Instruction Manual for Welland models including: FG2001B-A, Smart Full Body Composition Scale, FG2001B-A Smart Full Body Composition Scale
fitdays weegschaal | Slimme Weegschaal - Bluetooth - Lichaamsanalyse - Smart Full Body Composition Scale Model No.: FG2001B-A
File Info : application/pdf, 51 Pages, 966.00KB
DocumentDocumentSmart Full Body Composition Scale Model No.: FG2001B-A Instruction Manual NL EN DE FR IT ES Read this manual before using and save for future reference Manual Language Netherland ....................................................................... 01 English ............................................................................. 08 Deutsch ............................................................................ 16 Français ........................................................................... 24 Italiano.............................................................................. 32 Español............................................................................. 40 Snelstartgids 1.Download de "Fitdays" App uit de Apple Store of de Google Play store 2.Verwijder het plastic isolatieblad van de batterijdeksel. 3.Plaats de weegschaal op een harde en vlakke ondergrond. 4.Meet met blote voeten en volledig contact met de elektroden. 5.Schakel de slimme app in en verbind de weegschaal voordat u gaat meten. 6.Volg onderstaande handelingen en zorg ervoor dat uw houding correct is om te meten. 08 16 24 32 Armen niet recht Armen te dicht bij de taille Houd je armen recht in een hoek van 45 of 90 graden De pink raakt het elektrodekussen niet De duimen te dicht bij elkaar 1 Zorg ervoor dat al uw vingers de elektroden pads aanraken Slimme personenweegschaal Bedankt voor het kiezen van de Smart Full Body Composition Scale. Deze weegschaal is uw persoonlijke gezondheidsassistent. Het maakt gebruik van bio-elektrische impedantieanalyse (BIA) -technologie om u de gegevens te bieden die u nodig hebt om uw persoonlijke gezondhe- idsstatistieken bij te houden: BMI (Body Mass Index), lichaamsvetpercentage, lichaamswater, spiermassa, botmassa, proteïne en veel meer! Wij hopen dat u veel plezier beleeft aan het gebruik van uw nieuwe product. ! Waarschuwing °NIET gebruiken met medische implantaten zoals pacemakers. °Ga NIET op de rand van de weegschaal staan en spring er NIET op. °Overbelast de weegschaal NIET (MAX. 180kg / 400lb). °Laat geen voorwerpen op de weegschaal vallen, aangezien dit de sensoren kan beschadigen. °Dompel de weegschaal NIET onder water en gebruik geen chemische reinigingsmiddelen. Reinig de weegschaal met een licht vochtige doek. °Niet aanbevolen voor zwangere vrouwen °NIET aanbevolen voor baby's, peuters en kinderen onder de 10 jaar. °Elke meting verkregen met dit apparaat is alleen ter referentie en mag niet worden beschouwd als een medisch advies. °Raadpleeg uw huisarts of arts voordat u wijzigingen aanbrengt in uw dieet, trainingsplan of fysieke activiteiten. °Plaats de weegschaal voor het meten altijd op een harde, droge en vlakke ondergrond. °Zorg ervoor dat uw voeten droog zijn voordat u op de weegschaal gaat staan. °Sluit de batterijen aan volgens de aangegeven polariteiten. °Verwijder de batterijen als de weegschaal langere tijd niet wordt gebruikt. °Gebruik het apparaat NIET als het beschadigd is. Het gebruik van een beschadigd apparaat kan letsel of onjuiste resultaten veroorzaken. Controleer het apparaat voor elk gebruik. °Controleer of de batterijen leeg zijn en vervang deze indien nodig als de weegschaal niet werkt. °Wees voorzichtig bij gebruik op een natte en/of gladde ondergrond. Product Specificaties Product afmetingen: LED scherm: Weegeenheden: Weeg limiet: Weeg nauwkeurigheid: Voeding: Werkbare temperatuur: Werkbare luchtvochtigheid: 300x300x26mm 86x36mm Kg/lb/st 5kg-180kg 0.1kg/0.2Ib 4 x 1.5V AAA batterijen 10-40 40%-80% RH 2 Symbolen De batterijen in de weegschaal zijn te zwak. Plaats nieuwe batterijen (zie het hoofdstuk "Batterijen vervangen"). Meer dan 180kg op de weegschaal. De weegschaal is overbelast Er is een fout opgetreden tijdens de meting. Stap 5 seconden van de weegschaal af en stap er opnieuw op om het meetproces te herhalen. Product overzicht Elektrodesensoren Hand metingen Verbindingsdraad Verbindingsdraad Verbindingsdraad Voetsensoren batterijdeksel 3 Ondersteunde apparaten IOS 8.0 of hoger Android 6.0 of hoger Installatie FITDAYS APP 1.Zoek op "Fitdays" in Apple Store of Google Play Store of scan de onderstaande QR-code: 2.Download en installeer de app op uw apparaat. 3.Het app-pictogram verschijnt op uw telefoon of tablet nadat de installatie is voltooid. Hoe gebruik je de weegschaal de eerste keer met de Fitdays App? 1. Open de app "Fitdays" op uw apparaat. 2. Registreer je eigen account via e-mail of log in met een social media account. 3. Voeg persoonlijke gegevens toe en bevestig. 4 4. iOS: Zorg ervoor dat Bluetooth is ingeschakeld en Bluetooth-autorisatie is toegestaan. Android: Zorg ervoor dat Bluetooth is ingeschakeld en GPS en locatie is toegestaan. iOS Android 5.Trek achterop de weegschaal de isolatieplaat eruit en plaats de weegschaal vervolgens op een harde en vlakke ondergrond en stap met één voet op de weegschaal om de weegschaal te activeren. Wacht tot op het display "0,0 kg" verschijnt. 6.Koppel de weegschaal via Bluetooth. Zorg ervoor dat de weegschaal is ingeschakeld tijdens het koppelen. Als u de APP op het hoofdscherm laat staan maakt deze automatisch verbinding met de weegschaal. Of u kunt ook op "Account" klikken ----> "Apparaat"---> "+" ----> "Bluetooth" de schaal Bluetooth ID vinden: My_scale. 7.De app toont uw gegevens binnen enkele seconden. 5 Bluetooth Connectie 1) Normale verbinding Zie het hoofdstuk 'Hoe gebruik je de weegschaal voor het eerst met de Fitdays App? 2 ) Als de normale verbinding met Bluetooth is mislukt, probeer dan de onderstaande stappen: 1. Reset de weegschaal door één batterij 5 seconden eruit te halen en er weer in te doen. 2. Reset de Bluetooth-verbinding. Zorg ervoor dat Bluetooth en GPS (alleen Android) zijn ingeschakeld op uw apparaat. 6HOHFWHHURQGHUKHWJHGHHOWH$FFRXQWKHW$SSDUDDW Schuif naar links om het huidige apparaat te verwijderen. 7LNUHFKWVERYHQRSRPQDDUGHNRSSHOLQJVPRGXVWHJDDQ 6WDSPHWppQYRHWRSGHZHHJVFKDDORPKHPZDNNHUWHPDNHQ 1DHHQSDDUVHFRQGHQYHUVFKLMQWGHZHHJVFKDDOQDDPWLNWXHURSHQEHYHVWLJWXGH]H 6WDSRSQLHXZRSGHZHHJVFKDDORPGHNRSSHOLQJWHYROWRRLHQ Probleemoplossing 1. Bluetooth kan geen verbinding maken ° Zorg ervoor dat de weegschaal en de Bluetooth en GPS (alleen Android) op uw telefoon zijn ingeschakeld; °Controleer de systeemversie van uw smartphone, deze moet iOS 8.0 of hoger / Android 6.0 hoger zijn; °Voor een succesvolle verbinding is er een Bluetooth-pictogram op het display en het woord "Verbonden" wordt weergegeven op de cirkel van de startpagina op de telefoon; °Als u geen verbinding kunt maken via Bluetooth, klikt u op Account--->Device om de schaal- ID te vinden: My_scale. 2. Geen lichaamsvetgegevens na weging. °U moet met blote voeten op de weegschaal stappen. °Zorg ervoor dat uw voeten en de weegschaal droog zijn. °Stap van de weegschaal af wanneer de meting niet is voltooid (blijf ongeveer 10 seconden op de weegschaal staan totdat het nummer op het display stopt met knipperen). °Bluetooth is niet ingeschakeld. ° Bluetooth is gekoppeld aan een andere weegschaal. 3. Incorrecte gewichtsgegevens. °Controleer of de weegschaal zich op een harde en vlakke ondergrond bevindt. °Controleer elke sensorvoet aan de achterkant om er zeker van te zijn dat er niets aan de onderkant vastzit. 4. Incorrect vet-spierverhouding op de App. °De instellingen van de bodyparameter zijn onjuist, controleer of u het juiste geslacht, de juiste lengte en leeftijd hebt ingevoerd. ° Controleer of u de atleetmodus heeft geactiveerd. 5.Hoe kalibreer ik de weegschaal opnieuw? °Stap op de weegschaal om deze in te schakelen. Laat het automatisch dalen tot 0,0 kg om te kalibreren. 6 6.De weegschaal gaat niet aan °Controleer of de isolatieplaat is uitgetrokken. °Controleer of de batterij leeg is en vervang indien nodig nieuwe batterijen. Veelgestelde vragen en antwoorden 1.Hoe krijg je het meest nauwkeurige resultaat? - Ga stevig op de weegschaal staan en schud niet tijdens het wegen. - Voer uw meting elke dag op hetzelfde tijdstip uit om de meest nauwkeurige resultaten te garanderen. - Plaats uw weegschaal op een harde en vlakke ondergrond en stap vervolgens met blote voeten op de weegschaal, daarna wordt het display ingeschakeld. - Controleer uw profielgegevens (geslacht, leeftijd en lengte), zorg ervoor dat alle gegevens correct zijn. - Controleer de ondergrond, zorg ervoor dat het hard en vlak is, sommige plaatsen lijken vlak maar zijn dit eigenlijk niet. Je zou kunnen proberen om naar een ander hardere ondergrond te gaan totdat je het hetzelfde resultaat krijgt. - Controleer de onderkant van de schaal vóór de meting, als deze niet in evenwicht is, zijn de gegevens niet nauwkeurig. - Zorg ervoor dat "0.0" op het display wordt weergegeven voor elk gebruik. - Weeg met blote voeten waarbij elke voet zowel de bovenste als de onderste elektrode raakt. 2.Hoe herstart de weegschaal? - Neem allereerst één van de batterijen uit de weegschaal. - Stop deze na 5 seconden weer terug. - Hierna herstrat de weegschaal automatisch en kunt u er nadien weer opstappen. 3.Hoe kan je de taal wijzigen? - Fitdays APP--->Account--->Instellingen--->Taal 4.How to change unit? - Fitdays APP--->Account--->Instellingen--->Wijzig-eenheden . Kijk voor meer informatie op FAQ van Fitdays APP. "Account >Instellingen >FAQ" Advies Houdt de weegschaal buiten het gebruik van de kinderen . ! Stel de weegschaal niet bloot aan hitte of vuur, wat gemakkelijk explosie zal veroorzaken. Afgedankte elektrische producten mogen niet bij het huisvuil worden weggegooid. Gelieve te recyclen waar faciliteiten bestaan. Neem contact op met uw lokale autoriteit of winkelier voor recyclingadvies. 7 Quick Start Guide 1. Download the "Fitdays" App from Apple Store or Google Play. 2. Remove the plastic isolation sheet from the battery cover. 3. Place the scale on the hard flat surface. 4. Measure with bare feet and fully contact with the electrodes. 5. Turn on the smart App and get the scale connected before measuring. 6. Follow below operations and make sure the posture is correct for measuring. Arms not straight Arms close to waist Keep your arms straight 45 degrees or 90 degrees The tail finger does not touch the electrode pad Two thumbs close together 8 Keep your all fingers touch the electrode pads Healthkeep Smart Full Body Composition Scale Thanks for choosing Smart Full Body Composition Scale. This scale uses bio-electrical impedance analysis (BIA) technology to help you conveniently measure Body weight, Body balance, BMI, Body fat rate, Visceral fat, Body water, Skeletal muscle rate, Muscle mass, Bone mass, Protein, BMR, Body age and etc. ! WARNING °DO NOT use with medical implants such as pacemakers. °DO NOT stand on the edge of the scale or jump on it; °DO NOT overload the scale (Max.180kg/440lb/28st) °DO NOT drop scale or drop the objects on it as this may damage the sensors. °DO NOT immerse the scale in water or use chemical cleaning agents. Clean the scale with a slightly damp cloth. °Not recommended for pregnant women. °Not recommended for infants, toddlers, and children who are under 10 years of age. °Any measurement obtained using this device is for reference only and should not be consid ered as a medical opinion. °DO NOT be used to diagnose or treat any medical condition. You should consult your primary care doctor or physician before making changes to your diet, exercise plan or physical activities. °Always place the scale on a hard, dry and flat surface before measurement. °Make sure your feet are dry before stepping on the scale. °Connect the batteries in accordance with the correct polarities indicated. °Remove batteries if the scale is not be used for a prolonged period of time °DO NOT use the device if damaged. The continuous use of a damaged unit may cause injury or improper results. Please check the device before each use. °First check the batteries power and replace it if needed, if the scale malfunction. °Be careful when using on the wet and slippery surface. Product Specification Product size: LED screen display: Weight unit: Weight limit: Weight division: Power Supply: Operating temperature: Operation humidity: 300x300x26mm 86x36mm Kg/lb/st 5kg-180kg 0.1kg/0.2Ib 4 x 1.5V AAA batteries 10-40 40%-80% RH 9 Indication Symbols The batteries in the scales are too weak. Insert new batteries (see the"Replacing the Batteries" chapter). More than 180kg are on the scales. The scales are overloaded. An error has occurred during measurement. Step off the scales for 5 seconds and step onto them again to repeat the measuring process. Product Overview Electrode sensors Measuring hand bar Connecting wire Electrode sensors Electrode sensors Sensor feet Battery cover 10 Indication Symbols iOS: 8.0 or higher Android: 5.0 or higher Install Fitdays App 1.Scan the below QR Code to download APP, or search "Fitdays" from Apple Store and Google Play. 2.Download and install the App "Fitdays" on your device. 3.The App icon will appear on your phone or tablet after the installation is completed. How to use the scale with Fitdays App for the first time? 1.Open the App "Fitdays" on your device. 2.Register your own account by email or login with social media account. 3.Add personal data and confirm. 11 4.iOS: Make sure Bluetooth is on and Bluetooth Authorization is allowed. Android: Make sure Bluetooth is on and GPS and Location is allowed. iOS Android 5.In the back of scale, pull out the insulation sheet, then place the scale on a hard, flat surface, step onto the scale with single foot to activate the scale. Wait until the display shows "0.0kg". 6.Pair the scale through Bluetooth. Make sure the scale is on when pairing. Leaving the APP on its main screen, it will automatically connect to the scale. Or you could also click "Account" ----> "Device"---> "+" ----> "Bluetooth" find the scale Bluetooth ID: My_scale. 7.The app will show your data within a few seconds. 12 Bluetooth Connection 1) Regular Connection See the "How to use the scale with Fitdays App for the first time?" chapter 2 ) If the regular connection to Bluetooth failed, please try the below steps: 1. Reset the scale by taking out one battery for 5 seconds and putting it back in. 2. Reset the Bluetooth connection. Ensure Bluetooth and GPS (Android only) are enabled on your device. 8QGHUWKH$FFRXQWVHFWLRQVHOHFWWKH³'HYLFH´6OLGHLWOHIWWRGHOHWHWKHFXUUHQWGHYLFH 7DSRQWKHWRSULJKWWRHQWHUSDLULQJPRGH 6WHSRQWRWKHVFDOHZLWKVLQJOHIRRWWRZDNHLWXS $IWHUDIHZVHFRQGVRIORDGLQJWKHVFDOHQDPHZLOODSSHDUWDSDQGFRQILUPLW 6WHSRQWKHVFDOHDJDLQWRFRPSOHWHWKHSDLULQJ Troubleshooting 1. Bluetooth failed to connection. °Make sure the scale and the Bluetooth and GPS (Android only) on your phone are on; °Check the system version of your smart phone, it must be iOS 8.0 or higher/Android 6.0 higher; °For successfully connection, there is a Bluetooth icon on the display and the word "Connected" will show on the circle of the homepage on phone; °If fail to connect via Bluetooth, please click Account--->Device to find the scale ID: My_scale. 2.No body fat data after weighting. °Must step onto the scale with bare feet. °Make sure your feet and the scale are both dry. °Step off the scale when measurement does not finish (Please keep standing on the scale around 10 second until the number on the display stops flashing). °Bluetooth is not turned on. °Bluetooth is paired with a difference scale. 3.Incorrect weight data occurs. °Check whether the scale is on a hard, flat surface. °Check each sensor foot on the back to make sure nothing is stuck to the bottom of it. 4.Incorrect fat-muscle ratio shows on App. °The body parameter settings are incorrect, check to make sure you entered the correct gender, height, and age. °Check if you activate the Athlete Mode. 5.How do I re-calibrate the scale after removing? °Step on the scale to turn it on. Let it automatically drop to 0.0kg to calibrate. 13 6.The scale does not turn on. °Check if the insulation sheet has been pulled out. °Check if battery has run out of power and change new batteries if needed. Frequently Asked Questions & Answers 1.How to get the most accurate result? - Stand on the scale firmly, do not shake when weigh-in. - Take your measurement at the same time each day to ensure the most accurate results. - Please place your scale on the hard/flat ground, then step on the scale with bare feet, after that the display will be turned on. - Check your profile information (gender, age and height), make sure all the data is accurate. - Check the place, make sure it is hard/flat, some place seems flat, but actually not, you could try to move to different hard surface until it gets the same result. - Check the bottom of the scale before measurement, if it is not balanced, the data won't be accurate. - Make sure that "0.0" shown on the display, before each time use. - Keep bare feet, with each foot touching both the top and bottom electrode. 2.How to restart the scale? - First, take one of the batteries out of the scale. - Then, put back the batteries and wait for 5 seconds. - After the scale has been automatic restart, you can step onto the scale. 3.How to change language? - Fitdays APP--->Account--->Settings--->Language 4.How to change unit? - Fitdays APP--->Account--->Settings--->Switch units For more information, please check FQA from Fitdays APP. "Account >Settings >FAQ" Advice Place the scale far away from the children in case of falling down or crashing. ! Do not expose the scale to heat or fire, which will easily cause explosion. Waste electrical products should not be disposed of with household waste. Please recycle where facilities exist. Check with your local Authority or retailer for recycling advice. 14 Intelligent Ganzkörper-Kompositionsskala Modell Nr.: FG2001B-A Bedienungsanleitung Lesen Sie dieses Handbuch vor der Verwendung und bewahren Sie es zum späteren Nachschlagen auf 8 Schnellstartanleitung 1. Laden Sie die Anwendung "Fitdays" aus dem Apple Store oder von Google Play herunter. 2. Entfernen Sie die Kunststoffisolierfolie von der Batterieabdeckung. 3. Stellen Sie die Waage auf eine harte, flache Oberfläche. 4. Mit bloßen Füßen messen und die Elektroden vollständig berühren. 5. Öffnen Sie vor dem Messen die Intelligent App und schließen Sie die Waage an. 6. Befolgen Sie die nachstehenden Schritte und stellen Sie sicher, dass die Haltung für die Messung geeignet ist. Arm ist nicht gerade Arme nahe der Taille Halte deine Arme gerade 45 Grad oder 90 Grad Der Schwanzfinger berührt Zwei Daumen das Elektrodenpad nicht zusammen 9 Lassen Sie alle Finger die Elektrodenpads berühren Healthkeep Smart Full Body Composition Scale Vielen Dank, dass Sie sich für Smart Full Body Composition Scale entschieden haben. Diese Skala verwendet die BIA-Technologie (Bio-Electric Impedance Analysis), mit der Sie bequem Körpergewicht, Körperbalance, BMI, Körperfettrate, viszerales Fett, Körperwasser, Skelettmuskelfrequenz, Muskelmasse, Knochenmasse, Protein, BMR und Körper messen können Alter und etc. ! WARNUNG °NICHT mit medizinischen Implantaten wie Herzschrittmachern verwenden. °Stellen Sie sich NICHT auf den Rand der Waage und springen Sie nicht darauf. °Überlasten Sie die Waage NICHT (max.180 kg/440lb/28st) °Lassen Sie KEINE Waage oder Gegenstände fallen, da dies die Sensoren beschädigen kann. °Tauchen Sie die Waage NICHT in Wasser und verwenden Sie keine chemischen Reinigungsmittel. Reinigen Sie die Waage mit einem leicht feuchten Tuch. °Nicht für schwangere Frauen empfohlen. °Nicht empfohlen für Säuglinge, Kleinkinder und Kinder unter 10 Jahren. °Jede Messung, die mit diesem Gerät durchgeführt wird, dient nur als Referenz und sollte nicht als medizinisches Gutachten betrachtet werden. °NICHT zur Diagnose oder Behandlung von Erkrankungen verwendet werden. Sie sollten Ihren Hausarzt konsultieren, bevor Sie Änderungen an Ihrer Ernährung, Ihrem Trainingsplan oder Ihren körperlichen Aktivitäten vornehmen. °Stellen Sie die Waage vor der Messung immer auf eine harte, trockene und flache Oberfläche. °Stellen Sie sicher, dass Ihre Füße trocken sind, bevor Sie auf die Waage treten. °Schließen Sie die Batterien gemäß den angegebenen Polaritäten an. °Entfernen Sie die Batterien, wenn die Waage längere Zeit nicht benutzt wird. °Verwenden Sie das Gerät NICHT, wenn es beschädigt ist. Die kontinuierliche Verwendung eines beschädigten Geräts kann zu Verletzungen oder falschen Ergebnissen führen. Bitte überprüfen Sie das Gerät vor jedem Gebrauch. °Überprüfen Sie zuerst die Batterieleistung und ersetzen Sie sie bei Bedarf, wenn die Waage nicht richtig funktioniert. °Seien Sie vorsichtig, wenn Sie es auf nasser und rutschiger Oberfläche verwenden. Produktspezifikation Produktgröße: LED-Bildschirmanzeige: Gewichtseinheit: Gewichtsbeschränkung: Gewichtsverteilung: Energieversorgung: Betriebstemperatur: Betriebsfeuchtigkeit: 300x300x26mm 86x36mm Kg/lb/st 5kg-180kg 0.1kg/0.2Ib 4 x 1.5V AAA Batterien 10-40 40%-80% RH 10 Anzeigesymbole Die Batterien in der Waage sind zu schwach. Legen Sie neue Batterien ein (siehe Kapitel "Austauschen der Batterien"). Mehr als 180 kg sind auf der Waage. Die Waage ist überlastet. C-Während der Messung ist ein Fehler aufgetreten. Steigen Sie 5 Sekunden lang von der Waage und treten Sie erneut darauf, um den Messvorgang zu wiederholen. Produktübersicht Elektrodensensoren Handstange messen Verbindungskabel Elektrodensensoren Elektrodensensoren Sensorfüße Batteriefach 11 Support-Geräte: iOS: 8.0 oder höher Android: 5.0 oder höher Installieren Sie die Fitdays App 1.Scannen Sie den folgenden QR-Code, um die APP herunterzuladen, oder suchen Sie im Apple Store und bei Google Play nach ,,Fitdays". 2.Downloaden und installieren Sie die App ,,Fitdays" auf Ihrem Gerät. 3.Das App-Symbol wird nach Abschluss der Installation auf Ihrem Telefon oder Tablet angezeigt. Wie verwende ich die Waage zum ersten Mal mit der Fitdays App? 1.Öffnen Sie die App ,,Fitdays" auf Ihrem Gerät. 2.Registrieren Sie Ihr eigenes Konto per E-Mail oder melden Sie sich mit einem Social Media-Konto an. 3.Fügen Sie persönliche Informationen hinzu und bestätigen Sie. 12 4.iOS: Stellen Sie sicher, dass Bluetooth aktiviert ist und die Bluetooth-Autorisierung zulässig ist. Android: Stellen Sie sicher, dass Bluetooth aktiviert ist und GPS und Standort zulässig sind. iOS Android 5.Ziehen Sie auf der Rückseite der Waage die Isolierfolie heraus, legen Sie die Waage auf eine harte, flache Oberfläche und treten Sie mit einem Fuß auf die Waage, um die Waage zu aktivieren. Warten Sie, bis auf dem Display ,,0.0kg" angezeigt wird. 6.Koppeln Sie die Waage über Bluetooth. Stellen Sie sicher, dass die Skala beim Pairing eingeschaltet ist. Lassen Sie die APP auf dem Hauptbildschirm eingeschaltet, sie stellt automatisch eine Verbindung zur Waage her. Sie können auch auf "Konto" ----> "Gerät" ---> "+" ----> "Bluetooth" klicken, um die Waage der Bluetooth-ID zu finden: My_scale. 7.Die App zeigt Ihre Daten innerhalb weniger Sekunden an. 13 Bluetooth-Verbindung 1) Regelmäßige Verbindung Siehe "Wie verwende ich die Waage zum ersten Mal mit der Fitdays-App?" Kapitel 2)Wenn Sie keine ordnungsgemäße Verbindung zu Bluetooth herstellen können, führen Sie die folgenden Schritte aus: 1. Setzen Sie die Waage zurück, indem Sie eine Batterie 5 Sekunden lang herausnehmen und wieder einlegen. 2. Setzen Sie die Bluetooth-Verbindung zurück. Stellen Sie sicher, dass Bluetooth und GPS (nur Android) auf Ihrem Gerät aktiviert sind. :lKOHQ6LHLP$EVFKQLWW.RQWRGDV*HUlWDXV6FKLHEHQ6LHHVQDFKOLQNVXPGDV aktuelle Gerät zu löschen. 7LSSHQ6LHREHQUHFKWVDXIXPGHQ3DLULQJ0RGXVDXI]XUXIHQ 7UHWHQ6LHPLWHLQHP)XDXIGLH:DDJHXPVLHDXI]XZHFNHQ 1DFKHLQLJHQ6HNXQGHQGHV/DGHQVZLUGGHU1DPHGHU:DDJHDQJH]HLJW7LSSHQ6LHDXIXQG bestätigen Sie ihn. 7UHWHQ6LHHUQHXWDXIGLH:DDJHXPGLH.RSSOXQJDE]XVFKOLHHQ Fehlerbehebung 1. Bluetooth konnte keine Verbindung herstellen. 6WHOOHQ6LHVLFKHUGDVVGLH:DDJHXQG%OXHWRRWKXQG*36QXU$QGURLGDXI,KUHP7HOHIRQ eingeschaltet sind. hEHUSUIHQ6LHGLH6\VWHPYHUVLRQ,KUHV6PDUWSKRQHV6LHPXVVL26RGHUK|KHU Android 6.0 höher sein. )UHLQHHUIROJUHLFKH9HUELQGXQJZLUGDXIGHP'LVSOD\HLQ%OXHWRRWK6\PERODQJH]HLJWXQG das Wort ,,Verbunden" wird im Kreis der Startseite des Telefons angezeigt. :HQQNHLQH9HUELQGXQJEHU%OXHWRRWKKHUJHVWHOOWZHUGHQNDQQNOLFNHQ6LHDXI.RQWR! Gerät, um die Waagen-ID zu ermitteln: My_scale. 2.Keine Körperfettdaten nach dem Gewicht. 0XVVPLWEORHQ)HQDXIGLH:DDJHWUHWHQ 6WHOOHQ6LHVLFKHUGDVV,KUH)HXQGGLH:DDJHWURFNHQVLQG 6FKDOWHQ6LHGLH:DDJHDEZHQQGLH0HVVXQJQLFKWEHHQGHWLVW%LWWHEOHLEHQ6LHHWZD Sekunden auf der Waage, bis die Zahl auf dem Display nicht mehr blinkt). %OXHWRRWKLVWQLFKWHLQJHVFKDOWHW %OXHWRRWKLVWPLWHLQHU'LIIHUHQ]VNDODJHNRSSHOW 3.Es treten falsche Gewichtsdaten auf. hEHUSUIHQ6LHREVLFKGLH:DDJHDXIHLQHUKDUWHQHEHQHQ)OlFKHEHILQGHW hEHUSUIHQ6LHMHGHQ6HQVRUIXDXIGHU5FNVHLWHXPVLFKHU]XVWHOOHQGDVVQLFKWVDP Boden klebt. 4.Das falsche Fett-Muskel-Verhältnis wird in der App angezeigt. 'LH(LQVWHOOXQJHQGHU.|USHUSDUDPHWHUVLQGIDOVFKhEHUSUIHQ6LHRE6LHGDVULFKWLJH Geschlecht, die richtige Größe und das richtige Alter eingegeben haben. hEHUSUIHQ6LHRE6LHGHQ$WKOHWHQPRGXVDNWLYLHUHQ 14 5.Wie kalibriere ich die Waage nach dem Entfernen neu? 6FKUHLWHQ6LHDXIGLH:DDJHXPVLHHLQ]XVFKDOWHQ/DVVHQ6LHHV]XP.DOLEULHUHQDXWRPDWLVFK auf 0,0 kg fallen. 6.Die Waage lässt sich nicht einschalten. hEHUSUIHQ6LHREGDV,VROLHUEODWWKHUDXVJH]RJHQZXUGH hEHUSUIHQ6LHREGLH%DWWHULHOHHULVWXQGWDXVFKHQ6LHEHL%HGDUIQHXH%DWWHULHQDXV Häufig gestellte Fragen und Antworten 1.Wie erhalte ich das genaueste Ergebnis? - Stellen Sie sich fest auf die Waage und schütteln Sie sie beim Wiegen nicht. - Nehmen Sie Ihre Messung jeden Tag zur gleichen Zeit vor, um die genauesten Ergebnisse zu erzielen. - Bitte stellen Sie Ihre Waage auf den harten / flachen Boden, treten Sie dann mit bloßen Füßen auf die Waage, dann wird das Display eingeschaltet. - Überprüfen Sie Ihre Profilinformationen (Geschlecht, Alter und Größe) und stellen Sie sicher, dass alle Daten korrekt sind. - Überprüfen Sie den Ort, stellen Sie sicher, dass er hart / flach ist. Ein Ort scheint flach zu sein, aber tatsächlich nicht. Sie können versuchen, auf eine andere harte Oberfläche zu wechseln, bis das gleiche Ergebnis erzielt wird. - Überprüfen Sie die Beine der Waage vor der Messung. Wenn sie nicht ausgeglichen ist, sind die Daten nicht genau. - Stellen Sie vor jedem Gebrauch sicher, dass "0.0" auf dem Display angezeigt wird. - Halten Sie nackte Füße, wobei jeder Fuß sowohl die obere als auch die untere Elektrode berührt. 2.Wie starte ich die Waage neu? - Nehmen Sie zuerst eine der Batterien aus der Waage. - Legen Sie dann die Batterien wieder ein und warten Sie 5 Sekunden. - Nach dem automatischen Neustart der Waage können Sie die Waage betreten. 3.Wie ändere ich die Sprache? - Fitdays APP ---> Konto ---> Einstellungen ---> Sprache 4.Wie wird die Einheit gewechselt? - Fitdays APP ---> Konto ---> Einstellungen ---> Einheiten wechseln Weitere Informationen finden Sie in der FQA der Fitdays APP. "Konto> Einstellungen> FAQ" Rat Stellen Sie die Waage im Falle eines Sturzes oder eines Absturzes weit von den Kindern entfernt auf. ! Setzen Sie die Waage keiner Hitze oder Feuer aus, da dies leicht zu Explosionen führen kann. Abfallelektrische Produkte dürfen nicht mit dem Hausmüll entsorgt werden. Bitte recyceln Sie, wo Einrichtungen vorhanden sind. Wenden Sie sich an Ihre örtliche Behörde oder Ihren Händler, um Ratschläge zum Recycling zu erhalten. 15 Balance Pèse-Personne de Composition Corporelle Intelligente Model No.: FG2001B-A Manuel d'instructions Lisez ce manuel avant de l'utiliser et conservez-le pour référence future 16 Guide d'Opération 1. Téléchargez l'application «Fitdays» depuis l'Apple Store ou Google Play. 2. Retirez la feuille isolante en plastique du couvercle de la batterie. 3. Placez la balance sur la surface plane et dure. 4. Mesurez avec les pieds nus et entièrement en contactez avec les électrodes. 5. Suivez les opérations ci-dessous et assurez-vous que la posture est correcte pour la mesure. Le bras n'est pas droit Le bras ne peut pas Gardez vos bras tendus 45 être près de la taille degrés ou 90 degrés Le doigt de queue ne toucher le tampon d'électrode Les deux pouces ne Gardez tous vos doigts se touchent pas toucher les électrodes 17 Healthkeep Balance Pèse-Personne de Composition Corporelle Intelligente Merci d'avoir choisi la balance pèse-personne de composition corporelle intelligente. Cette balance utilise la technologie d'analyse d'impédance bioélectrique (BIA) pour vous aider à mesurer facilement le poids corporel, l'équilibre corporel, l'IMC, le taux de graisse corporelle, la graisse viscérale, l'eau corporelle, le taux musculaire squelettique, la masse musculaire, la masse osseuse, les protéines, le BMR , L'âge corporel et etc. ! AVERTISSEMENT 1(3$6XWLOLVHUDYHFGHVLPSODQWVPpGLFDX[WHOVTXHGHVVWLPXODWHXUVFDUGLDTXHV 1(3$6VHWHQLUGHERXWVXUOHERUGGHODEDODQFHRXVDXWHUGHVVXV 1(3$6VXUFKDUJHUODEDODQFH0D[NJOEVW 1(3$6ODLVVHUWRPEHUODEDODQFHQLIDLUHWRPEHUOHVREMHWVGHVVXVFDUFHODSRXUUDLWHQGRPPDJHU les capteurs. 1(3$6LPPHUJHUODEDODQFHGDQVO HDXRXXWLOLVHUGHVDJHQWVGHQHWWR\DJHFKLPLTXHV1HWWR\H] la balance avec un chiffon légèrement humide. 1RXVQHVRPPHVSDVUHFRPPDQGpVSRXUOHVIHPPHVHQFHLQWHV 1RXVQHVRPPHVSDVUHFRPPDQGpVSRXUOHVHQFHLQWHVOHVWRXWSHWLWVHWOHVHQIDQWVGHPRLQV de 10 ans. 7RXWHPHVXUHREWHQXHjO DLGHGHFHWDSSDUHLOHVWIRXUQLHjWLWUHLQGLFDWLIXQLTXHPHQWHWQHGRLW pas être considérée comme un avis médical. 1(3$6rWUHXWLOLVpSRXUGLDJQRVWLTXHURXWUDLWHUXQHFRQGLWLRQPpGLFDOH9RXVGHYULH]FRQVXOWHU votre médecin de soins primaires ou votre médecin avant de modifier votre alimentation, votre programme d'exercice ou vos activités physiques. 3ODFH]WRXMRXUVODEDODQFHVXUXQHVXUIDFHGXUHVqFKHHWSODQHDYDQWODPHVXUH $VVXUH]YRXVTXHYRVSLHGVVRQWVHFVDYDQWGHPRQWHUVXUODEDODQFH &RQQHFWH]OHVSLOHVFRQIRUPpPHQWDX[SRODULWpVFRUUHFWHVLQGLTXpHV 5HWLUH]OHVSLOHVVLODEDODQFHQ HVWSDVXWLOLVpHSHQGDQWXQHSpULRGHSURORQJpH 1(3$6XWLOLVHUO DSSDUHLOV LOHVWHQGRPPDJp/ XWLOLVDWLRQFRQWLQXHG XQDSSDUHLOHQGRPPDJp peut entraîner des blessures ou des résultats incorrects. Veuillez vérifier l'appareil avant chaque utilisation. 9pULILH]G DERUGO DOLPHQWDWLRQGHVSLOHVHWUHPSODFH]OHVVLQpFHVVDLUHHQFDVGH dysfonctionnement de la balance. 6R\H]SUXGHQWORUVTXHYRXVO XWLOLVH]VXUXQHVXUIDFHPRXLOOpHHWJOLVVDQWH Spécification de produit Taille du Produit: 300x300x26mm Affichage de L'écran LED: 86x36mm 8QLWpGH3RLGV Kg/lb/st Limite de Poids: 5kg-180kg Division de Poids: 0.1kg/0.2Ib Source de Puissance: 4 x 1.5V AAA batteries Température de Fonctionnement: 10-40 Humidité de Fonctionnement: 40%-80% RH 18 Symboles d'indication Les piles de la balance sont trop faibles. Insérez de nouvelles piles (voir le chapitre «Remplacement des piles»). Plus de 180 kg sont sur la balance. Les balances sont surchargées. 8QHHUUHXUV HVWSURGXLWHORUVGHODPHVXUH'HVFHQGH]GHODEDODQFHSHQGDQW secondes et remontez dessus pour répéter le processus de mesure. Présentation du Produit Capteurs d'électrodes Barre à main de mesure Fil de connexion Capteurs d'électrodes Capteurs d'électrodes Pieds de capteur Couvercle de la batterie 19 Symboles d'indication iOS: 8.0 ou supérieur Android: 5.0 ou supérieur Installez l'application Fitdays 1.Scannez le code QR ci-dessous pour télécharger l'application ou recherchez «Fitdays» sur Apple Store et Google Play. 2.Téléchargez et installez l'application «Fitdays» sur votre appareil. 3.L'icône de l'application apparaît sur votre téléphone ou votre tablette une fois l'installation terminée. Comment utiliser la balance avec l'application Fitdays pour la première fois? 1.Ouvrez l'application «Fitdays» sur votre appareil.. 2.Enregistrez votre propre compte par e-mail ou connectez-vous avec un compte de réseau social. 3.Ajoutez des données personnelles et confirmez. 20 4.iOS: Assurez-vous que Bluetooth est activé et que l'autorisation Bluetooth est autorisée. Android: Assurez-vous que Bluetooth est activé et que le GPS et la localisation sont autorisés. iOS Android 5.À l'arrière de la balance, retirez la feuille isolante, puis placez la balance sur une surface dure et plane, montez sur la balance avec un seul pied pour activer la balance. Attendez que l'écran affiche «0.0kg». 6.Pairez la balance via Bluetooth. Assurez-vous que la balance est allumée lors de l'appairage. En laissant l'APP sur son écran principal, il se connectera automatiquement à la balance. Ou vous pouvez également cliquer sur «Compte»----> «Appareil» ---> «+»----> «Bluetooth» trouver l'ID Bluetooth de la balance: My_scale. 7.L'application affichera vos données en quelques secondes. 21 La Connexion Bluetooth 1) La connexion régulière Consultez la section «Comment utiliser la balance avec l'application Fitdays pour la première fois?» 2) Si la connexion normale à Bluetooth échoue, veuillez essayer les étapes ci-dessous: 1.Réinitialisez la balance en retirant une pile pendant 5 secondes et en la remettant en place. 2.Réinitialisez la connexion Bluetooth. Assurez-vous que Bluetooth et GPS (Android uniquement) sont activés sur votre appareil. 'DQVODVHFWLRQ©&RPSWHªVpOHFWLRQQH]©'LVSRVLWLIª)DLWHVOHJOLVVHUYHUVODJDXFKHSRXU supprimer l'appareil actuel. $SSX\H]VXU©ªHQKDXWjGURLWHSRXUDFFpGHUDXPRGHGHFRXSODJH 0RQWH]VXUODEDODQFHDYHFXQVHXOSLHGSRXUODUpYHLOOHU $SUqVTXHOTXHVVHFRQGHVGHFKDUJHPHQWOHQRPGHODEDODQFHDSSDUDvWUDDSSX\H]VXUHW confirmez-le. 0RQWH]jQRXYHDXVXUODEDODQFHSRXUWHUPLQHUO DSSDLUDJH Dépannage 1.Bluetooth n'a pas réussi à se connecter. $VVXUH]YRXVTXHODEDODQFHHWOH%OXHWRRWKHWOH*36$QGURLGXQLTXHPHQWVXUYRWUHWpOpSKRQH sont activés; 9pULILH]ODYHUVLRQGXV\VWqPHGHYRWUHWpOpSKRQHLQWHOOLJHQWLOGRLWrWUHL26RXVXSpULHXU Android 6.0 ou supérieur; 3RXUXQHFRQQH[LRQUpXVVLHLO\DXQHLF{QH%OXHWRRWKVXUO pFUDQHWOHPRW©&RQQHFWpªDSSDUDvWUD sur le cercle de la page d'accueil du téléphone; (QFDVG pFKHFGHODFRQQH[LRQYLD%OXHWRRWKFOLTXH]VXU©&RPSWHª!©'LVSRVLWLIªSRXUWURXYHU l'ID de la balance: My_scale. 2. Aucune donnée de graisse corporelle après la pondération. 'RLWPRQWHUVXUODEDODQFHSLHGVQXV $VVXUH]YRXVTXHYRVSLHGVHWODEDODQFHVRQWWRXVOHVGHX[VHFV 'HVFHQGH]GHODEDODQFHORUVTXHODPHVXUHQHVHWHUPLQHSDVYHXLOOH]UHVWHUGHERXWVXUOD balance pendant environ 10 secondes jusqu'à ce que le nombre sur l'écran cesse de clignoter). %OXHWRRWKQ HVWSDVDFWLYp %OXHWRRWKHVWDVVRFLpjXQHpFKHOOHGHGLIIpUHQFH 3. Des données de poids incorrectes se produisent. 9pULILH]VLODEDODQFHVHWURXYHVXUXQHVXUIDFHGXUHHWSODQH 9pULILH]FKDTXHSLHGGHFDSWHXUjO DUULqUHSRXUYRXVDVVXUHUTXHULHQQ HVWFROOpDXEDVGHFHOXLFL 4.Le rapport graisse-muscle incorrect s'affiche sur l'application. /HVUpJODJHVGHVSDUDPqWUHVGXFRUSVVRQWLQFRUUHFWVYpULILH]TXHYRXVDYH]HQWUpOHVH[H la taille et l'âge corrects. 9pULILH]VLYRXVDFWLYH]OHPRGH$WKOqWH 5. Comment recalibrer la balance après l'avoir retirée? 0RQWH]VXUODEDODQFHSRXUO DOOXPHU/DLVVH]OHWRPEHUDXWRPDWLTXHPHQWjNJSRXUFDOLEUHU 22 6.La balance ne s'allume pas. 9pULILH]VLODIHXLOOHLVRODQWHDpWpUHWLUpH 9pULILH]VLODEDWWHULHHVWpSXLVpHHWUHPSODFH]ODVLQpFHVVDLUH Foire aux questions et réponses 1.Comment obtenir le résultat le plus précis? -Se tenir fermement sur la balance, ne pas secouer lors de la pesée. -Prenez votre mesure à la même heure chaque jour pour assurer les résultats les plus précis. -Veuillez placer votre balance sur un sol dur / plat, puis montez sur la balance pieds nus, après quoi l'écran sera allumé. -Vérifiez les informations de votre profil (sexe, âge et taille), assurez-vous que toutes les données sont exactes. -Vérifiez l'endroit, assurez-vous qu'il est dur / plat, qu'un endroit semble plat, mais en fait pas, vous pouvez essayer de vous déplacer sur une surface dure différente jusqu'à ce que le résultat soit le même. -Vérifiez le bas de l'échelle avant la mesure, s'il n'est pas équilibré, les données ne seront pas exactes. -Assurez-vous que "0.0" s'affiche à l'écran avant chaque utilisation. -Gardez pieds nus, chaque pied touchant à la fois l'électrode supérieure et inférieure. 2. Comment redémarrer la balance? -D'abord, retirez l'une des piles de la balance. -Ensuite, remettez les piles en place et attendez 5 secondes. -Après le redémarrage automatique de la balance, vous pouvez monter sur la balance. 3.Comment changer de langue? -Fitdays APP ---> Compte ---> Paramètres ---> Langue 4.Comment changer d'unité? -Fitdays APP ---> Compte ---> Paramètres ---> Changement d'unité Pour plus d'informations, veuillez consulter FQA de Fitdays APP. «Compte> Paramètres> FAQ» Conseil Placez la balance loin des enfants en cas de chute ou de collision. ! N'exposez pas la balance à la chaleur ou au feu, ce qui provoquerait facilement une explosion. Les déchets de produits électriques ne doivent pas être jetés avec les ordures ménagères. Veuillez recycler là où les installations existent. Consultez votre autorité locale ou votre revendeur pour obtenir des conseils de recyclage. 23 Smart Full Scala della composizione corporea Modello: FG2001B-A Manuale di istruzioni Leggere questo manuale prima di utilizzare e salvare per riferimento futuro 24 Guida Rapida 1. Scarica l'app "Fitdays" da Apple Store o Google Play. 2. Rimuovere il foglio isolante in plastica dal coperchio della batteria. 3. Posizionare la bilancia sulla superficie piana e dura. 4. Misurare a piedi nudi e contattare completamente gli elettrodi. 5. Accendi l'app smart e collega la bilancia prima di misurare. 6. Seguire le operazioni seguenti e assicurarsi che la postura sia corretta per la misurazione. Braccia non-dritte Braccio vicino alla vita Tieni le braccia dritte di 45 gradi o 90 gradi Il dito della coda non tocca Due pollici non il cuscinetto dell'elettrodo possono toccarsi 25 Tieni tutte le dita a contatto con gli elettrodi Healthkeep Smart Scala per la composizione corporea completa Grazie per aver scelto la scala di composizione corporea completa intelligente. Questa bilancia utilizza la tecnologia di analisi dell'impedenza bioelettrica (BIA) per aiutarti a misurare comodamente peso corporeo, equilibrio corporeo, indice di massa corporea, percentuale di grasso corporeo, grasso viscerale, acqua corporea, frequenza dei muscoli scheletrici, massa muscolare, massa ossea, proteine, BMR , Età del corpo ed ecc. ! AVVERTIMENTO 121XWLOL]]DUHFRQLPSLDQWLPHGLFLFRPHSDFHPDNHU 121VRVWDUHVXOERUGRGHOODELODQFLDRVDOWDUFLVRSUD 121VRYUDFFDULFDUHODELODQFLDPD[NJOE 121IDUFDGHUHODELODQFLDRIDUFDGHUHJOLRJJHWWLVXGLHVVDLQTXDQWRFLzSRWUHEEH danneggiare i sensori. 121LPPHUJHUHODELODQFLDLQDFTXDRXWLOL]]DUHGHWHUJHQWLFKLPLFL3XOLUHODELODQFLDFRQXQ panno leggermente umido. 1RQUDFFRPDQGDWRSHUOHGRQQHLQJUDYLGDQ]D 1RQUDFFRPDQGDWRSHUQHRQDWLEDPELQLHEDPELQLGLHWjLQIHULRUHDLDQQL 4XDOVLDVLPLVXUD]LRQHRWWHQXWDXWLOL]]DQGRTXHVWRGLVSRVLWLYRqVRORGLULIHULPHQWRHQRQGHYH essere considerata come un parere medico. 121HVVHUHXWLOL]]DWRSHUGLDJQRVWLFDUHRWUDWWDUHDOFXQDFRQGL]LRQHPHGLFD6LFRQVLJOLDGL consultare il proprio medico curante o medico prima di apportare modifiche alla propria dieta, piano di allenamento o attività fisiche. 3RVL]LRQDUHVHPSUHODELODQFLDVXXQDVXSHUILFLHGXUDDVFLXWWDHSLDQDSULPDGHOODPLVXUD]LRQH $FFHUWDUVLFKHLSLHGLVLDQRDVFLXWWLSULPDGLVDOLUHVXOODELODQFLD &ROOHJDUHOHEDWWHULHVHFRQGROHSRODULWjLQGLFDWH 5LPXRYHUHOHEDWWHULHVHODELODQFLDQRQYLHQHXWLOL]]DWDSHUXQSHULRGRGLWHPSRSUROXQJDWR 121XWLOL]]DUHLOGLVSRVLWLYRVHGDQQHJJLDWR/ XVRFRQWLQXRGLXQ XQLWjGDQQHJJLDWDSXzFDXVDUH lesioni o risultati impropri. Si prega di controllare il dispositivo prima di ogni utilizzo. &RQWUROODUHLQQDQ]LWXWWRO DOLPHQWD]LRQHGHOOHEDWWHULHHVRVWLWXLUODVHQHFHVVDULRVHODELODQFLD non funziona correttamente. 3UHVWDUHDWWHQ]LRQHTXDQGRVLXWLOL]]DVXOODVXSHUILFLHEDJQDWDHVFLYRORVD Specifiche di prodotto Taglia del prodotto: Display a LED: 8QLWjGLSHVR Limite di peso: Weight division: Divisione del peso: Temperatura di esercizio: 8PLGLWjGLIXQ]LRQDPHQWR 300x300x26mm 86x36mm Kg/lb/st 5kg-180kg 0.1kg/0.2Ib 4 x 1.5V AAA batteries 10-40 40%-80% RH 26 Simboli di indicazione Le batterie della bilancia sono troppo scariche Inserire nuove batterie (consultare il capitolo "Sostituzione delle batterie"). Più di 180 kg sono in bilancia Le bilance sono sovraccariche. Si è verificato un errore durante la misurazione: scendere dalla bilancia per 5 secondi e salire di nuovo su di essi per ripetere il processo di misurazione. Panoramica del Prodotto Sensori di elettrodi Barra di misurazione Filo di collegamento Sensori di elettrodi Sensori di elettrodi Piedi del sensore Coperchio della batteria 27 Dispositivi supportati iOS: 8.0 o versioni successive Android: 5.0 o versione successiva Installa l'app Fitdays 1.Scan il codice QR qui sotto per scaricare l'APP o cercare "Fitdays" da Apple Store e Google Play. 2.Scarica e installa l'app "Fitdays" sul tuo dispositivo. 3.L'icona dell'app apparirà sul tuo telefono o tablet al termine dell'installazione. Come utilizzare la bilancia con l'app Fitdays per la prima volta? 1.Aprire l'app "Fitdays" sul dispositivo. 2.Registra il tuo account tramite e-mail o accedi con un account di social media. 3.Aggiungi dati personali e conferma. 28 4. iOS: assicurati che il Bluetooth sia attivo e che l'autorizzazione Bluetooth sia consentita. Android: assicurati che il Bluetooth sia attivo e che GPS e posizione siano consentiti.che GPS e posizione siano consentiti. iOS Android 5.Sul retro della bilancia, estrarre il foglio isolante, quindi posizionare la bilancia su una superficie dura e piana, salire sulla bilancia con un solo piede per attivare la bilancia. Attendere fino a quando sul display non viene visualizzato "0.0kg". 6.Accoppiare la bilancia tramite Bluetooth. Assicurarsi che la bilancia sia accesa durante l'associazione. Lasciando l'APP sulla sua schermata principale, si connetterà automaticamente alla bilancia. Oppure puoi anche fare clic su "Account"----> "Dispositivo" ---> "+"> "Bluetooth" trova l'ID Bluetooth della bilancia: My_scale. 7.L'app mostrerà i tuoi dati in pochi secondi. 29 Connessione Bluetooth 1) Connessione regolare Vedi "Come utilizzare la bilancia con l'app Fitdays per la prima volta?" capitolo 2 ) Se la connessione regolare a Bluetooth non è riuscita, provare i passaggi seguenti: 1.Ripristinare la bilancia estraendo una batteria per 5 secondi e reinserendola. 2.Ripristinare la connessione Bluetooth. Assicurati che Bluetooth e GPS (solo Android) siano abilitati sul tuo dispositivo. 6XOODVH]LRQH$FFRXQWVHOH]LRQDUH'LVSRVLWLYR6FRUULYHUVRVLQLVWUDSHUHOLPLQDUHLO dispositivo corrente. 7RFFDUHLQDOWRDGHVWUDSHUDFFHGHUHDOODPRGDOLWjGLDVVRFLD]LRQH 6DOLUHVXOODELODQFLDFRQXQVRORSLHGHSHUULDWWLYDUOR 'RSRDOFXQLVHFRQGLGLFDULFDPHQWRYHUUjYLVXDOL]]DWRLOQRPHGHOODELODQFLDWRFFDUHH confermarlo. 6DOLUHQXRYDPHQWHVXOODELODQFLDSHUFRPSOHWDUHO DVVRFLD]LRQH Risoluzione dei problemi 1.La connessione Bluetooth non è riuscita. $FFHUWDUVLFKHODELODQFLDHLO%OXHWRRWKHLO*36VROR$QGURLGVXOWHOHIRQRVLDQRDFFHVL &RQWUROODODYHUVLRQHGLVLVWHPDGHOWXRVPDUWSKRQHGHYHHVVHUHL26RYHUVLRQHVXFFHVVLYD / Android 6.0 versione successiva; 3HUXQDFRUUHWWDFRQQHVVLRQHVXOGLVSOD\qSUHVHQWHXQ LFRQD%OXHWRRWKHODSDUROD³&ROOHJDWR´ apparirà sul cerchio della homepage sul telefono; 6HODFRQQHVVLRQH%OXHWRRWKQRQULHVFHIDUHFOLFVX0LR!'LVSRVLWLYRSHUWURYDUHO ,' bilancia: My_scale. 2.Nessun dato sul grasso corporeo dopo la ponderazione. 'HYHVDOLUHVXOODELODQFLDDSLHGLQXGL $FFHUWDUVLFKHLSLHGLHODELODQFLDVLDQRHQWUDPELDVFLXWWL 6FHQGHUHGDOODELODQFLDTXDQGRODPLVXUD]LRQHQRQWHUPLQDVLSUHJDGLULPDQHUHLQSLHGLVXOOD bilancia per circa 10 secondi fino a quando il numero sul display smette di lampeggiare). %OXHWRRWKQRQDWWLYDWR ,O%OXHWRRWKqDVVRFLDWRDXQDVFDODGLGLIIHUHQ]D 3.Si verificano dati di peso errati. &RQWUROODUHVHODELODQFLDVLWURYDVXXQDVXSHUILFLHGXUDHSLDQD &RQWUROODUHFLDVFXQSLHGLQRGHOVHQVRUHVXOUHWURSHUDVVLFXUDUVLFKHQXOODVLDEORFFDWRVXO fondo di esso. 4.Il rapporto muscolo-grasso errato viene visualizzato sull'app. /HLPSRVWD]LRQLGHLSDUDPHWULGHOFRUSRQRQVRQRFRUUHWWHYHULILFDUHGLDYHULQVHULWRVHVVR altezza ed età corretti. &RQWUROODVHDWWLYLODPRGDOLWjDWOHWD 5.Come ricalibrare la bilancia dopo la rimozione? 6DOLUHVXOODELODQFLDSHUDFFHQGHUOD/DVFLDFKHVFHQGDDXWRPDWLFDPHQWHDNJSHUFDOLEUDUH 30 6.La bilancia non si accende. &RQWUROODUHVHLOIRJOLRLVRODQWHqVWDWRHVWUDWWR &RQWUROODUHVHODEDWWHULDVLqHVDXULWDHVHQHFHVVDULRVRVWLWXLUHOHEDWWHULHQXRYH Domande frequenti e risposte 1.Come ottenere il risultato più accurato? -Resta saldamente sulla bilancia, non agitarla durante la pesatura. -Prendi la tua misura ogni giorno alla stessa ora per garantire i risultati più accurati. -Si prega di posizionare la bilancia sul terreno duro / piatto, quindi salire sulla bilancia a piedi nudi, dopodiché il display si accenderà. -Controlla le informazioni del tuo profilo (sesso, età e altezza), assicurati che tutti i dati siano accurati. -Controlla il posto, assicurati che sia duro / piatto, un posto sembra piatto, ma in realtà no, potresti provare a spostarti su un'altra superficie dura fino a ottenere lo stesso risultato. -Controllare la parte inferiore della scala prima della misurazione, se non è bilanciata, i dati non saranno accurati. -Assicurarsi che "0.0" sia visualizzato sul display, prima di ogni utilizzo. -Mantenere i piedi nudi, con ogni piede che tocca l'elettrodo superiore e inferiore. 2.Come riavviare la bilancia? -Prima di tutto, togli una delle batterie dalla bilancia. -Poi, rimetti le batterie e attendi 5 secondi. -Dopo che la bilancia è stata riavviata automaticamente, è possibile salire sulla bilancia. 3.Come cambiare la lingua? -Fitdays App---> Mio ---> Impostazione ---> Linguaggio 4.Come cambiare unità? -Fitdays APP--->-Account ---> Impostazioni ---> Cambia unità Per ulteriori informazioni, controlla FQA dall'APP Fitdays. "Mio> Impostazione> FAQ" Consigli Posizionare la bilancia lontano dai bambini in caso di caduta o crash. ! Non esporre la bilancia al calore o al fuoco, che potrebbe facilmente causare un'esplosione. I rifiuti di prodotti elettrici non devono essere smaltiti insieme ai rifiuti domestici. Si prega di riciclare dove esistono strutture. Verificare con l'autorità locale o il rivenditore per consigli sul riciclaggio. 31 Inteligente de Composición de Cuerpo Completo Model No.: FG2001B-A Manual de Instrucciones Lea este manual antes de usar y guárdelo para futuras referencias 32 Guía de inicio rápido 1. Descargue la aplicación "Fitdays" de Apple Store o Google Play. 2. Retire la lámina de aislamiento de plástico de la tapa de la batería. 3. Coloque la balanza sobre la superficie plana y dura. 4. Mida con los pies descalzos y totalmente en contacto con los electrodos. 5. Encienda la aplicación inteligente y conecte la báscula antes de medir. 5. Siga las siguientes operaciones y asegúrese de que la postura sea la correcta para medir. Brazos no rectos Brazos cerca de la cintura Mantenga los brazos rectos 45 grados o 90 grados El dedo de la cola no toque la almohadilla del electrodo Dos pulgares cerca juntos Mantén todos tus dedos tocar los electrodos 33 Healthkeep Inteligente de Composición de Cuerpo Completo Escala Gracias por elegir Smart Full Body Composition Scale. Esta báscula utiliza la tecnología de análisis de impedencia biotécrica (BIA) para ayudarle a medir convenientemente el peso corporal, equilibrio corporal, IMC, tasa de grasa corporal, grasa visceral, agua corporal, tasa muscular esquelética, masa muscular, masa ósea, proteína, BMR, edad corporal y etc. ! Advertencia 12ORXVHFRQLPSODQWHVPpGLFRVFRPRPDUFDSDVRV 12VHSRQJDGHSLHHQHOERUGHGHODEiVFXODQLVDOWHVREUHHOOD 12VREUHFDUJXHODEiVFXOD0D[NJOEVW 12GHMHFDHUODEiVFXODQLVXHOWHORVREMHWRVVREUHHOOD\DTXHHVWRSXHGHGDxDUORVVHQVRUHV 12VXPHUMDODEiVFXODHQDJXDQLXWLOLFHDJHQWHVGHOLPSLH]DTXtPLFRV/LPSLHODEiVFXODFRQ un paño ligeramente húmedo. 1RUHFRPHQGDGRSDUDPXMHUHVHPEDUD]DGDV 1RUHFRPHQGDGRSDUDEHEpVQLxRVSHTXHxRV\QLxRVPHQRUHVGHDxRV &XDOTXLHUPHGLGDREWHQLGDFRQHVWHGLVSRVLWLYRHVVRORGHUHIHUHQFLD\QRGHEHFRQVLGHUDUVH como una opinión médica. 12VHXVHSDUDGLDJQRVWLFDURWUDWDUQLQJXQDDIHFFLyQPpGLFD'HEHFRQVXOWDUDVXPpGLFRGH atención primaria o médico antes de realizar cambios en su dieta, plan de ejercicios o actividades físicas. &RORTXHVLHPSUHODEiVFXODVREUHXQDVXSHUILFLHGXUDVHFD\SODQDDQWHVGHODPHGLFLyQ $VHJ~UHVHGHTXHVXVSLHVHVWpQVHFRVDQWHVGHSLVDUODEiVFXOD &RQHFWHODVEDWHUtDVGHDFXHUGRFRQODVSRODULGDGHVFRUUHFWDVLQGLFDGDV 5HWLUHODVEDWHUtDVVLODEiVFXODQRVHXVDSRUXQSHUtRGRSURORQJDGR 12XVHHOGLVSRVLWLYRVLHVWiGDxDGR(OXVRFRQWLQXRGHXQDXQLGDGGDxDGDSXHGHFDXVDU lesiones o resultados incorrectos. Comprueba el dispositivo antes de cada uso. 3ULPHURYHULILTXHODHQHUJtDGHODVEDWHUtDV\UHHPSOiFHODVLHVQHFHVDULRVLODEiVFXODQR funciona correctamente. 7HQJDFXLGDGRFXDQGRORXVHHQVXSHUILFLHVPRMDGDV\UHVEDODGL]DV Especificaciones del producto Tamaño del producto: Pantalla LED: 8QLGDGGHSHVR Límite de peso: División de peso: Fuente de alimentación: Temperatura de funcionamiento: Operación humedad: 300x300x26mm 86x36mm Kg/lb/st 5kg-180kg 0.1kg/0.2Ib 4 x 1.5V AAA baterías 10-40 40%-80% RH 34 Símbolos de indicación Las baterías en la balanza son demasiado débiles. Inserte baterías nuevas (consulte el capítulo "Reemplazo de las baterías"). Más de 180 kg están en la balanza. Las básculas están sobrecargadas. Se ha producido un error durante la medición. Baje de la báscula durante 5 segundos y vuelva a subir para repetir el proceso de medición. Descripción del producto Sensores de electrodos Barra de mano de medición Cable de conexión Sensores de electrodos Sensores de electrodos Tarifa del sensor Tapa de la batería 35 Símbolos de indicación iOS: 8.0 o mayor Android: 5.0 o mayor Instalar la aplicación Fitdays 1.Escanee el siguiente código QR para descargar la APLICACIÓN, o busque "Fitdays" en Apple Store y Google Play 2.Descargue e instale la aplicación "Fitdays" en su dispositivo. 3.El ícono de la aplicación aparecerá en su teléfono o tableta después de que se complete la instalación. ¿Cómo usar la báscula con la aplicación Fitdays por primera vez? 1.Abra la aplicación "Fitdays" en su dispositivo. 2.Registre su propia cuenta por correo electrónico o inicie sesión con una cuenta de redes sociales. 3.Agregar datos personales y confirmar 36 4.iOS: Asegúrese de que Bluetooth esté activado y que la Autorización de Bluetooth esté permitida Android:Asegúrese de que Bluetooth esté activado y que el GPS y la ubicación estén permitidos. iOS Android 5.En la parte posterior de la báscula, extraiga la lámina de aislamiento, luego coloque la báscula sobre una superficie dura y plana, suba a la báscula con un solo pie para activar la báscula. Espere hasta que la pantalla muestre "0.0kg". 6.Empareje la báscula a través de Bluetooth. Asegúrese de que la báscula esté encendida cuando se empareje. Al dejar la aplicación en su pantalla principal, se conectará automáticamente a la báscula. O también puede hacer clic en "Cuenta"----> "Dispositivo" ---> "+"> "Bluetooth" encuentre la báscula ID de Bluetooth: My_scale. 7.La aplicación mostrará sus datos en unos segundos. 37 Conexión Bluetooth 1) Conexión regular Consulte "¿Cómo usar la báscula con la aplicación Fitdays por primera vez?" capítulo 2 ) Si falla la conexión regular a Bluetooth, intente los siguientes pasos: 1.Restablezca la báscula sacando una batería durante 5 segundos y volviéndola a colocar. 2.Restablece la conexión Bluetooth. Asegúrese de que Bluetooth y GPS (solo Android) estén habilitados en su dispositivo. (QODVHFFLyQ&XHQWDVHOHFFLRQHHO'LVSRVLWLYR'HVOtFHORKDFLDODL]TXLHUGDSDUDHOLPLQDU el dispositivo actual. 7RFDHQODHVTXLQDVXSHULRUGHUHFKDSDUDLQJUHVDUDOPRGRGHHPSDUHMDPLHQWR 6~EDVHDODEiVFXODFRQXQVRORSLHSDUDGHVSHUWDUOD 'HVSXpVGHXQRVVHJXQGRVGHFDUJDDSDUHFHUiHOQRPEUHGHODEiVFXODWRTXH\FRQILUPH 9XHOYDDVXELUODEiVFXODSDUDFRPSOHWDUHOHPSDUHMDPLHQWR Solución de problemas 1.Bluetooth no pudo conectarse. $VHJ~UHVHGHTXHODEiVFXOD\HO%OXHWRRWK\*36VROR$QGURLGGHVXWHOpIRQRHVWpQHQFHQGLGRV 9HULILTXHODYHUVLyQGHOVLVWHPDGHVXWHOpIRQRLQWHOLJHQWHGHEHVHUL26RVXSHULRU Android 6.0 superior; 3DUDXQDFRQH[LyQH[LWRVDKD\XQLFRQRGH%OXHWRRWKHQODSDQWDOOD\ODSDODEUD&RQHFWDGR aparecerá en el círculo de la página de inicio en el teléfono; 6LQRVHFRQHFWDDWUDYpVGH%OXHWRRWKKDJDFOLFHQ&XHQWD!'LVSRVLWLYRSDUDHQFRQWUDUOD ID de la báscula: My_scale. 2.No hay datos de grasa corporal después de ponderar. 'HEHVXELUDODEiVFXODFRQORVSLHVGHVFDO]RV $VHJ~UHVHGHTXHVXVSLHV\ODEiVFXODHVWpQVHFRV %DMHGHODEiVFXODFXDQGRODPHGLFLyQQRWHUPLQHPDQWpQJDVHGHSLHHQODEiVFXODDOUHGHGRU de 10 segundos hasta que el número en la pantalla deje de parpadear). %OXHWRRWKQRHVWiDFWLYDGR %OXHWRRWKHVWiHPSDUHMDGRFRQXQDHVFDODGHGLIHUHQFLD 3.Se producen datos de peso incorrectos. 9HULILTXHVLODEiVFXODHVWiVREUHXQDVXSHUILFLHGXUD\SODQD 9HULILTXHFDGDSLHGHOVHQVRUHQODSDUWHSRVWHULRUSDUDDVHJXUDUVHGHTXHQRKD\DQDGD pegado en la parte inferior. 4.La relación grasa-músculo incorrecta se muestra en la aplicación. /DFRQILJXUDFLyQGHORVSDUiPHWURVGHOFXHUSRHVLQFRUUHFWDYHULILTXHTXHKD\DLQJUHVDGRHO sexo, la altura y la edad correctos. &RPSUXHEDVLDFWLYDVHOPRGR$WOHWD 5.¿Cómo recalibro la báscula después de quitarla? 3LVHODEiVFXODSDUDHQFHQGHUOD'HMHTXHFDLJDDXWRPiWLFDPHQWHDNJSDUDFDOLEUDU 38 6.La báscula no se enciende. &RPSUXHEHVLODOiPLQDGHDLVODPLHQWRVHKDH[WUDtGR &RPSUXHEHVLODEDWHUtDVHKDDJRWDGR\FDPELHODVEDWHUtDVQXHYDVVLHVQHFHVDULR Preguntas y respuestas frecuentes 1.¿Cómo obtener el resultado más preciso? -Párese firmemente en la báscula, no lo agite cuando pese. -Realice su medición a la misma hora todos los días para garantizar los resultados más precisos.. -Coloque su báscula en el suelo duro / plano, luego pise la báscula con los pies descalzos, luego se encenderá la pantalla. -Verifique la información de su perfil (sexo, edad y altura), asegúrese de que todos los datos sean precisos. -Verifique el lugar, asegúrese de que sea duro / plano, algún lugar parece plano, pero en realidad no, puede intentar moverse a una superficie dura diferente hasta obtener el mismo resultado. -Compruebe la parte inferior de la escala antes de la medición; si no está equilibrada, los datos no serán precisos. -Asegúrese de que se muestre "0.0" en la pantalla, antes de cada uso. -Mantenga los pies descalzos, con cada pie tocando el electrodo superior e inferior. 2.¿Cómo reiniciar la báscula? -Primero, saque una de las baterías de la báscula. -Luego, vuelva a colocar las baterías y espere 5 segundos. -Después de que la báscula se haya reiniciado automáticamente, puede subir a la báscula. 3.¿Cómo cambiar el idioma? -Fitdays APP ---> Cuenta ---> Configuración ---> Idioma 4.¿Cómo cambiar la unidad? -APLICACIÓN Fitdays ---> Cuenta ---> Configuración ---> Cambiar unidades Para obtener más información, consulte FQA desde la aplicación Fitdays. "Cuenta> Configuración> Preguntas frecuentes" Consejo Coloque la balanza lejos de los niños en caso de caerse o estrellarse. ! No exponga la báscula al calor o al fuego, lo que fácilmente provocará una explosión. Los productos eléctricos de desecho no deben desecharse con la basura doméstica. Por favor, recicle en las instalaciones correspondientes. Consulte con su autoridad local o minorista para obtener asesoramiento sobre reciclaje. 39 Neto: 40 Neto: 41