiitawecciiddsileeffrriiiiiiiiiiossoc,,rrrrm,.oonnnnnnnnnnaaaaeeiiryyyyneaseeIv-ss-ssssssssssiiiirreestdnnnndiwwieeeeeeeeohhhhnndniddeaggggs((fieaattgn((66((((dnt66p5466sstho55d.ohh55rd5550PWRRDPWRDePWRRRDPWRRDfWRRDWRDPWRDPWRD°°et(CCi°°t°°°°hsCC4CCCCfhtrririritiiiiirrrrrre))iiririirrhaaheaannnnnnnnaaaao5eee))yynnnnn))))eeyyeeyyyyreep°amsssssssssslCiissss--sssssiiii----iiornnbnnhhwwsnnnnhhwweeeoahhhhwweeeee)weeeeealpggsecggggggn((((eaaaar((((((aa((tk((((a66td7755r6666s66oss4466ssyss5500555500hh5555hh55hh5535 ((((//0/ 4422255g))))))55555))00))))))))ggg )))) 160 180 185 90 51/.522g ( o5r/32i2ng1) ( or3in 1) 51/.2252g ( o5r/32i2ng1) ( or3in 1) 5 / 22 g ( o50r/.329i12ng1 ) (o r3in1) 27 g ( o21r3.73ig5n 1) ( or3 in 1) 18.5 15 11 12.5 « 16 5 16 5 « 17 5 17 5 « 19 0 19 0 «90 90 » Thshpoeoryiozdnosontsanhlooputolsndietbisoetnlotaoat dgtheeedthfsreeoprn.at oraf ttehley into the app upper baske ropriate slots, es t as shown in the pecially pict ure. long utens ils s h ould tbhee pr ol at actei odn ionf tthhee spray arms.. » Silverware is placed with the handles down. RRAaPpIiDd Rapid AswAsAloooaasssiidhshhllsoeehooraddt.rrnettllrdeeoowqrraaauwwddsichssaakfwssoaarhhannlsddiffghooh.qqrrtluuylliiiisggccohhkkilettlldyy Wash (45W°Ca) sh ( 45 ) Rinse RWianshe((540520g) Rinse (55R°Ci)nse((5505)) 40 200.7g5 11.5 3 0 20 g 30 was h. Rinse ( 55 ) WARNING: Do not let any item eDxteond nthoroutglhethteabonttyomiotfethme baeskxett,eornexdtentdhhrigoh uabgovhe. Tthhis ewilbl o t to m. Folding Spikes of Lower Basket prevent damage to thAe lbwaseaoyf tsheldoishawdashserhaandrapllowuttheenspsraiylasrmwtoiwthorktchorerecstlyh. arp NOTE: For better stacking of pots and pans, the spike s can be folded down as 1.4 1.4 1.1 1.1 0. 69 0. 69 1.15 1.15 0.7 0.7 Cutlery should be plapceod iinnthtedcuotlewrynba!sket with the handles at the bottom. If the rack has side baskets, the spoons should be loaded separately into the appropriate slots, especially long utensils should be placed in the horizontal position at the front of the upper basket as shown in the picture. WARNING: 13 *EN50242: This pshroowgirnatmhempiectuisretrhigehtt. est cycle. The information for comparability test n accordance with EN 50242, as follows: *EN 50242 : This programme is the test cycle. The information for comparability t » Capa*cEitNy: 51022s4e2ttin: gTiinnhaaCisccapccpooraorrcddgiaartaynn:mcc9eemswweeiititttshhintEEhgNNe t5e0s2t 4c2y,cales. 50242, as fTohlleowinsfo: rma follows: tion fo r comparability t Cutlery spoons should sh ould be be placed loaded in the separ cut ate le ly ry baske into the tawpipthrotphreia»htaensPdlooletsss,iateitsotphneecbUiaopltltypolmeon.rIgfbutahteesnkrsaeicltsPRCPk:shoouaihansspopssuiipasttelideiicdoorabeinntebwiydpaUU:hlsas9kppeceeeeppsttdsleets,iintrrnthottbbegihnnaae:grss6akkileestt:: upper upper wheels wheels on on rails rails horizontal position at the front of the upper basket as s»howRniinn sthee apiicdtusree.tting: 6 PRli:n0s.e49awid; sPeot:t0in.4g5: 6w. Do not let any item extend through the bottom. Always load sharp utensils with » Pl:0.49w; Po:0.45w. Pl:0.49w; Po:0.45w. the sharp point down. Do not let any item extend through the bottom. 24 Instruction manual DI631 Please keep this instruction manual for future reference Starting a cycle wash Always l o«ad shar p utensils with the sha rp S1Ftiall RrDitnisrneaAgwidainotcouythtcetldheisepwenlsoaerwsher and upper basket, load the dishes and push them back. point down!1 IDt risawcoomumt theendloewd etor alonaddutphpeelor wbaesrkbeats, kloeat dfirt "ItLiosacdoimngmtehnedDedisthowloaasdhPelteahrs"eeke)leo.pwthies irnsbtruactsiokn meatnufiarl fhssortte,,futtdtuhhrieseerhennfeertteshhnceeea nuudppInpppseeturrrusoochnntiteeohn((essmmee eeabnatt hhuceeakl. ssDeeI6cc3tt ii1oo n n entitl e n2t i5t l ed ed 2 "PLoouardinintghethdeetDeirsghewnat s(sheeer"th)e. section entitled"Salt, Detergent and Rinse Aid"). https://manual-hub.com/ 32 IPnosuerrtinththeepdluegteinrgtoetnhte(sseoecktheet.sTehcetipoonweenrtistluepdp"lySiaslt2,2D0-e2te4r0gVeAnCt a/n5d0 RHiZn,stehAeisdp"e)c.ification N OT E : EN 50242: This programme is the test cycle. The information for comparability test in accordance with EN 50242, as follows: » Capacity: 12 settings » Position Upper basket: upper wheels on rails » Rinse Aid setting: 6 » PI:0.49w;Po:0.45w TURNING ON THE APPLIANCE Starting a wash cycle: » Pull out the lower and upper baskets, load the dishes and push them back. It is recommended to load the lower basket first, then the upper one (see the section entitled "Loading the Dishwasher"). » Pour in the detergent (see the section entitled Salt, Detergent and Rinse Aid). » Insert the plug into the socket. The power supply is 220-240 VAC /50 HZ, the specification of the socket is 10A 250VAC. Make sure that the water supply is turned on to full pressure. » Open the door, press the power button, and the On/Off light will turn on. » Press the program Button , the wash program will be changed as follows direction: Intensive->Normal->ECO->90Min->Rapid; CHANGE THE PROGRAMME » A cycle that is underway can only be modified if it has only been running for a short time. Otherwise, the detergent may have already been released, and the appliance may have already drained the wash water. If this is the case, the detergent dispenser must be refilled (see the section entitled "Loading the Detergent"). » Open the door, press the Programme button for 3 seconds, the machine will be in standby state, then you can change the programme to the desired cycle setting (see the section entitled "Starting a wash cycle"). NOTE: If you open the door during a wash cycle, the machine will pause. The programme light will stop blinking and the buzzer will sound every minute until you close the door. After you close the door, the machine will continue working again. FORGOT TO ADD A DISH A forgotten dish can be added any time before the detergent cap opens: » Open the door a little. » After the spray arms stop working, you can open the door completely » Add forgotten dishes » Close the door » The dishwasher will start running again AT THE END OF THE WASH CYCLE When the working cycle has finished, the buzzer of the dishwasher will sound for 8 seconds, then stop. Turn off the appliance using the ON/OFF button, shut off the water supply (if connected to tap only) and open the door of the dishwasher. Wait for a few minutes before unloading the dishwasher to avoid handling the dishes and utensils while they are still hot and more susceptible to breakage. They will also dry better. SWITCH OFF THE DISHWASHER The programme light is on but is not blinking, only in this case the programme has ended. 1.Open the door. Switch off the dishwasher by pressing the ON/OFF button. 2.Turn off the water tap (if not plumbed into mains water supply). O P E N T H E D O O R C A R E F U L LY Hot dishes are sensitive to knocks. The dishes should therefore be allowed to cool down around 15 minutes before removing from the appliance. Open the dishwasher's door, leave it ajar and wait a few minutes before removing the dishes. In this way they will be cooler and the drying will be improved. UNLOADING THE DISHWASHER It is normal that the dishwasher is wet inside. Empty the lower basket first and then the upper one. This will avoid water dripping from the upper Basket onto the dishes in the lower one. WARNING: It is dangerous to open the door during a wash cycle, because the hot water or steam may scald you. 26 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 27 Improper replacement of the filter may reduce the performance level of the appliance and damage dishes and utensils. CLEANING AND MAINTENANCE 1 FILTERING SYSTEM eltseidr uperesTrvehmseeidnafuitylsteesblralmoprragceykevbertnlhroteecskmflaitnlrhtgaeeenrfr,itlristenemor,tfhninfaiosnthotcsidasoscofaerfsooetohttdheheyoeyrrmoomtubhusjesettrcbboteebsjrerfeercmotmsmofovreovgdmee.dtgt.ienttginignsinidsiedeththeeppuummpp..The Step 1 Turn the filter in anti-clockwise direction. Step 1Turn the filter in anti-clockwise direction, The filter system consists of a coaTrsheefifltieltre, ar sflyatst(Memaincofilntesri)satsndoaf amcicoroafrilsteer filter,a flat (Main filter) (Fine filter). And a microfilter(Fine filter). 1 2 1 1 . MMAaIiNn fFiIltLeTrE R 2 FoodFaonoddsoailnpdarstoicilleps atrratpicpleedsintrtahpispfeildterinartehipsuflviletreizreadrbeypauslvpecriazled by a jet onsptheeclioawl ejer tsoprnaythaermloawnderwsapsrhaedy adormwnatnoddwraains.hed down to drain. Step 2lift the filter assembly up Step 2 12 2 2 . CCOoAaRrSsEe FfiIltLeTrE R LargeLraitregmesr, istuecmh sa,s spuiecchesaosf pboiencees sorogflbasosn, tehsatocrogulladsbslo, ctkhathtecould block Lift the filter assembly up. draintharee dtrraapipneadrien trhaepcpoeardseinfilttheer. Tcooraermsoevfeiltheer.itTeomrsecmauogvhet bthy e items 3 the ficltaeur, gghent tblyystqhueeefziletethr,egteapntolyn sthqeuteoepzoef thhies ftialtperoanndthliefttooupt.of this filter and lift out. Reverse these steps to re install the filter. 3. FINE FILTER 3 3 This fFiltienr ehofldilstesoril and food residues in the sump area and prevents NOTE: 16 it froTmhbiseinfigltederphooslitdesdsoonilthaenddisfhoeosddruerisnigdwueasshincytchlee. sump area and Reverse these steps to re install the filter. prevents it from being deposited on the dishes during wash cycle. F I LT E R A S S E M B LY er assembly The filter efficiently removes food particles from the wash water, allowing it to be recycled during REMARKS lter effitchieecnytcllye.rFeomr obevsetspeforfoordmpaanrcteicalnedsrfersoumlts,ththeewfialtesrhmwuasttebre, calellaonweidnrgegitutlaorlby.eFroer cthyicslreedasdoun,ring the cycle. » Inspect the filters for blocking after every time the dishwasher has been used. est perfitoirsmaagnocoed aidneda rtoesreumltosv,eththeeflialtregrermfouosdt bpaertcicleleasntreadppreedgiunlathrelyf.ilFteorratfhteirseraecahswoans,hitcyisclea bgyood idea to e the larrignesirngfotohde pseamrticilercsultarar pfiplterdaindthceupfilutendr earftreurnenaincghwwaatesrh. Tcoyrcelemobvyeritnhseinfigltetrhedesveicme,ictuirrcnutlaher filter and cup » By unscrewing the coarse filter, you can remove the filter system. Remove any food remnants runningfilwtearteanr.tiT-colorcekmwoisveeatnhdepfiultlel rthdeefvilitceer,intutrhnetuhpewfialtredrs adnirteicctlioocnk. wise and pull the filter in the upwards direction. and clean the filters under running water. W » ARNING The dishwasher The dishwasher must never be used without the filters. mIumstpnreovpeer br ereupseladcweimtheountt tohfetfhiletefrisl.ter may reduce the perfor and damage dishes and utensils. mance lev el of the NOTE: applTihaenecnetire filter assembly should be cleaned once a week. » Improper replacement of the filter may reduce the performance level of the appliance and damage dishes and utensils. CLEANING THE FILTER To clean the coarse filter and the fine filter, use a cleaning brush. Reassemble the filter parts as shown in the figures on the previous page and reinsert the entire assembly in the dishwasher. 1 WARNING: Step 1Turn the filter in anti-clockwise direction, When cleaning the filters, don't knock on them. Otherwise, the filters could be contorted and the performance of the dishwasher could be decreased. 28 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 29 When cleaning the filters, don't knock on them. Otherwise, the filters could be contorted and the performance of the dishwasher could be decreased. CARING FOR THE DISHWASHER The control panel can be cleaned by using a lightly dampened cloth. After cleaning, make sure to dry it thoroughly. The control panel can be cleaned by using a lightly dampened cloth. FAoftrerthceleaenxitnegr,iomr,aukesesuaregtoooddryaitptphloiaronucgehplyo. lish wax. Never use sharp objects, scouring pads or harsh cNFloeervatenhreeuressxeotsenhriaoarrnp, yuosbpejaearctgtsoo, ofsdtchoaeuprpdinliiagshnpcwaedapssoholrieshrh.awrsahxc. leaners on any part of the dishwasher. CC LlEeAaNnIiNnGg TTHhEeDDOoOoR .r To clean the edge around the door, you should To culeseanotnhleyeadgseofatrowuanrdmth, eddaomopr, ycoloutshh.oTuoldauvsoeidonly a soft warm, damp cloth. To apveonidetpreantieotrnatoiofnwoaf twearteinr tiontoththeeddoooorr lloocckkaannddelectrical components, do not useealescptrraicyacllecaonmepr oofnaennytks,inddo. not use a spray cleaner of any kind. WARNING: Never use a spray cleaner to clean the door panel as it may damage the door lock and electrical components. Abrasive agents or some paper towels should not be used because of the risk of » Never use a spray cleanersctroatcclheianng othr eleadvoinogr sppaontesloansthite mstaaiynldeassmsategeel sthurefadcoeo. r lock and electrical components. Protect Against Freezing »PleasAebtraakseivfreosat gpreontetcstioonr some paper towels should not be used because of the risk of scratching measures on the dishwasher in winter. Every time after washing cycles please or operaleteavasinfgollospwosts on the stainless steel surface. 1.Cut off the electrical power to the dishwasher. 2.Turn off the water supply and disconnect the water inlet pipe from the water valve. 3P.DRraOinTthEeCwaTterAfrGomAthIeNinSleTt pipFeRanEdEwZatIeNr vGalve. (Use a pan to gather the water) 45P..lRReeeacmsoeonvnteaectkhteethffeirltoewsratatetprtrhioneltebetocptttioipomentoomftthheeeawdsauistrheewrsvaasolhvneer.tahnedduissehawsapsohneger iton swoainktuepr.wEavteerriyn tthime esuamfpte. r washing cycles please operate asIf fyooullrodwissh:washer cannot work because of the ice build up, please contact a qualified plumber or serviceman. C1. leCuat nofifnthge etlehcetricSal pporwaeyr toAtrhme dsishwasher. 2It.is nTeucrenssoafrfy toheclewaantteher sspurpapy layrmasndregduilsacrolynansehcatrdthweatwerater inlet pipe from the water valve. chemicals will clog the spray arm jets and bearings. To remove the upper spray arm, hold the nut, rotate the arm c3lo.ckDwrisaeintothreemwovaeteitr. from the inlet pipe and water valve. (Use a pan to gather the water). To remove the lower spray arm, pull out the spray arm upward. 4W.ashRethceoanrmnescint wthaermwsaotaepry iwnaletetr panipdeustoe athseoftwbarutsehrtvoacllveean. the jets. Replace them after rinsing them thoroughly. 5. Remove the filter at the bottom of the dishwash17er and use a sponge to soak up water in the sump. Protect Against Freezing Please take frost protection measures on the dishwasher in winter. Every time after washing cycles please operate as follows NOTE: If12y..CTouuurtrnodofffiftshthheweewaleaschttereircrasulcppaopnwlyneaornttdowdthiosercdkoinsbnheewccatastuhheesrew. aotferthineleticpeipebufriolmd uthpe,wpalteear svealvceo.ntact a qualified plumber or34..sDRerearcvioninctnheeemcwtatanhtee. rwfraotmer the inlet pipe and water valve. inlet pipe to the water valve. (Use a pan to gather the water) 5.Remove the filter at the bottom of the dishwasher and use a sponge to soak up water in the sump. C L E A N I N G T HIfEyouSr dPisRhwAasYherAcaRnMnotSwork because of the ice build up, please contact a qualified plumber or serviceman. It is necessary to clean the spray arms regularly as hard water chemicals wCill lceloag tnheinspgraytharem jSetsparnad ybeAarirnmgs.s ToIt irsenmeocevsesatrhyetoucplepaenrthseprsapyraayramrm,shroelgdultahrley ansuhta,rrdowtaatteer the arm clockwise to recmheomviecailts.will clog the spray arm jets and bearings. TTcoolorrceekmmwooisvveeettothhreeeumploopvweereisrtp. srpayraayrma,rmho,ldputhlleonuutt,trhoetastpertahye aarrmm upward. WToasrehmthoveeathrme lsowinerwsaprrmay saormap, ypuwll aotuetrthaensdpruasyeaarmsoupftwbarruds. h to clean the jets. Replace them after rinsing them thoroughly. Wash the arms in warm soapy water and use a soft brush to clean the jets. Replace them after rinsing them thoroughly. 17 HOW TO KEEP YOUR DISHWASHER IN SHAPE AFTER EVERY WASH After every wash, turn off the water supply to the appliance and leave the door slightly open so that moisture and odours are not trapped inside. REMOVE THE PLUG Before cleaning or performing maintenance, always remove the plug from the socket. NO SOLVENTS OR ABRASIVE CLEANING To clean the exterior and rubber parts of the dishwasher, do not use solvents or abrasive cleaning products. Only use a cloth with warm soapy water. To remove spots or stains from the surface of the interior, use a cloth dampened with water and a little vinegar, or a cleaning product made specifically for dishwashers. WHEN NOT IN USE FOR A LONG TIME It is recommend that you run a wash cycle with the dishwasher empty and then remove the plug from the socket, turn off the water supply and leave the door of the appliance slightly open. This will help the door seals to last longer and prevent odours from forming within the appliance. MOVING THE APPLIANCE If the appliance must be moved, try to keep it in the vertical position. If absolutely necessary, it can be positioned on its back. SEALS One of the factors that causes odours to form in the dishwasher is food that remains trapped in the seals. Periodic cleaning with a damp sponge will prevent this from occurring. 30 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 31 INSTALLATION INSTRUCTION P L E A S E C A R E F U L LY R E A D T H E I N S TA L L AT I O N I N S T R U C T I O N Illustrations of cabinet dimensions and installation position of the dishwasher. Please carefully read the installation instruction. ATTENTION: Illustrations of cabinet dimensions and iPnrsetpaallraattiioonnspsohsoituioldnboef mthaededibsehfworaeshmeorving the dishwasher to the installation place. Preparations should be made before moving the dishwasher to the installation place. We strongly recommend the installation of the pipes and 1 a qualified engineer or similarly qualified professional. electrical connCechtoioonsseshaopulaldcbeenmeaardtehbeysink (see figure 1). to facilitate1t.heCihnosotasellaatipolnacoef (see figure 1). ninelaert tahnedsdinrkaitno hfaocsielitsate the installation of inlet and drain hoses 2 If dishwasher is installed at the corner of the cabinet, there should be some space WARNING: Electrical Shock Hazard. Disconnect electrical can result in death or electrical shock. power before installing (illustrated in figure 2) when dishwasher. Failure to do so the door is o2p.enIfeddi.shwasher is installed at the corner in figure 2) when the door is opened. of the cabinet, there should be some space (illustrated Figure1 INSTALLATION PREPARATION Cabinet dimensions Less than 5mm The installation position of dishwasher should be near the existing inlet abnedtwdreaeinnhtohseestoapnd power cord. of dishwasher and cabinet and the One side of the cabinet sink should be chosen to facilitate the connectioonuotef rdrdaoinohr oasleigs noef d the dishwasher. to cabinet. NOTE: Please check the accompanying installation accessories (fixing for aesthetic door panel). 90 ° 90 ° Figure 1 Cabin82e0tmmdimensions Less than 5mm 580mm Electrical, drain and between the topwater supply line entrances 80 of dishwasher and cabinet and the outer Space between 100 cabinet door aligned bottom and floor to cabinet. 600 mm 90 90 820mm 580mm Electrical, drain and water supply line entrances 80 100 Space between cabinet bottom and floor 450mm Figure2 Minimum space when the door is opened Figure 2 Minimum space when the door is opened. Dishwasher Door of dishwasher Cabinet Minimum space of 50mm Aesthetic door panel dimensions and installation 1 The aesthetic door panel could be processed according to the Figure 3. 32 Instruction manual DI631 Please keep this instruction manual for future reference Figure3 The aesthetic door panel should https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 33 d is h w a s h er Minimum space of 50mm AESTHETIC DOOR PANEL DIMENSIONS AND INSTALLATION The aesthetic door panel could be processed according to the Figure 3. Aesthetic panel's dimensions and ins tallation 1 The aestheti c wooden panel could be processed ac cording to the Figure 3. Figure 3 The aesthetic door panel should be processed in accordance with the illustrated dimensions. Figure3 T he aesthetic p anel should be processed in accordance w ith the illustrat ed dimensions (Unit: mm) (Unit: mm) 19 34 Instruction manual DI631 Please keep this instruction manual for future reference 2 Install the hook on the aesthetic door panel and put the hook into the slot of the outer door of Idaninssdhtwbaoallsltsht(ehSr(eeseehefigofuiogruekre4ob4)na.).tAhfeterapeosstithioenitnigc odf othoerpapnaenl, efixl tahne dpapneultontthoethhe oouotekr idnotoor btyhsecreswlost of the outer door of 2 Instdalilsthhewhaooskhoenrth(seeaeesftihgeuticredo4orap)a.nAelfatendr ppuot sthietiohonoiknigntootfhethsleot pofathneeol,utfeixr dtohoer opfanel onto the outer door by dishswcraeshwesr(saene dfigubroe l4tas).(ASfeteer pfoigsiutiornein4gbof)th.e panel, fix the panel onto the outer door by screws and bolts(See figure 4b) . Figure 4Figure4a InsItnasltlaltliaotnioonf oafesthetic panel aesthFetiigc upraen4ela Installation of aesthetic panel NOTE: The furniture door weight should be 3.5-5kg. FiguFreig4ure4b Installation of InaseFtsdaitoghlloeaurttriipceoadn4nobeoolfrapeasntehletic Installation of aesthetic door panel 1. Remove the four 1.shRoret mscorveew sthe 1s.2hRionserscmtfseroocesrtvrucweterrheswetwshhsfesoofuorrtulor ng 2insert the four long s2c.rewInssert the four long screws https://manual-hub.com/ 20 20 Please keep this instruction manual for future reference Instruction manual DI631 35 Tension adjustment of the door spring TenTwsTThhhEeieeoNnddooStnhooIerrOasaspNepdrsrinitAnjhgugeDsstaisJcraUetdreSmoseoTstreMeatptaaEnttnhNtetehlTefoiasfcOafitnocFstrtyothTartyolHelettEodhde,thDypoeorOoupopOrwoerRrpilltesehSrnaptPseviRonrensiItinNofoonGargdtfohjuer stohtuettheoeruddtooeoor rrd. osWpohrrei.nngthteenaseiostnh.etic door spRdrointoagrtsepaatnhreeel aissdeijntusastattilntlehgde,scyfaoreucwtwotirolyl hdtaorivvteehtetohpaedraojudpsjeut srthtteeerdntosoisortnsrapfironinrogtrhtereenlsoaiouxntt.ehRreodstaotetoeertl.hceabadlejusting screw the ae(tssoethdeeriftviigecutdhroeoa5rd)p.juastneer ltoisstirnasintaolrleredl,axyothue wsteilel lhcaavblee t(oseae dfijguusret t5h)e. door spring tension. rfeisgtpuhrreienaDttfDtfohu5gduhooel)lejallt.oouyyeddrrcsoooonslstpopopiosepnrrserinigrnreoneeirgndmesnewgtcmpadeiirionttsneapehssswiiicontonthihsonosstonoiierritos,hirizdosyneocoerlonncriitirvgsi trtrzaeehicslowcyetittonneshhlwritttetfreahohterleenaioacsindnftejawusthshteeernto strain or relax the steel cable doopoer nrefecimnldogsapeeiorwn.sistihthitohoenri szligoyhnet tltiafrtliosifneastfhineger. close with the slight lift of a e r. Figure5 Figure 5 Tension adjustment ToefnthsieondoaFodrjiugsspturmoinrfegetnh5tedoor spring Tension adjustment of the door spring Connection of drain hoses CONNECTION OF DRAIN HOSES Insert the drain hose into a drain pipe with a minimum diameter of 40mm, or let it run into the Con nection of drai n hoses Iansvsioneikdrt,btmheenaddkirniangingohrsocusrriemeipntiotnogaaivtd.orTaidhinebpteoipnpedowifnitthgheaohrmoscineriimmmuupmsint dbgieaimlte.esTsthetrehoatfno4p100mo0mf0mt, homer .lehtoitsreunminutsotthbeesliensks, mthaakning1s0u0r0e mtom. the drain hose into a drain pipe with a minimum diameter of 40mm, or let it run into the sink, making sure to bending or crimping it. The top of the hose must be less than 1000mm. Front Counter DISHWASHER INSTALLATION STEPS 1. Install the furniture door to the outer door of the dishwasher using the brackets provided. Refer to the template for positioning of the brackets. 2. Adjust the tension of the door springs by using an Allen key turning in a clockwise motion to tighten the left and right door springs. Failure to do this could cause damage to your dishwasher. (2) 3. Connect the inlet hose to the cold water supply. 4. Connect the drain hose. Refer to diagram.(6) 5. Connect the power cord. 6. Affix the condensation strip under the work surface of cabinet. Please ensure the condensation strip is flush with eDdigsehowfawsohrekrsiunrsfatacell.a(3ti)on steps 1 Install the furniture door to the outer door of the dishwasher using the brackets provided. Refer 7. Place the dishwasher into position.(4) to the template for positioning of the brackets. 2 Adjust the tension of the door springs by using an Allen key turning in a clockwise motion to tighten the left and right door springs. Failure to do this could cause damage to your dishwasher(2). 8. Level the dishw43aCCsoohnnnneeercc.tt The rear foot can be adjusted the inlet hose to the cold water supply . the drain hose. Refer to diagram.(6) from the front of the dishwasher by turning the Allen screw in the middle of 5 Connect the power cord. 6 Affix the condensation strip utnhdeer base of dishwasher use an the work surface of cabinet. Please ensure the Allen key (5A). condensation strip is flushTo adjust the front feet, use a flat screw driver and turn with edge of work surface. (3) 7 Place the dishwasher into position.(4) the front feet until the dishwasher is level (5B). 8 Level the dishwasher. The rear foot can be adjusted from the front of the dishwasher by turning 9. The dishwasher must be secured in place. There are two ways to do this: the Allen screw in the middle of the base of dishwasher use an Allen key (5A). To adjust the front feet, use a flat screw driver and turn the front feet until the dishwasher is level (5B). 9 The dishwasher must be secured in place. There are two ways to do this: » Normal work suA.rNfaorcmeal:wPorkusturtfahcee:Puint thsetiansltlaallattiioonnhoohkointoo ktheinslottoof tthheesidse lpolatneoanfdtsheceuresitidtoethepwloarkne and secure it to surface with the wood screws (6). the work surfacBe. Mwarbiltehor the wood screws.(6) granite work top:Fix the side with Screw. (7). » Marble or granite work top: Fix the side with Screw. (7) NOTE The top of the hose Frm1o0nu0st0tmbeml.ess than A Counter NOTE Drain pipe B The top of the hose must be less than A 1000mm. 40mm Drain pipe B 21 36 Instruction manual DI631 Please keep this instruction manual for future reference 40mm https://manual-hub.com/ FiguFreig7ure 7 22 Please keep this instruction manual for future reference Instruction manual DI631 37 r musTthbeedislehwvaeshl efromr upsrtobepleevredl fiosrhprroapecrkdioshpreacrkaotipoenrataionndanwd awsashh ppeerfrofromramncae.nce. spirit 1le. vPleacleoanspdioritolrevaenl odnrdaocokr atnrdacrakckintrsacidk einstihdee tdheisdhiswhwaasshheerr aassshsohwonwtonchtoecck htheact kthethat washer isdislhewvaeslh.er is level. dishw2a. sLehveelrthbeydaisdhwjuasshtienr gbytahdejutshtinreg etheletvhreeleinlegvellelinggsleingsdiinvdiidviuduaallly.. veling 3th. Wehdenislhevwelalinsghtehre,dpislhewaassheer,ppaleyasaetpteaynatitotenntinoon tntoot tloeltetththee ddiisshhwwasahesrhtipeorvteipr. over. Figure 8 gureIflelue8sttaradtjiuosntmoef nt of feet adjustment Check level Front to Back NOTE: mum adThjue msatmximeumntadjustment he feetheiisgh5t o0f tmhemfee.t is 50 mm Spirit level Check level side to side ELECTRICAL CONNECTION WARNING: For personal safety: » Do not use an extension cord or an adapter plug with this appliance. » Do not, under any circumstances, cut or remove the earthing connection from the power cord. ELECTRICAL REQUIREMENTS Please look at the rating label to know the rating voltage and connect the dishwasher to the appropriate power supply. Use the required 10 amp fuse, time delay fuse or circuit breaker recommended and provide separate circuit serving only this appliance. ELECTRICAL CONNECTION Ensure the voltage and frequency of the power corresponds to those on the rating label. Only insert the plug into an electrical socket which is earthed properly. If the electrical socket to which the appliance must be connected is not appropriate for the plug, replace the socket, rather than using an adapter as they could cause overheating and burns. GROUNDING INSTRUCTIONS This appliance must be earthed. In the event of a malfunction or breakdown, earthing will reduce the risk of electric shock by providing a path of least resistance for the electric current. This appliance is equipped with a cord having an equipment-earthing conductor and an earthing plug. The plug must be plugged into an appropriate outlet that is installed and earthed in accordance with all local standards and requirements. personal safety: not use an extension cord or an adapter plug this appliance. not, under any circumstances, cut or remove the hing connection from the power cord. WARNING: Improper connection of the equipment grounding conductor can result in the risk of an electric shock. Check with a qualified electrician or service representative if you are in doubt whether the appliance is properly grounded. Do not modify the plug provided with the appliance, if it is not fit for the outlet. Have a proper outlet installed by a qualified electrician. COLD WATER CONNECTION Connect the cold water supply hose to a threaded 3/4(inch) connector and make sure that it is fastened tightly in place. If the water pipes are new or have not been used for an extended period of time, let the water run to make sure that the water is clear and free of impurities. If this precaution is not taken, there is a risk that the water inlet can get blocked and damage the appliance. he rating label to know the rating voltage and connect the dishwasher to the appropriate power supply. Use the p fuse, time delay fuse or circuit breaker recommended and provide separate circuit serving only this appliance. Ensure the voltage and frequency of the power being corresponds to those on the rating label. Only insert the plug into an electrical socket which is earthed 38 Instrupfocrrotiptohenerlmpy.lauIngf ut,hareleDepllIea6cc3ter1icthaePllessaosoecckkekeepettth,tisorianwstthrhuecitcirohnthmtaahnneualuafospripfnultgiuareanrecafeedrenamcpeutestr be as connected they could is not appropriate cause overheating and burns. https://manual-hub.com/ WARNING: Please close the hydrant after using. ATTENTION: After installation, please make sure to keep this manual. The content of this manual is very helpful to the users. Please keep this instruction manual for future reference Instruction manual DI631 39 POSITIONING THE APPLIANCE Position the appliance in the desired location. The back should rest against the wall behind it, and the sides, along the adjacent cabinets or walls. The dishwasher is equipped with water supply and drain hoses that can be positioned either to the right or the left sides to facilitate proper installation. HOW TO DRAIN EXCESS WATER FROM HOSES If the sink waste is more than 1000mm from the floor, the excess water in the hoses cannot be drained directly into the sink. It will be necessary to drain excess water from hoses into a bowl or suitable container that is held outside and lower than the sink. WATER OUTLET Connect the water drain hose. The drain hose must be correctly fitted to avoid water leaks. Ensure that the water inlet hose is not kinked or squashed. EXTENSION HOSE If you need a drain hose extension, make sure to use a similar drain hose. It must be no longer than 4 metres, otherwise the cleaning effectiveness of the dishwasher could be reduced. SYPHON CONNECTION Insert the drain hose into a drain pipe with a minimum diameter of 40mm, or let it run into the sink, making sure to avoid bending or crimping it. The top of the hose must be less than 1000mm from the floor. START THE DISHWASHER The following things should be checked before starting the dishwasher: 1. The dishwasher is level and fixed properly. 2. The inlet valve is open. 3. There is no leakage at the connection points. 4. The wires are tightly connected. 5. The power is switched on. 6. The inlet and drain hoses are not knotted. 7. All packing materials and printings should be taken out from the dishwasher. TROUBLESHOOTING BEFORE CALLING FOR SERVICE TYPE PROBLEM POSSIBLE CAUSES WHAT TO DO Fuse blown, or the circuit Replace fuse or reset circuit breaker. Remove any other appliances breaker acted sharing the same circuit with the dishwasher. TECHNICAL PROBLEMS Dishwasher doesn't start Power supply is not turned on Water pressure is low Door of dishwasher not properly closed. Kink in drain hose Water not pumped from dishwasher Filter clogged Kitchen sink clogged Make sure the dishwasher is turned on and the door is closed securely. Make sure the power cord is properly plugged into the wall socket. Check that the water supply is connected properly and the water is turned on. Make sure to close the door properly and latch it. Check drain hose. Check coarse filter (see section titled) the " Cleaning The Filter " Check the kitchen sink to make sure it is draining well. If the problem is the kitchen sink not draining, you may need a plumber. GENERAL PROBLEMS Suds in the tub Improper detergent Use only the special dishwasher detergent to avoid suds. If this occurs, open the dishwasher and let suds evaporate. Add 1 gallon of cold water to the tub. Close and latch the dishwasher, then select any cycle. Dishwasher will drain out the water at the first step. Open the door after draining to stop and check if the suds have disappeared. Repeat if necessary. Spilled Rinse Aid Always wipe up Rinse Aid spills immediately Stained tub interior Detergent with colourant was used Make sure that the detergent is the one without colourant. White film on inside surface Hard water minerals To clean the interior, use a damp sponge with dishwasher detergent and wear rubber gloves. Never use any other cleaner than dishwasher detergent for the risk of foaming or suds. The affected items are not corrosion resistant. There are rust stains on cutlery A programme was not run after dishwasher salt was added. Traces of salt have gotten into the wash cycle. Always run the quick wash programme without any crockery in the dishwasher and without selecting the Turbo function (if present), after adding dishwasher salt. The lid of the softer is loose Check the lip. Ensure the fix is fine. 40 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 41 TYPE PROBLEM Knocking noise in the wash cabinet POSSIBLE CAUSES WHAT TO DO A spray arm is knocking against an item in a basket Interrupt the programme, and rearrange the items which are obstructing the spray arm. NOISE Rattling noise in the Items of crockery are loose in Interrupt the programme, and rearrange the items wash cabinet the wash cabinet of crockery. UNSATISFACTORY WASHING RESULTS Knocking noise in the water piped This may be caused by on-site This has no influence on the dishwasher function. installation or the cross-section of the piping If in doubt, contact a suitably qualified plumber. The dishes were not loaded correctly See notes in "Loading the Dishwasher Baskets". The programme was not powerful enough Select a more intensive programme. See" Wash Cycle Table ". The dishes are not clean Not enough detergent was dispensed Use more detergent, or change your detergent. Items are blocking the path of spray arms Rearrange the items so that the spray can rotate freely. The filter combination in the base of wash cabinet is not clean or is not correctly fitted. This may cause the spray arm jets to get blocked. Clean and/or fit the filter combination correctly. Clean the spray arm jets. See "Cleaning the Spray Arms". Cloudiness on glassware Combination of soft water and too much detergent. Use less detergent if you have soft water and select a shortest cycle to wash the glassware and to get them clean. Black or grey marks on dishes Aluminium utensils have rubbed against dishes. Use a mild abrasive cleaner to eliminate those marks. Detergent left in dispenser cups Dishes block detergent cups. Re-loading the dishes properly. UNSATISFACTORY DRYING RESULTS TYPE PROBLEM POSSIBLE CAUSES WHAT TO DO Improper loading Load the dishwasher as suggested in the directions. Too little Rinse Aid Increase the amount of Rinse Aid/refill the Rinse Aid dispenser. Dishes are removed too soon The dishes are not drying Wrong programme has been selected Empty the lower basket first and then the upper one. This will avoid water dripping from the upper basket onto the dishes in the lower one. In short programme the washing temperature is lower. This also lowers cleaning performance. Choose a programme with a long washing time. Use of cutlery with a lowquality coating Water drainage is more difficult with these items. Cutlery or dishes of this type are not suitable for washing in the dishwasher. ERROR CODES When some malfunctions occur, the appliance will display error codes to warn you: CODES The rapid light flickers quickly The ECO light flickers quickly MEANINGS Longer inlet time. Overflow. POSSIBLE CAUSES Faucet is not opened, or water intake is restricted, or water pressure is too low Some element of the dishwasher leaks. WARNING: » If overflow occurs, turn off the main water supply before calling a service. » If there is water in the base pan because of an overfill or small leak, the water should be removed before restarting the dishwasher. 42 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 43 TECHNICAL INFORMATION Height : Width : D e p t hHe:ight: Wate rWpidrthe:ssure: PoweDresptuhp: p ly: Ca p aci ty : Water pressure: Power supply: Capacity: 815mm 598 mm 815mm 5 50mm(with the door closed) 598mm0.04-1.0MP a 550mms(ewiethrtahtei ndogorl aclboseeld) 12 place settings 0.04-1.0MPa See rating label 12 plac2e7 settings 44 Instruction manual DI631 Please keep this instruction manual for future reference TECHNICAL FICHE Sheet of household dishwasher according to EU Directive 1059/2010: Manufacturer Type / Description Standard place settings Energy efficiency class 1 Annual energy consumption 2 Energy consumption of the standard cleaning cycle Power consumption of off-mode Power consumption of left-on mode Annual water consumption 3 Drying efficiency class 4 Standard cleaning cycle 5 Programme duration of the standard cleaning cycle Noise level Mounting Could be built-in Height Width Depth (with connectors) Power consumption Rated voltage / frequency Water pressure (flow pressure) Caple DI631 12 A++ 258 kWh 0.91 kWh 0.45 W 0.49 W 3080 litre A ECO 45ºC 185 min 49 dB(A) re 1 pW Build under Yes 81.5 cm 59.8 cm 55 cm 1930 W 230 V~ / 50 Hz 0.4-10 bar = 0.04-1 MPa https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 45 NOTE: 1 A + + + (highest efficiency) to D (lowest efficiency). 2 Energy consumption 188 kWh per year, based on 280 standard cleaning cycles using cold water fill and the consumption of the low power modes. Actual energy consumption will depend on how the appliance is used. 3 Water consumption 2240 litres per year, based on 280 standard cleaning cycles. Actual water consumption will depend on how the appliance is used. 4 A (highest efficiency) to G (lowest efficiency). 5 This programme is suitable for cleaning soiled normally soiled tableware and that it is the most efficient programme in terms of its combined energy and water consumption for that type of tableware. The device meets the European standards and the directives in the current version at delivery(If the version number is not in conformity with the latest standards, please refer to the latest version number): - LVD 2014/35/EU - EMC 2014/30/EU - ERP 2009/125/EC The above values have been measured in accordance with standards under specified operating conditions. Results may vary greatly according to quantity and pollution of the dishes, water hardness, amount of detergent, etc. The manual is based on the European Union's standards and rules. NOTES: 46 Instruction manual DI631 Please keep this instruction manual for future reference https://manual-hub.com/ Please keep this instruction manual for future reference Instruction manual DI631 47 Caple Service Fourth Way Avonmouth Bristol BS11 8DW T: 0117 938 1900 E: service@caple.co.uk www.caple.co.uk https://manual-hub.com/