Air cooler in the summer, humidifier in the winter. PAE 19 H. □ Evaporation air cooler. □ 4-in-1 air cooler: air cooling, heating, ventilation and air ...
... 69. Fan heaters ... such as the TTK 54 E or the TTK 127 E are ideal for lovers of upscale ...
HOME COMFORT COMFORTABLE CLIMATE FOR HOME HOME APPLIANCES 1 | 2024 TROTEC A DANTHERMGROUP COMPANY 2 TROTEC OUR SUBSIDIARIES ON SITE FOR YOU WORLDWIDE. Scan QR code Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification SecoSan Air cleaning Contents DEHUMIDIFICATION HUMIDIFICATION SECOSAN AIR CLEANING HEATING AIR CONDITIONING AIR COOLING VENTILATION CLEANING POWER CONSUMPTION ACCESSORIES INDEX %QOHQTVFGJWOKFKGTU...............................................................................................................................................4 - 29 #KTJWOKFKGTU ..........................................................................................................................................................30 - 37 Air washers...............................................................................................................................................................38 - 39 SecoSan Sticks .......................................................................................................................................................40 - 41 Air cleaners...............................................................................................................................................................42 - 47 Radiant heaters ........................................................................................................................................................48 - 59 Radiant ceiling heaters ...........................................................................................................................................60 - 63 Pedestal radiant heaters ........................................................................................................................................64 - 69 Fan heaters ...............................................................................................................................................................70 - 79 Convectors ................................................................................................................................................................80 - 87 1KNNNGFTCFKCVQTU ....................................................................................................................................................88 - 93 Infrared heating panels...........................................................................................................................................94 - 97 Comfort air conditioners .......................................................................................................................................98 - 111 Air coolers ............................................................................................................................................................112 - 121 Fans .......................................................................................................................................................................122 - 133 Vacuum cleaner ...................................................................................................................................................134 - 136 Cordless high-pressure cleaner................................................................................................................................. 137 Power strips................................................................................................................................................................... 138 Accessories ..........................................................................................................................................................140 - 141 Index.......................................................................................................................................................................142 - 143 Heating Air cooling Air conditioning Ventilation Cleaning Accessories This publication replaces all previous announcements. No part of this publication may be reproduced, processed using electronic systems, replicated or distributed in any form, without our written authorisation. Subject to technical changes. All rights reserved. Names of goods are used without guarantee of free usage keeping to the manufacturer's syntax. The names of goods used are TGIKUVGTGFCPFUJQWNFDGEQPUKFGTGFCUUWEJ9GTGUGTXGVJGTKIJVVQOQFKH[FGUKIPKPVJGKPVGTGUVQHQPIQKPIRTQFWEVKORTQXGOGPVUWEJCUUJCRGCPFEQNQWTOQFKECVKQPU6JGUEQRGQHFGNKXGT[ may vary from that in the product description. All due care has been taken in compiling this document. We accept no liability for errors or omissions. © Trotec ® TROTEC 3 DEHUMIDIFICATION COMFORT DEHUMIDIFIERS THE APPROPRIATE SOLUTION FOR EVERY DEMAND Peltier dehumidifiers For keeping small rooms dry TTP 1 E TTP 2 E TTP 5 E TTP 10 E Desiccantdehumidifier For powerful drying applications in small, unheated and cold rooms Dehumidifier with HEPA air cleaner The perfect combination for a healthy room climate TTR 50 E TTK 27 HEPA TTK 64 HEPA TTK 70 HEPA (Plus) TTK 99 HEPA TTR 57 E TTK 26 E TTK 30 E TTK 32 E TTK 33 E TTK 75 E TTK 90 E 4 DEHUMIDIFICATION HOMECOMFORT SERIES TTK 95 E TTK 96 E TTK 100 E Constantly updated: www.trotec.com/catalogs Trotec Humidification DeEhntufemiudcifhitcuantigon SecoSan PRACTICAL KNOWLEDGE GUIDE A comprehensive overview of device differences, functional principles and possible applications of the different types of dehumidifiers can be found at: DEHUMIDIFICATION EVERYTHING YOU NEED TO KNOW! uk.trotec.com/dehumidification-info Benefit from the world`s largest selection of dehumidifiers! Condensation dehumidifiers For drying and dry keeping of differently sized rooms TTK 52 E TTK 53 E TTK 54 E TTK 60 E TTK 66 E TTK 67 E TTK 68 E TTK 71 E TTK 72 E TTK 73 E Air cleaning Heating Air cooling Air conditioning Ventilation Cleaning Accessories TTK 120 S TTK 120 E TTK 122 E An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info TTK 127 E DEHUMIDIFICATION HOMECOMFORT SERIES 5 DEHUMIDIFICATION Mini-Dehumidifiers for small rooms that are difficult to ventilate TTP 1 E Peltier dehumidifiers For keeping rooms that are difficult to ventilate, e.g. walk-in closets, windowless bathrooms or pantries, dry Modern thermoelectric Peltier element High degree of flexibility due to extra-small construction Simple dehumidification operation Air purification function filters animal hair, fluff and dust Ultra-silent operation thanks to Peltier element Energy-efficient Particularly easy handling TTP 2 E Peltier dehumidifiers For keeping rooms that are difficult to ventilate, e.g. walk-in closets, windowless bathrooms or pantries, dry Modern thermoelectric Peltier element High degree of flexibility due to extra-small construction Simple dehumidification operation Air purification function filters animal hair, fluff and dust Ultra-silent operation thanks to Peltier element Energy-efficient Particularly easy handling TTP 5 E Peltier dehumidifiers For keeping rooms that are difficult to ventilate, e.g. walk-in closets, windowless bathrooms or pantries, dry Modern thermoelectric Peltier element Simple dehumidification operation Air purification function filters animal hair, fluff and dust Removes excess moisture from the air, reduces condensation and prevents mould growth Ultra-silent operation thanks to Peltier element Energy-efficient Particularly easy handling 6 DEHUMIDIFICATION HOMECOMFORT SERIES TTP 10 E Peltier dehumidifiers For keeping rooms that are difficult to ventilate, e.g. walk-in closets, windowless bathrooms or pantries, dry Modern thermoelectric Peltier element Simple dehumidification operation Removable air filter Air purification function filters animal hair, fluff and dust Removes excess moisture from the air, reduces condensation and prevents mould growth Ultra-silent operation thanks to Peltier element Energy-efficient Particularly easy handling Constantly updated: www.trotec.com/catalogs Trotec Humidification DeEhntufemiudcifhitcuantigon SecoSan Air cleaning Mini-Dehumidifiers for small rooms that are difficult to ventilate Overview: Comfort dehumidifiers for small rooms that are difficult to ventilate Technical data Article number Dehumidification performance Suitable for rooms sized up to Operating range At 30 °C / 80 % RH Max. Temperature Humidity Input voltage Max. power input Water tank Sound pressure level Length Width H H Height Weight LW L W Equipment and functions 5WKVCDNGHQTFT[KPI|FT[MGGRKPIQHTQQOU Dehumidification principle Fan stages Filling level warning light indicating that the water tank is full Overflow protection with automatic switch-off Washable air filter Adjustable air discharge direction Manual Swing function Whisper mode Carry handles / swivel casters / parking brakes Connection for external condensation draining TTP 1 E 1.105.000.001 0.22 l/24h 0.22 l/24h 5 m² / 12.5 m³ 16 °C - 35 °C 45 % RH 100 - 240 V/ 50 - 60 Hz 0.02 kW 0.5 l 35 dB(A) 95 mm 150 mm 220 mm 1 kg TTP 1 E / Peltier technology 1 / / TTP 2 E 1.105.000.002 0.22 l/24h 0.22 l/24h 5 m² / 12.5 m³ 16 °C - 35 °C 45 % RH 100 - 240 V/ 50 - 60 Hz 0.02 kW 0.5 l 35 dB(A) 95 mm 150 mm 220 mm 1 kg TTP 2 E / Peltier technology 1 / / TTP 5 E 1.105.000.010 0.3 l/24h 0.3 l/24h 6 m² / 15 m³ 10 °C - 50 °C 100 - 240 V/ 50 - 60 Hz 0.02 kW 0.7 l 35 dB(A) 100 mm 160 mm 260 mm 1.5 kg TTP 5 E / Peltier technology 1 / / TTP 10 E 1.105.000.020 0.75 l/24h 0.75 l/24h 10 m² / 25 m³ 10 °C - 50 °C 220 - 240 V/ 50 - 60 Hz 0.04 kW 2 l 45 dB(A) 130 mm 220 mm 370 mm 2 kg TTP 10 E / Peltier technology 1 / / ULTRA-COMPACT DRYERS FOR USE IN SMALL ROOMS THAT ARE DIFFICULT TO VENTILATE &WTKPIQRGTCVKQPVJGWVVGTN[EQORCEV2GNVKGTFGJWOKFKGTUQHVJG662 A blower now sucks in the room air and guides it past the cold side of series are very silent, require very little power and for process-related the Peltier element. There the air cools down to below dew point, the reasons no defrost system. Owing to their minor space requirements moisture condenses and drips into a collection container. The dry air is CPFVJGTGNCVKXGN[UOCNNQRGTCVKPITCPIGVJGUGEQOHQTVFGJWOKFKGTU then guided past the hot element side, where it absorbs the heat and CTGKFGCNN[UWKVGFHQTVJGFT[MGGRKPIQHUOCNNJGCVGFTQQOUFKEWNVVQ QYUDCEMKPVQVJGTQQOCUYCTOFT[CKT ventilate, e.g. closets and shoe cabinets, pantries or small, windowless lavatories. 2GNVKGTFGJWOKFKGTU ;QW ECP WUG C 2GNVKGT FGJWOKFKGT QH VJG 662 UGTKGU YJGTGXGT [QW PF C PGCTD[ UQEMGV 5KORN[ RNWI KV KP UYKVEJ KV QP CPF UVCTV FT[KPI Functional principle Although the equipment features correspond to the variety of individ- DRY AIR ual requirements. All devices are provided with sophisticated comfort HWPEVKQPU UWEJ CU C NNKPI NGXGN YCTPKPI NKIJV CP QXGTQY RTQVGEVKQP PELTIER FAN YKVJCWVQOCVKEUYKVEJQCPFWNVTCUKNGPVQRGTCVKQP ELEMENT D AIR Here is how condenser dryers with Peltier technology work # EQNF UWTHCEG OWUV DG IGPGTCVGF YKVJKP VJKU V[RG QH FGJWOKFKGT CU well. The temperature of this surface must lie below the dew point of the air so that water can condense on it. This is achieved by the eponymous Peltier element: a compact, thermoelectric converter that sYJGPGNGEVTKEKV[QYUsECWUGUQPGGNGOGPVUKFGVQDGEQOGXGT[JQV and the other very cold. DAMP AIR ILLUSTRATION © TROTEC COLLECTION CONTAINER DEHUMIDIFIE Heating Air cooling Air conditioning Ventilation Cleaning Accessories An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 7 Trotec 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO Humidification DeEhntufemiudcifhitcuantigon SecoSan Air cleaning Overview: Desiccant dehumidifiers with a dehumidification capacity of up to 9 litres WHICH DEHUMIDIFIER FOR WHAT ROOM SIZE? Technical data TTR 50 E TTR 57 E Article number EU plug UK plug 1.120.000.060 1.120.000.065 Dehumidification performance At 30 °C / 80 % RH Max. 7 l/24h 7.5 l/24h 8.5 l/24h 9 l/24h Amount of air 126 m³/h 185 m³/h Suitable for rooms sized up to 18 m² / 45 m³ 20 m² / 50 m³ Operating range Temperature Humidity 0 °C - 35 °C 35 % - 75 % RH 1 °C - 32 °C 35 % - 90 % RH Input voltage 220 - 240 V/50 - 60 Hz 220 - 240 V/50 Hz Max. power input 0.65 kW 0.73 kW Water tank 2.5 l 5 l Sound pressure level 38 dB(A) 47 dB(A) Length 200 mm 232 mm Width H H 300 mm 340 mm Height LW L W 455 mm 511 mm Weight 6 kg 7.5 kg Equipment and functions TTR 50 E TTR 57 E Suitable for drying / dry keeping of rooms / / Air circulation / electronic Automatic defrosting Hot gas Hygrostat-controlled Automatic dehumidification Program-controlled Fan stages 3 3 Filling level warning light indicating that the water tank is full Overflow protection with automatic switch-off Washable air filter HEPA filter / activated carbon filter / / Selectable ioniser Adjustable air discharge Manual direction Swing function Timer function Laundry drying function Carry handles / swivel casters / parking brakes / / / / Connection for external condensation draining Selection tool for suitability 1) TTR 50 E TTR 57 E Relative room size 2) SML SML Dry keeping of heated living and office spaces 421421 Keeping unheated rooms such as garages, attics and basements dry 521521 Keeping bathrooms and laundry rooms dry 511511 Rooms up to 18 m² Suitable for rooms with a volume up to m³ m³ Room size suitability 400 uTpTRto501E8 m² 350 m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 Average room temperature °C Suitable for rooms with an area up to m² 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO Rooms up to 20 m² m³ 4QQOUK\GUWKVCDKNKV[ 400 350 uTpTRto572E0 m² m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% TTR 50 E TTR 57 E Keeping holiday homes dry 511 Protecting stock and optimising room climate in libraries, archives and museums Protecting classic cars, motor boats and sailing boats from corrosion 511 511 Increasing operating security in computer and server rooms 5 1 1 Regulating room humidity in conservatories and indoor swimming pools 311 Optimising room humidity in wine stores and wine cellars 531 Inhibition of bacterial growth in clinics or laboratories Accessories HEPA filter 311 TTR 50 E 511 511 511 511 311 531 311 TTR 57 E 7.710.000.051 Heating Air cooling Air conditioning Ventilation Cleaning Accessories * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. = Standard equipment - = Optional accessories, orderable separately - } = Non-stop dehumidification - 1) Suitability score from 5 = Perfectly suited to 1 = Not suited - 2) S = Small, M = Medium, L = Large An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 9 Trotec 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO Humidification DeEhntufemiudcifhitcuantigon SecoSan Air cleaning Overview: Desiccant dehumidifiers with a dehumidification capacity of up to 9 litres WHICH DEHUMIDIFIER FOR WHAT ROOM SIZE? Technical data TTR 50 E TTR 57 E Article number EU plug UK plug 1.120.000.060 1.120.000.065 Dehumidification performance At 30 °C / 80 % RH Max. 7 l/24h 7.5 l/24h 8.5 l/24h 9 l/24h Amount of air 126 m³/h 185 m³/h Suitable for rooms sized up to 18 m² / 45 m³ 20 m² / 50 m³ Operating range Temperature Humidity -10 °C - 35 °C 35 % - 75 % RH 1 °C - 32 °C 35 % - 90 % RH Input voltage 220 - 240 V/50 - 60 Hz 220 - 240 V/50 Hz Max. power input 0.65 kW 0.73 kW Water tank 2.5 l 5 l Sound pressure level 38 dB(A) 47 dB(A) Length 200 mm 232 mm Width H H 300 mm 340 mm Height LW L W 455 mm 511 mm Weight 6 kg 7.5 kg Equipment and functions TTR 50 E TTR 57 E Suitable for drying / dry keeping of rooms / / Air circulation / electronic Automatic defrosting Hot gas Hygrostat-controlled Automatic dehumidification Program-controlled Fan stages 3 3 Filling level warning light indicating that the water tank is full Overflow protection with automatic switch-off Washable air filter HEPA filter / activated carbon filter / / Selectable ioniser Adjustable air discharge Manual direction Swing function Timer function Laundry drying function Carry handles / swivel casters / parking brakes / / / / Connection for external condensation draining Selection tool for suitability 1) TTR 50 E TTR 57 E Relative room size 2) SML SML Dry keeping of heated living and office spaces 421421 Keeping unheated rooms such as garages, attics and basements dry 521521 Keeping bathrooms and laundry rooms dry 511511 Rooms up to 18 m² Suitable for rooms with a volume up to m³ m³ Room size suitability 400 uTpTRto501E8 m² 350 m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 Average room temperature °C Suitable for rooms with an area up to m² 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO Rooms up to 20 m² m³ 4QQOUK\GUWKVCDKNKV[ 400 350 uTpTRto572E0 m² m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% TTR 50 E TTR 57 E Keeping holiday homes dry 511 Protecting stock and optimising room climate in libraries, archives and museums Protecting classic cars, motor boats and sailing boats from corrosion 511 511 Increasing operating security in computer and server rooms 5 1 1 Regulating room humidity in conservatories and indoor swimming pools 311 Optimising room humidity in wine stores and wine cellars 531 Inhibition of bacterial growth in clinics or laboratories Accessories HEPA filter 311 TTR 50 E 511 511 511 511 311 531 311 TTR 57 E 7.710.000.051 Heating Air cooling Air conditioning Ventilation Cleaning Accessories * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. = Standard equipment - = Optional accessories, orderable separately - } = Non-stop dehumidification - 1) Suitability score from 5 = Perfectly suited to 1 = Not suited - 2) S = Small, M = Medium, L = Large An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 9 DEHUMIDIFICATION HEPA dehumidifiers and air cleaners with a dehumidification capacity of up to 30 litres EC RANT EC RANT DLY N ATUR DLY N ATUR FRIEN O R290 AL REFRIGE FRIEN O R290 AL REFRIGE TTK 27 HEPA Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value preselection between 30 and 80 % RH in steps of 5 % When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. 95% effective HEPA filtering of viruses, bacteria, pollen, dust mite residue, mould fungus spores and other allergens Indication of the relative humidity level Colour LED display showing the current humidity level Laundry-drying function Timer function Continuous mode Noiseless night operation in whisper mode 2 fan stages Automatic air circulation defrost system Connection for external condensate drain TTK 64 HEPA Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value preselection between 30 and 80 % RH in steps of 5 % When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. 95% effective HEPA filtering of viruses, bacteria, pollen, dust mite residue, mould fungus spores and other allergens Indication of the relative humidity level Colour LED display showing the current humidity level Laundry-drying function Timer function Continuous mode Noiseless night operation in whisper mode 2 fan stages Automatic air circulation defrost system Connection for external condensate drain EC RANT EC RANT DLY N ATUR DLY N ATUR FRIEN O R290 AL REFRIGE FRIEN O R290 AL REFRIGE TTK 70 HEPA (Plus) Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value preselection between 30 and 80 % RH in steps of 5 % When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. 95% effective HEPA filtering of viruses, bacteria, pollen, dust mite residue, mould fungus spores and other allergens Automatic mode Indication of the relative humidity level Colour LED display showing the current humidity level Laundry-drying function Timer function Child lock 2 fan stages Automatic air circulation defrost system Connection for external condensate drain 10 DEHUMIDIFICATION HOMECOMFORT SERIES TTK 99 HEPA Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value preselection between 30 and 80 % RH in steps of 5 % When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. 95% effective HEPA filtering of viruses, bacteria, pollen, dust mite residue, mould fungus spores and other allergens Indication of the relative humidity level Colour LED display showing the current humidity level Laundry-drying function Timer function Continuous mode Noiseless night operation in whisper mode Child lock 2 fan stages Automatic air circulation defrost system Connection for external condensate drain Constantly updated: www.trotec.com/catalogs Trotec 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO Humidification DeEhntufemiudcifhitcuantigon SecoSan Air cleaning Heating Overview: HEPA dehumidifiers with a dehumidification capacity of up to 30 litres WHICH DEHUMIDIFIER FOR WHAT ROOM SIZE? 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO Technical data TTK 27 HEPA Article number EU plug UK plug Dehumidification performance At 30 °C / 80 % RH Max. Amount of air Filter efficiency Pre-filter HEPA filter Suitable for rooms sized up to Operating range Temperature Humidity Input voltage Max. power input Type of refrigerant * Amount of refrigerant * GWP factor * CO2 equivalent * Water tank Sound pressure level Length Width H H Height LW L W Weight Equipment and functions 5WKVCDNGHQTFT[KPI|FT[MGGRKPIQHTQQOU Automatic defrosting Air circulation / electronic Hot gas Automatic dehumidification Hygrostat-controlled Program-controlled Fan stages Filling level warning light indicating that the water tank is full Overflow protection with automatic switch-off Washable air filter *'2#|HKNVGT|CEVKXCVGFECTDQPHKNVGT Selectable ioniser Adjustable air discharge direction Manual Swing function Timer function Laundry drying function Carry handles / swivel casters / parking brakes Connection for external condensation draining Selection tool for suitability 1) Relative room size 2) 1.120.000.029 10 l/24h 12 l/24h 90 m³/h 95% Synthetic fibre HEPA-Filter 15 m² / 37 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.24 kW R290 30 g 3 0.00009 t 2.5 l 45 dB(A) 245 mm 245 mm 500 mm 9.5 kg TTK 27 HEPA / 2 / / / TTK 27 HEPA SML Dry keeping of heated living and office spaces Keeping unheated rooms such as garages, attics and basements dry Keeping bathrooms and laundry rooms dry 411 111 211 TTK 64 HEPA 1.120.000.051 20 l/24h 24 l/24h 130 m³/h 95% Synthetic fibre HEPA-Filter 50 m² / 125 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.42 kW R290 60 g 3 0.00018 t 3.5 l 48 dB(A) 260 mm 260 mm 610 mm 13.5 kg TTK 64 HEPA / 2 / / / TTK 64 HEPA SML 511 311 511 TTK 70 HEPA (Plus) 1.120.000.069 18 l/24h 20 l/24h 140 m³/h 95% Synthetic fibre HEPA-Filter 45 m² / 110 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.42 kW R290 60 g 3 0.00018 t 6.5 l 48 dB(A) 225 mm 340 mm 565 mm 13 kg TTK 70 HEPA (Plus) / 2 / / / TTK 70 HEPA (Plus) SML 511 311 511 TTK 99 HEPA 1.120.000.103 30 l/24h 31 l/24h 170 m³/h 95% Synthetic fibre HEPA-Filter 90 m² / 230 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.72 kW R290 90 g 3 0.00027 t 4.0 l 51 dB(A) 250 mm 370 mm 585 mm 17 kg TTK 99 HEPA / 2 / / / TTK 99 HEPA SML 532 321 531 Keeping holiday homes dry 211421421431 Protecting stock and optimising room climate in libraries, archives and museums 211511511531 Protecting classic cars, motor boats and sailing boats from corrosion 2 1 1 5 2 1 5 2 1 5 3 1 Increasing operating security in computer and server rooms 2 1 1 4 1 1 4 1 1 5 3 2 Regulating room humidity in conservatories and indoor swimming pools 111311311421 Optimising room humidity in wine stores and wine cellars 111111111211 Rooms up to 15 m² 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO m³ 4QQOUK\GUWKVCDKNKV[ 400 TuTpKt2o41E5 m² 350 m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% TTK 27 HEPA Rooms up to 50 m² 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO m³ 4QQOUK\GUWKVCDKNKV[ 400 350 uTpTKto715E0 m² m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% TTK 64 HEPA TTK 70 HEPA (Plus) Rooms up to 90 m² 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO m³ 4QQOUK\GUWKVCDKNKV[ 400 350 uTpTKto909E0 m² m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% TTK 99 HEPA Inhibition of bacterial growth in clinics or laboratories 211411411421 Accessories TTK 27 HEPA TTK 64 HEPA TTK 70 HEPA (Plus) TTK 99 HEPA HEPA filter (95%) 7.710.000.005 7.710.000.023 7.710.000.077 7.710.000.025 * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. = Standard equipment - = Optional accessories, orderable separately - } = Non-stop dehumidification - 1) Suitability score from 5 = Perfectly suited to 1 = Not suited - 2) S = Small, M = Medium, L = Large Air cooling Air conditioning 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO Ventilation Cleaning Accessories An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 11 EC RANT EC RANT DLY N ATUR DLY N ATUR DEHUMIDIFICATION Comfort dehumidifiers with a dehumidification capacity of up to 12 litres TTK 26 E Condensation dehumidifier Simple dehumidification operation Automatic air circulation defrost system Connection for external condensate drain FRIEN O R290 AL REFRIGE FRIEN O R290 AL REFRIGE TTK 30 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE{3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. Automatic operation Display of the relative humidity level $PMPVS-&%{EJTQMBZTIPXJOHUIFDVSSFOU humidity level Laundry-drying function Timer function 2 fan stages Child lock Automatic air circulation defrost system Connection for external condensate drain EC RANT DLY N ATUR FRIEN O R290 AL REFRIGE 12 DEHUMIDIFICATION HOMECOMFORT SERIES TTK 32 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification with target value QSFTFMFDUJPOPG PS3) When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated. Particularly easy handling Automatic air circulation defrost system Connection for external condensate drain Constantly updated: www.trotec.com/catalogs Trotec Humidification DeEhntufemiudcifhitcuantigon Comfort dehumidifiers with a dehumidification capacity of up to 12 litres FRIEN O R290 AL REFRIGE WHICH DEHUMIDIFIER FOR WHAT ROOM SIZE? Rooms up to 15 m² m³ 4QQOUK\GUWKVCDKNKV[ 400 TuTpKto2415E m² 350 m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% TTK 26 E TTK 32 E EC RANT 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO DLY N ATUR TTK 33 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFOBOE3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated.. Automatic operation Colour LED display showing the current humidity level Laundry-drying function Timer function 2 fan stages Automatic air circulation defrost system Connection for external condensate drain An activated carbon filter to remove unpleasant odours is optionally available as an accessory TTK 30 E TTK 33 E SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation Cleaning Accessories An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 13 DEHUMIDIFICATION Comfort dehumidifiers with a dehumidification capacity of up to 12 litres Overview: Comfort dehumidifiers with a dehumidification capacity of up to 12 litres Technical data Article number EU plug UK plug Dehumidification performance At 30 °C / 80 % RH Max. Amount of air Suitable for rooms sized up to Operating range Temperature Humidity Input voltage Max. power input Type of refrigerant * Amount of refrigerant * GWP factor * CO2 equivalent * Water tank Sound pressure level Length Width H H Height LW L W Weight Equipment and functions 5WKVCDNGHQTFT[KPI|FT[MGGRKPIQHTQQOU Automatic defrosting Air circulation / electronic Hot gas Automatic dehumidification Hygrostat-controlled Program-controlled Fan stages Filling level warning light indicating that the water tank is full Overflow protection with automatic switch-off Washable air filter *'2#|HKNVGT|CEVKXCVGFECTDQPHKNVGT Selectable ioniser Adjustable air discharge direction Manual Swing function Timer function Laundry drying function Pumping function Carry handles / swivel casters / parking brakes Connection for external condensation draining Selection tool for suitability 1) Relative room size 2) Dry keeping of heated living and office spaces Keeping unheated rooms such as garages, attics and basements dry Keeping bathrooms and laundry rooms dry Keeping holiday homes dry Protecting stock and optimising room climate in libraries, archives and museums Protecting classic cars, motor boats and sailing boats from corrosion Increasing operating security in computer and server rooms Regulating room humidity in conservatories and indoor swimming pools Optimising room humidity in wine stores and wine cellars Inhibition of bacterial growth in clinics or laboratories Accessories Carbon filter TTK 26 E 1.120.000.026 1.120.010.026 8.56 l/24h 10 l/24h 80 m³/h 15 m² / 37 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.24 kW R290 40 g 3 0.00012 t 1.8 l 40 dB(A) 217 mm 296 mm 416 mm 9.5 kg TTK 26 E / 1 / / / TTK 26 E S M L 4 1 1 1 1 1 2 1 1 2 1 1 2 1 1 2 1 1 2 1 1 1 1 1 1 1 1 2 1 1 TTK 26 E TTK 30 E 1.120.000.034 1.120.010.034 10 l/24h 12 l/24h 120 m³/h 15 m² / 37 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.25 kW R290 35 g 3 0.0001 t 2.2 l 45 dB(A) 220 mm 280 mm 415 mm 8.5 kg TTK 30 E / 2 / / / TTK 30 E S M L 5 1 1 2 1 1 4 1 1 3 1 1 4 1 1 4 1 1 3 1 1 2 1 1 1 1 1 3 1 1 TTK 30 E TTK 32 E 1.120.000.035 12 l/24h 14 l/24h 118 m³/h 15 m² / 37 m³ 5 °C - 35 °C 35 % - 85 % RH 220 - 240 V/50 Hz 0.35 kW R290 50 g 3 0.00015 t 2.1 l 46 dB(A) 215 mm 320 mm 420 mm 11 kg TTK 32 E / 1 / / / TTK 32 E S M L 5 1 1 2 1 1 4 1 1 3 1 1 4 1 1 4 1 1 3 1 1 2 1 1 1 1 1 3 1 1 TTK 32 E TTK 33 E 1.120.000.037 12 l/24h 14 l/24h 80 m³/h 15 m² / 37 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.24 kW R290 52 g 3 0.00016 t 1.5 l 43 dB(A) 205 mm 270 mm 420 mm 10 kg TTK 33 E / 2 / / / TTK 33 E S M L 5 1 1 2 1 1 4 1 1 3 1 1 4 1 1 4 1 1 3 1 1 2 1 1 1 1 1 3 1 1 TTK 33 E 7.710.000.869 * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. = Standard equipment - = Optional accessories, orderable separately - } = Non-stop dehumidification - 1) Suitability score from 5 = Perfectly suited to 1 = Not suited - 2) S = Small, M = Medium, L = Large 14 DEHUMIDIFICATION HOMECOMFORT SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification DeEhntufemiudcifhitcuantigon THE RIGHT SOLUTION FOR EVERY NEED: BENEFIT FROM THE WORLD'S LARGEST SELECTION OF DEHUMIDIFIERS )QQF EJQKEG IQQF FGXKEGU s YKVJ C FGJWOKFKGT HTQO VJG 66-'5 compact class, you get more than you paid for in more ways than one: From adsorption dryers for small, unheated rooms to condensation dryers YKVJNKVGTUQHFGJWOKFKECVKQPECRCEKV[VJGYQTNF UNCTIGUVUGNGEVKQP QHFGJWOKFKGTUCNYC[UJCUVJGTKIJVOQFGNHQTGXGT[PGGFCPFVCUVG $GECWUG6TQVGEKUVJGWPFKURWVGFPWODGTHQTEQOHQTVFGJWOKFKGTU YKVJGXGT[FGJWOKFKGT[QWDGPGVHTQOVJGGZEGNNGPVRTKEGRGTHQTOCPEG ratio of the market leader with its own production, technical service and URGEKCNKUVYQTMUJQRU9JGVJGTHQTVJGJQOGQEGYCTGJQWUGICTCIG QTYQTMUJQRUOCNNQTNCTIGTQQOUCV6TQVGE[QWCTGIWCTCPVGGFVQPF VJGTKIJVFGJWOKFKGTUQNWVKQP SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation AN OPTIMUM HUMIDITY AND EVERYTHING IS FINE! An optimum indoor climate is not only a fundamental prerequisite for the well-being of residents excessive humidity levels can also cause damage to the furniture and the building structure. We feel most comfortable within the range of 20 to 22 °C at a relative humidity of 40 to 60 %, room climates outside these values tend to be perceived as unpleasant. * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. = Standard equipment - = Optional accessories, orderable separately - } = Non-stop dehumidification - 1) Suitability score from 5 = Perfectly suited to 1 = Not suited - 2) S = Small, M = Medium, L = Large An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 15 Cleaning Accessories EC RANT EC RANT DLY N ATUR DLY N ATUR DEHUMIDIFICATION Comfort dehumidifiers with a dehumidification capacity of up to 20 litres FRIEN O R290 AL REFRIGE O FRIEN R290 AL REFRIGE TTK 52 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification with target value preselection of 40, 50 or 60 % RH When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. Display of the relative humidity level Particularly easy handling Automatic air circulation defrost system Connection for external condensate drain TTK 53 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE{3)JO steps of 5 % When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated. Automatic operation Display of the relative humidity level $PMPVS-&%{EJTQMBZTIPXJOHUIFDVSSFOU humidity level Laundry-drying function Timer function 2 fan stages Automatic air circulation defrost system Connection for external condensate drain EC RANT EC RANT DLY N ATUR DLY N ATUR FRIEN O R290 AL REFRIGE FRIEN O R290 AL REFRIGE TTK 54 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE3)JO steps of 5 % When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. Continuous operation Comfort mode temperature-dependent automatic operation Display of the relative humidity level Laundry-drying function Timer function GBOTUBHFT Automatic air circulation defrost system Connection for external condensate drain 16 DEHUMIDIFICATION HOMECOMFORT SERIES TTK 60 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE{3)JO steps of 5 % When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. Continuous operation Laundry-drying function Timer function 2 fan stages Filter cleaning indicator Automatic air circulation defrost system Connection for external condensate drain Constantly updated: www.trotec.com/catalogs Comfort dehumidifiers with a dehumidification capacity of up to 20 litres Trotec Humidification DeEhntufemiudcifhitcuantigon SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation WHICH DEHUMIDIFIER FOR WHAT ROOM SIZE? 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO m³ 4QQOUK\GUWKVCDKNKV[ 400 uTpTKto5131Em² 350 m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% Rooms up to 31 m² TTK 52 E TTK 53 E TTK 54 E EFFECTIVE PROTECTION AGAINST MOISTURE AND CORROSION &QPQVYCKVWPVKNVJGTUVYCTPKPIUKIPUQHOQKUVWTGFCOCIGCRRGCT(QT example, did you know that mould can already form at 70 % humidity and corrosion at just 55 %? At too high humidity levels, expensive heating does not provide a remedy either: the air is indeed heated, but stays humid. Simple aeration is not the answer either, because the room air cannot be permanently stripped of humidity this way. 9KVJC6TQVGEEQOHQTVFGJWOKFKGT[QWECPGGEVKXGN[RTGXGPVOQKUVWTG FCOCIGUYJKNGCNUQUKIPKECPVN[KORTQXKPI[QWTRGTEGKXGFTQQOENKOCVG An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 17 Cleaning Accessories DEHUMIDIFICATION Comfort dehumidifiers with a dehumidification capacity of up to 20 litres Overview: Comfort dehumidifiers with a dehumidification capacity of up to 20 litres Technical data Article number EU plug UK plug Dehumidification performance At 30 °C / 80 % RH Max. Amount of air Suitable for rooms sized up to Operating range Temperature Humidity Input voltage Max. power input Type of refrigerant * Amount of refrigerant * GWP factor * CO2 equivalent * Water tank Sound pressure level Length Width H H Height LW L W Weight Equipment and functions 5WKVCDNGHQTFT[KPI|FT[MGGRKPIQHTQQOU Automatic defrosting Air circulation / electronic Hot gas Automatic dehumidification Hygrostat-controlled Program-controlled Fan stages Filling level warning light indicating that the water tank is full Overflow protection with automatic switch-off Washable air filter *'2#|HKNVGT|CEVKXCVGFECTDQPHKNVGT Selectable ioniser Adjustable air discharge direction Manual Swing function Timer function Laundry drying function Pumping function Carry handles / swivel casters / parking brakes Connection for external condensation draining Selection tool for suitability 1) Relative room size 2) Dry keeping of heated living and office spaces Keeping unheated rooms such as garages, attics and basements dry Keeping bathrooms and laundry rooms dry Keeping holiday homes dry Protecting stock and optimising room climate in libraries, archives and museums Protecting classic cars, motor boats and sailing boats from corrosion Increasing operating security in computer and server rooms Regulating room humidity in conservatories and indoor swimming pools Optimising room humidity in wine stores and wine cellars Inhibition of bacterial growth in clinics or laboratories TTK 52 E 1.120.000.042 1.120.010.042 14.7 l/24h 16 l/24h 110 m³/h 31 m² / 78 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.3 kW R290 85 g 3 0.00026 t 2.4 l 40 dB(A) 194 mm 304 mm 467 mm 10 kg TTK 52 E / 1 / / / TTK 52 E S M L 5 1 1 2 1 1 5 1 1 3 1 1 4 1 1 4 1 1 3 1 1 3 1 1 1 1 1 4 1 1 TTK 53 E 1.120.000.043 1.120.010.043 14 l/24h 16 l/24h 195 m³/h 31 m² / 78 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.24 kW R290 55 g 3 0.00017 t 5.5 l 48 dB(A) 185 mm 330 mm 550 mm 12 kg TTK 53 E / 2 / / / TTK 53 E S M L 5 1 1 3 1 1 5 1 1 4 1 1 5 1 1 5 1 1 4 1 1 3 1 1 1 1 1 4 1 1 TTK 54 E 1.120.000.044 1.120.010.044 16 l/24h 18 l/24h 150 m³/h 40 m² / 100 m³ 5 °C - 32 °C 35 % - 85 % RH 220 - 240 V/50 Hz 0.43 kW R290 75 g 3 0.00023 t 3 l 46 dB(A) 245 mm 350 mm 510 mm 15 kg TTK 54 E / 3 / / / TTK 54 E S M L 5 1 1 3 1 1 5 1 1 4 1 1 5 1 1 5 1 1 4 1 1 3 1 1 1 1 1 4 1 1 TTK 60 E 1.120.000.049 1.120.010.049 16 l/24h 18 l/24h 100 m³/h 40 m² / 100 m³ 5 °C - 35 °C 35 % - 95 % RH 220 - 240 V/50 Hz 0.47 kW R290 80 g 3 0.00024 t 3,5 l 43 dB(A) 225 mm 353 mm 496 mm 12 kg TTK 60 E / 2 / / / TTK 60 E S M L 5 1 1 2 1 1 5 1 1 3 1 1 4 1 1 4 1 1 3 1 1 3 1 1 1 1 1 3 1 1 * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. = Standard equipment - = Optional accessories, orderable separately - } = Non-stop dehumidification - 1) Suitability score from 5 = Perfectly suited to 1 = Not suited - 2) S = Small, M = Medium, L = Large 18 DEHUMIDIFICATION HOMECOMFORT SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification DeEhntufemiudcifhitcuantigon SecoSan Air cleaning OVERVIEW ABOUT FEATURES AND FUNCTIONS OF DEHUMIDIFIER #WVQOCVKE&GJWOKFKECVKQP (hygrostat- and programmatically) 1PCFGJWOKFKGTVJGZGFJWOKFKV[XCNWG HQT example, 50 % RH) is stored as the chosen target. If the indoor humidity exceeds these values, the CWVQOCVKEJ[ITQUVCVFGJWOKFKECVKQPCEVKXCVGU the device. If the target value is reached, the FGXKEGUYKVEJGUQCWVQOCVKECNN[CPFKPVQGPergy saving again. Permanent mode 9JGPVJGFGJWOKFKGTKUKPRGTOCPGPVOQFGKV is dehumidifying the air continuously and independently of the moisture content. In this mode, PQZGFJWOKFKV[XCNWGECPDGUGVCUCVCTIGV Comfort function The comfort function makes it possible to regulate with one touch, the air humidity depends on the temperature automatically to a more comfortable value. Devices with this feature, such as the TTK 54 E or the TTK 127 E are ideal for lovers of upscale convenience, because very few usually know what the optimum relative humidity should be at a certain temperature. Laundry drying function 6JCPMU VQ VJKU HWPEVKQP VJG FGJWOKFKGT ECP be used as an air-dryer. The device dehumidiGUVJGCKTEQPVKPWQWUN[CPFKUYQTMKPICVVJG maximum ventilation level. Alternatively, solid humidity values can be selected depending on the desired drying stage of the wash. Swing function The Swing function feature supports the optimal, FTCHVHTGGTGFKUVTKDWVKQPQHVJGFGJWOKFKGFCKT through the automatic swing - the well said QUEKNNCVKQPVJGCKTIWKFKPICRYKVJKP semi preset position limits. Timer function With the integrated timer function, the desired CWVQOCVKEQPCPFQVKOGUECPDGHTQOVQQT JQWTUGZKDN[CFLWUVGFKPJQWTKPETGOGPVU PQTOCNN[KPOQUVFGJWOKFKGTU Child safety lock The child safety lock prevents the settings of VJGFGJWOKFKGTQPVJGFKURNC[VQDGEJCPIGF inadvertently. 1XGTQYRTQVGEVKQPYKVJCWVQUJWVFQYP This practical and necessary function autoOCVKECNN[UJWVUQVJGFGXKEGYJGPVJGYCVGT reservoir is full. It is usually signaled by a level warning light that the tank should be emptied. Memory function In brief if there is a power failure, the dehuOKFKGTTGOGODGTUDQVJVJGRTGUGVXGPVKNCVKQP stage as well as the operating mode. Not saved, however, are the pre-programmed start and stop times for automatic operation. Connection for external condensate drain In continuous operation, a drain hose can be connected in order to continuously remove the condensate. Thus, an emptying of the full water tank is no longer necessary and the device can be operated without supervision. 2QYGTHWNFGJWOKFKECVKQPVJCPMUVQ integrated condensate pump Thanks to the high-quality condensate pump built into the unit and the convenient setting of the pump-down function at the touch of a DWVVQPVJGEQPFGPUCVGYCVGTECPDGFTCKPGFQ automatically. With this powerful pump capacity, COCZKOWOJGKIJVFKGTGPEGQHWRVQOGVTGU HQTGZCORNGVQVJGPGZVQQTECPDGQXGTEQOG without any problems. In addition, it is possible to dehumidify rooms with high humidity in continuous operation without having to constantly empty the water tank. This is particularly advantageous where a large amount of water has to be removed from the room air, for example after water damage. It generally applies: 46 - 49 % RH for `Cupboard dry' 58 % RH for `Iron dry' 65 % RH for `Dried' Inner drying function +HVJGFGJWOKFKGTJCUDGGPFKUWUGFHQTNQPI periods, the inner drying function should be used to remove excess water and steam from the machine and prevent mould. Heating Air cooling Air conditioning Ventilation Cleaning Accessories An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 19 EC RANT EC RANT DLY N ATUR DLY N ATUR DEHUMIDIFICATION Comfort dehumidifiers with a dehumidification capacity of up to 30 litres FRIEN O R290 AL REFRIGE FRIEN O R290 AL REFRIGE TTK 66 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. Continuous operation Comfort mode temperature-dependent automatic operation Display of the relative humidity level Laundry-drying function Timer function GBOTUBHFT Automatic air circulation defrost system Connection for external condensate drain TTK 67 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFOBOE3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated.. Automatic operation Continuous operation Indication of the relative humidity level Laundry-drying function Timer function GBOTUBHFT Swing function for even air distribution Automatic air circulation defrost system Connection for external condensate drain EC RANT EC RANT DLY N ATUR DLY N ATUR FRIEN O R290 AL REFRIGE FRIEN O R290 AL REFRIGE TTK 68 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE{3)JO TUFQTPG{ When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated. Automatic operation Display of the relative humidity level Laundry-drying function Timer function GBOTUBHFT Adjustable air discharge direction Child lock, filter cleaning indicator Automatic air circulation defrost system Connection for external condensate drain 20 DEHUMIDIFICATION HOMECOMFORT SERIES TTK 71 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE{3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated. Automatic operation Display of the relative humidity level Laundry-drying function Timer function 2 fan stages Adjustable air discharge direction Automatic air circulation defrost system Connection for external condensate drain Constantly updated: www.trotec.com/catalogs Trotec RANT Humidification DeEhntufemiudcifhitcuantigon DLY N ATUR DLY N ATUR Comfort dehumidifiers with a dehumidification capacity of up to 30 litres EC RANT FRIEN O R290 AL REFRIGE EC FRIEN O R290 AL REFRIGE TTK 72 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE{3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated. Automatic operation Display of the relative humidity level $PMPVS-&%{EJTQMBZTIPXJOHUIFDVSSFOU humidity level Laundry-drying function Timer function 2 fan stages Automatic air circulation defrost system Connection for external condensate drain TTK 73 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFOBOE3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated.. Automatic operation Continuous operation Indication of the relative humidity level Laundry-drying function Timer function Night mode GBOTUBHFT Automatic air circulation defrost system Connection for external condensate drain SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation EC RANT DLY N ATUR FRIEN O R290 AL REFRIGE TTK 75 E Condensation dehumidifier Automatic hygrostat-controlled dehumidification plus continuous operation When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. Particularly easy handling Automatic air circulation defrost system Connection for external condensate drain An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 21 Cleaning Accessories DEHUMIDIFICATION Comfort dehumidifiers with a dehumidification capacity of up to 30 litres Overview: Comfort dehumidifiers with a dehumidification capacity of up to 30 litres Technical data Article number EU plug UK plug Dehumidification performance At 30 °C / 80 % RH Max. Amount of air Suitable for rooms sized up to Operating range Temperature Humidity Input voltage Max. power input Type of refrigerant * Amount of refrigerant * GWP factor * CO2 equivalent * Water tank Sound pressure level Length Width H H Height LW L W Weight Equipment and functions 5WKVCDNGHQTFT[KPI|FT[MGGRKPIQHTQQOU Automatic defrosting Air circulation / electronic Hot gas Automatic dehumidification Hygrostat-controlled Program-controlled Fan stages Filling level warning light indicating that the water tank is full Overflow protection with automatic switch-off Washable air filter *'2#|HKNVGT|CEVKXCVGFECTDQPHKNVGT Selectable ioniser Adjustable air discharge direction Manual Swing function Timer function Laundry drying function Pumping function Carry handles / swivel casters / parking brakes Connection for external condensation draining Selection tool for suitability 1) Relative room size 2) Dry keeping of heated living and office spaces Keeping unheated rooms such as garages, attics and basements dry Keeping bathrooms and laundry rooms dry Keeping holiday homes dry Protecting stock and optimising room climate in libraries, archives and museums Protecting classic cars, motor boats and sailing boats from corrosion Increasing operating security in computer and server rooms Regulating room humidity in conservatories and indoor swimming pools Optimising room humidity in wine stores and wine cellars Inhibition of bacterial growth in clinics or laboratories TTK 66 E 1.120.000.054 1.120.010.054 20 l/24h 24 l/24h 168 m³/h 50 m² / 125 m³ 5 °C - 32 °C 30 % - 90 % RH 220 - 240 V/50 Hz 0.44 kW R290 75 g 3 0.00022 t 3 l 46 dB(A) 245 mm 350 mm 510 mm 15 kg TTK 66 E / 3 / / / TTK 66 E SML 5 1 1 3 1 1 5 1 1 4 2 1 5 1 1 5 2 1 4 1 1 3 1 1 1 1 1 4 1 1 TTK 67 E 1.120.000.055 20 l/24h 24 l/24h 130 m³/h 50 m² / 125 m³ 5 °C - 32 °C 30 % - 90 % r.F. 220 - 240 V/50 Hz 0.45 kW R290 110 g 3 0.00033 t 3.5 l 43 dB(A) 210 mm 325 mm 580 mm 15.5 kg TTK 67 E / 3 / / / TTK 67 E SML 5 1 1 3 1 1 5 1 1 4 2 1 5 1 1 5 2 1 4 1 1 3 1 1 1 1 1 4 1 1 TTK 68 E 1.120.000.056 1.120.010.056 18.7 l/24h 20 l/24h 130 m³/h 45 m² / 110 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.45 kW R290 110 g 3 0.0003 t 4 l 43 dB(A) 246 mm 367 mm 582 mm 15 kg TTK 68 E / 3 / / / TTK 68 E SML 5 1 1 3 1 1 5 1 1 4 2 1 5 1 1 5 2 1 4 1 1 3 1 1 1 1 1 4 1 1 TTK 71 E 1.120.000.071 1.120.010.071 20 l/24h 24 l/24h 180 m³/h 50 m² / 125 m³ 5 °C - 32 °C 30 % - 90 % RH 220 - 240 V/50 Hz 0.42 kW R290 55 g 3 0.00016 t 2.3 l 48 dB(A) 220 mm 350 mm 550 mm 13 kg TTK 71 E / 2 / / / TTK 71 E SML 5 1 1 3 1 1 5 1 1 4 2 1 5 1 1 5 2 1 4 1 1 3 1 1 1 1 1 4 1 1 TTK 72 E 1.120.000.073 1.120.010.073 20 l/24h 24 l/24h 195 m³/h 50 m² / 125 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.32 kW R290 60 g 3 0.00018 t 5.5 l 48 dB(A) 198 mm 330 mm 570 mm 13 kg TTK 72 E / 2 / / / TTK 72 E SML 5 1 1 3 1 1 5 1 1 4 2 1 5 1 1 5 2 1 4 1 1 3 1 1 1 1 1 4 1 1 * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. = Standard equipment - = Optional accessories, orderable separately - } = Non-stop dehumidification - 1)4VJUBCJMJUZTDPSFGSPN1FSGFDUMZTVJUFEUP/PUTVJUFE2) S = Small, M = Medium, L = Large 22 DEHUMIDIFICATION HOMECOMFORT SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification DeEhntufemiudcifhitcuantigon SecoSan Air cleaning Comfort dehumidifiers with a dehumidification capacity of up to 30 litres Overview: Comfort dehumidifiers with a dehumidification capacity of up to 30 litres Technical data TTK 73 E Article number EU plug UK plug Dehumidification performance At 30 °C / 80 % RH Max. Amount of air Suitable for rooms sized up to Operating range Temperature Humidity Input voltage Max. power input Type of refrigerant * Amount of refrigerant * GWP factor * CO2 equivalent * Water tank Sound pressure level Length Width H H Height LW L W Weight Equipment and functions 5WKVCDNGHQTFT[KPI|FT[MGGRKPIQHTQQOU Automatic defrosting Air circulation / electronic Hot gas Automatic dehumidification Hygrostat-controlled Program-controlled Fan stages Filling level warning light indicating that the water tank is full Overflow protection with automatic switch-off Washable air filter *'2#|HKNVGT|CEVKXCVGFECTDQPHKNVGT Selectable ioniser Adjustable air discharge direction Manual Swing function Timer function Laundry drying function Pumping function Carry handles / swivel casters / parking brakes Connection for external condensation draining Selection tool for suitability 1) Relative room size 2) 1.120.000.074 20 l/24h 24 l/24h 130 m³/h 50 m² / 125 m³ 5 °C - 32 °C 30 % - 90 % r.F. 220 - 240 V/50 Hz 0.45 kW R290 110 g 3 0.00033 t 3.5 l 43 dB(A) 220 mm 365 mm 590 mm 15.5 kg TTK 73 E / 3 / / / TTK 73 E SML Dry keeping of heated living and office spaces 511 Keeping unheated rooms such as garages, attics and basements dry 311 Keeping bathrooms and laundry rooms dry 511 TTK 75 E 1.120.001.003 1.120.011.003 18 l/24h 20 l/24h 150 m³/h 45 m² / 110 m³ 5 °C - 32 °C 30 % - 90 % r.F. 220 - 240 V/50 Hz 0.42 kW R290 86 g 3 0.00026 t 3 l 43 dB(A) 253 mm 340 mm 570 mm 12.5 kg TTK 75 E / 2 / / / TTK 75 E SML 511 311 511 WHICH DEHUMIDIFIER FOR WHAT ROOM SIZE? 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO m³ 4QQOUK\GUWKVCDKNKV[ 400 uTpTtKo6485Em² 350 m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% Rooms up to 45 m² TTK 60 E TTK 68 E TTK 75 E 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO m³ 4QQOUK\GUWKVCDKNKV[ 400 uTpTtKo7510Em² 350 m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% Rooms up to 50 m² TTK 66 E Keeping holiday homes dry 421421 Protecting stock and optimising room climate in libraries, archives and museums 511511 Protecting classic cars, motor boats and sailing boats from corrosion 5 2 1 5 2 1 Increasing operating security in computer and server rooms 4 1 1 4 1 1 Regulating room humidity in conservatories and indoor swimming pools 311311 Optimising room humidity in wine stores and wine cellars 111111 Inhibition of bacterial growth in clinics or laboratories 411411 TTK 67 E TTK 73 E TTK 71 E TTK 72 E Heating Air cooling Air conditioning Ventilation Cleaning Accessories * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. = Standard equipment - = Optional accessories, orderable separately - } = Non-stop dehumidification - 1)4VJUBCJMJUZTDPSFGSPN1FSGFDUMZTVJUFEUP/PUTVJUFE2) S = Small, M = Medium, L = Large An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 23 DEHUMIDIFICATION Comfort dehumidifiers with a dehumidification capacity of 30 litres and more EC RANT EC RANT DLY N ATUR DLY N ATUR FRIEN O R290 AL REFRIGE FRIEN O R290 AL REFRIGE TTK 90 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. Display of the relative humidity level Laundry-drying function Timer function 2 fan stages Automatic air circulation defrost system Connection for external condensate drain TTK 95 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated. Display of the relative humidity level Laundry-drying function Timer function 2 fan stages Swing function for even air distribution Automatic air circulation defrost system Connection for external condensate drain EC RANT EC RANT DLY N ATUR DLY N ATUR FRIEN O R290 AL REFRIGE FRIEN O R290 AL REFRIGE TTK 96 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated. Comfort mode temperature-dependent automatic operation Particularly easy handling Display of the relative humidity level Laundry-drying function Timer function 2 fan stages Automatic air circulation defrost system Connection for external condensate drain 24 DEHUMIDIFICATION HOMECOMFORT SERIES TTK 100 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE{3)JO TUFQTPG{ When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. Hot gas automatic defrosting for unheated rooms Display of the relative humidity level Laundry-drying function Timer function 2 fan stages Automatic air circulation defrost system Connection for external condensate drain Constantly updated: www.trotec.com/catalogs Trotec RANT Humidification DeEhntufemiudcifhitcuantigon DLY N ATUR DLY N ATUR Comfort dehumidifiers with a dehumidification capacity of 30 litres and more EC RANT FRIEN O R290 AL REFRIGE EC FRIEN O R290 AL REFRIGE TTK 120 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated. Display of the relative humidity level Laundry-drying function Hot gas automatic defrosting for unheated rooms Connection for external condensate drain TTK 120 S Condensation dehumidifier Solid metal plastic composite housing Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE{3)JO TUFQTPG{ When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. When the value is exceeded, the device is automatically activated. Hot gas automatic defrosting POBNJOVUFDZDMFr for unheated rooms Connection for external condensate drain SecoSan Air cleaning Heating RANT Air cooling Air conditioning DLY N ATUR DLY N ATUR Ventilation EC RANT FRIEN O R290 AL REFRIGE EC FRIEN O R290 AL REFRIGE TTK 122 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated. Display of the relative humidity level Laundry-drying function Hot gas automatic defrosting for unheated rooms Connection for external condensate drain An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info TTK 127 E Condensation dehumidifier Hygrostat-controlled automatic dehumidification system with target value QSFTFMFDUJPOCFUXFFO{BOE3)JO TUFQTPG When the desired humidity level is reached, the compressor switches off automatically. The fan keeps running. The display does not switch off. When the value is exceeded, the device is automatically activated. Comfort mode temperature-dependent automatic operation Particularly easy handling Display of the relative humidity level Laundry-drying function Timer function 2 fan stages Automatic air circulation defrost system Pumping function Connection for external condensation drain with an integrated condensate pump (up to 4 m height difference possible) DEHUMIDIFICATION HOMECOMFORT SERIES 25 Cleaning Accessories Room size suitability WHICH DEHUMIDIFIER FOR WHAT ROOM SIZE? 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO m³ 4QQOUK\GUWKVCDKNKV[ 400 uTpTtKo 90 mE ² 350 m² 160 140 300 120 250 100 200 80 150 60 100 40 50 20 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% Rooms up to 90 m² TTK 90 E TTK 95 E TTK 96 E 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO m³ 4QQOUK\GUWKVCDKNKV[ 400 uTpTtKo 19250mE² 350 m² 160 140 300 120 250 100 200 Keeping 80 rooms dry 150 60 100 40 Clearing water 50 damage or 20 construction drying 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% Rooms up to 95 m² TTK 100 E TTK 120 E TTK 120 S 5WKVCDNGHQTTQQOU YKVJCXQNWOGWRVQO 5WKVCDNGHQTTQQOU YKVJCPCTGCWRVQO m³ 4QQOUK\GUWKVCDKNKV[ 400 uTpTtKo 15207 mE ² 350 m² 160 140 300 Keeping 120 rooms dry 250 100 200 80 150 60 100 40 Clearing water 50 damage or 20 construction drying 0 0 0 5 10 15 20 25 30 35 #XGTCIGTQQOVGORGTCVWTG% Rooms up to 150 m² TTK 122 E TTK 127 E OPTIONAL ACCESSORIES FOR COMFORT DEHUMIDIFIERS BH30 Socket hygrostat n %QPUVCPVJWOKFKV[TGIWNCVKQPQHJWOKFKGTUCPFFGJWOKFKGTUVQCUGV value n Regulation of the humidity level between 20 % and 90 % RH n $WGTDCVVGT[HQTUVQTCIGQHUGNGEVGFUGVVKPIU Article number 6.100.004.205 26 DEHUMIDIFICATION HOMECOMFORT SERIES BZ06 Designer weather station n Simultaneous indication of room temperature, humidity level, date, time, weekday and symbolic weather forecast n Supplies helpful information for preventing mould growth n Display of minimum and maximum values n Alarm function with snooze button Article number 3.510.205.016 Constantly updated: www.trotec.com/catalogs Trotec Humidification DeEhntufemiudcifhitcuantigon SecoSan Air cleaning DEHUMIDIFICATION DEHUMIDIFIERS OF TROTEC'S HOMECOMFORT SERIES A strong brand for more well-being at home Trotec has been developing, manufacturing and selling market-leading FGJWOKFKGTUVQETGCVGCJGCNVJ[KPFQQTENKOCVGHQTOQTGVJCP|[GCTU Our development engineers, technicians and product consultants have TUVENCUUMPQYJQYCPFMPQYCDQWVVJGRCTVKEWNCTN[UGPUKVKXGTGSWKTGments for optimally conditioned air. +PPQXCVKXGFGJWOKFKGTUHTQO6TQVGEKPJQWUGRTQFWEVKQP 6TQVGEKUEQPVKPWQWUN[GZRCPFKPIKVUTCPIGQHFGJWOKFKGTUYKVJPGY product innovations from their own development in order to be able to recommend the right device for your demands. As an international OCTMGVNGCFGTQWTENCKOKUPQVQPN[VQUGNNFGJWOKFKGTUDWVCNUQVQQGT in-depth consultation and comprehensive customer service. Competent consultation before purchase #FGJWOKFKGTECPQPN[ETGCVGCJGCNVJ[TQQOENKOCVGKHVJGFGXKEGKU perfectly matched to your individual environment. There are various factors to be taken into account, which a layman cannot assess, but which our engineers and product consultants deal with on a daily basis. This concentrated knowledge contributes to the continuous development QHQWTFGJWOKFKECVKQPFGXKEGUCPFKUCNUQKPEQTRQTCVGFKPQWTGZVGPUKXG online product presentation. In-house repair service Should there ever be a problem with one of our devices, we will help you as quickly as possible to keep the downtime of your device to a minimum. As a brand provider, Trotec has its own repair service with JKIJN[SWCNKGFVGEJPKEKCPUCPFCUGTXKEGXGJKENGGGV6JGRGTHGEVN[ organised shipping service also enables us to keep processing times as short as possible in the event of a repair. The Trotec brand service is always there for you, even after the purchase. Immediate availability, fast delivery Our large warehouses across Europe guarantee the constant availability QHQXGT|FGJWOKFKGTUUQVJCVYGCNYC[UJCXGVJGTKIJVFGJWOKFKGTHQTGXGT[PGGFCPFVCUVGKPUVQEM#VVJGDGUVXCNWGHQTOQPG[TCVKQ and delivered directly to your home in next to no time. Express delivery is also possible on request. Comprehensive spare parts service Trotec products are durable and low-maintenance. This is what distinguishes our devices. Therefore, you will be able to obtain all necessary spare parts through our spare parts service even many years after RWTEJCUKPI[QWTFGJWOKFKGT|URCTGRCTVUCTGEQPUVCPVN[KPUVQEM so you can count on fast spare parts delivery today and in the future. At favourable manufacturer prices, of course. Heating Air cooling Air conditioning Ventilation Cleaning Accessories An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 27 Comfort dehumidifiers with a dehumidification capacity of 30 litres and more Overview: Comfort dehumidifiers with a dehumidification capacity of 30 litres and more Technical data Article number EU plug UK plug Dehumidification performance At 30 °C / 80 % RH Max. Amount of air Suitable for rooms sized up to Operating range Temperature Humidity Input voltage Max. power input Type of refrigerant * Amount of refrigerant * GWP factor * CO2 equivalent * Water tank Sound pressure level Length Width H H Height LW L W Weight Equipment and functions 5WKVCDNGHQTFT[KPI|FT[MGGRKPIQHTQQOU Automatic defrosting Air circulation / electronic Hot gas Automatic dehumidification Hygrostat-controlled Program-controlled Fan stages Filling level warning light indicating that the water tank is full Overflow protection with automatic switch-off Washable air filter *'2#|HKNVGT|CEVKXCVGFECTDQPHKNVGT Selectable ioniser Adjustable air discharge direction Manual Swing function Timer function Laundry drying function Pumping function Carry handles / swivel casters / parking brakes Connection for external condensation draining Selection tool for suitability 1) Relative room size 2) Dry keeping of heated living and office spaces Keeping unheated rooms such as garages, attics and basements dry Keeping bathrooms and laundry rooms dry Keeping holiday homes dry Protecting stock and optimising room climate in libraries, archives and museums Protecting classic cars, motor boats and sailing boats from corrosion Increasing operating security in computer and server rooms Regulating room humidity in conservatories and indoor swimming pools Optimising room humidity in wine stores and wine cellars Inhibition of bacterial growth in clinics or laboratories TTK 90 E 1.120.000.105 1.120.010.105 28.4 l/24h 30 l/24h 173 m³/h 90 m² / 230 m³ 5 °C - 32 °C 30 % - 90 % RH 220 - 240 V/50 Hz 0.5 kW R290 125 g 3 0.00038 t 5.2 l 50 dB(A) 253 mm 340 mm 540 mm 14 kg TTK 90 E / 2 / / / TTK 90 E S M L 5 3 2 3 1 1 5 3 1 4 3 1 5 3 1 5 3 1 5 3 2 4 2 1 2 1 1 4 2 1 TTK 95 E 1.120.000.106 1.120.010.106 28 l/24h 30 l/24h 185 m³/h 90 m² / 230 m³ 5 °C - 32 °C 30 % - 90 % RH 220 - 240 V/50 Hz 0.5 kW R290 129 g 3 0.00039 t 5.3 l 43 dB(A) 355 mm 235 mm 560 mm 15.5 kg TTK 95 E / 2 / / / TTK 95 E S M L 5 3 2 3 1 1 5 3 1 4 3 1 5 3 1 5 3 1 4 3 2 4 2 1 2 1 1 4 2 1 TTK 96 E 1.120.000.101 1.120.010.101 28.3 l/24h 30 l/24h 191 m³/h 90 m² / 230 m³ 5 °C - 32 °C 35 % - 100 % RH 220 - 240 V/50 Hz 0.72 kW R290 100 g 3 0.0003 t 3 l 50 dB(A) 260 mm 386 mm 500 mm 17 kg TTK 96 E / 2 / / / TTK 96 E S M L 5 3 2 3 2 1 5 3 1 4 3 1 5 3 1 5 3 1 5 3 2 4 2 1 2 1 1 4 2 1 TTK 100 E 1.120.001.005 1.120.011.005 25 l/24h 30 l/24h 215 m³/h 90 m² / 230 m³ 5 °C - 32 °C 30 % - 80 % RH 220 - 240 V/50 Hz 0.57 kW R290 122 g 3 0.00037 t 4.3 l 50 dB(A) 274 mm 390 mm 612 mm 15.5 kg TTK 100 E / 2 / / / TTK 100 E S M L 5 3 2 3 1 1 5 3 1 4 3 1 5 3 1 5 3 1 4 3 2 4 2 1 2 1 1 4 2 1 * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. = Standard equipment - = Optional accessories, orderable separately - } = Non-stop dehumidification - 1)4VJUBCJMJUZTDPSFGSPN1FSGFDUMZTVJUFEUP/PUTVJUFE2) S = Small, M = Medium, L = Large 28 DEHUMIDIFICATION HOMECOMFORT SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification DeEhntufemiudcifhitcuantigon SecoSan Air cleaning Comfort dehumidifiers with a dehumidification capacity of 30 litres and more Overview: Comfort dehumidifiers with a dehumidification capacity of 30 litres and more Technical data Article number EU plug UK plug Dehumidification performance At 30 °C / 80 % RH Max. Amount of air Suitable for rooms sized up to Operating range Temperature Humidity Input voltage Max. power input Type of refrigerant * Amount of cooling agent * GWP factor * CO2 equivalent * Water tank Sound pressure level Length Width H H Height LW L W Weight Equipment and functions 5WKVCDNGHQTFT[KPI|FT[MGGRKPIQHTQQOU Automatic defrosting Air circulation / electronic Hot gas Automatic dehumidification Hygrostat-controlled Program-controlled Fan stages Filling level warning light indicating that the water tank is full Overflow protection with automatic switch-off Washable air filter *'2#|HKNVGT|CEVKXCVGFECTDQPHKNVGT Selectable ioniser Adjustable air discharge direction Manual Swing function Timer function Laundry drying function Pumping function Carry handles / swivel casters / parking brakes Connection for external condensation draining Selection tool for suitability 1) Relative room size 2) Dry keeping of heated living and office spaces Keeping unheated rooms such as garages, attics and basements dry Keeping bathrooms and laundry rooms dry Keeping holiday homes dry Protecting stock and optimising room climate in libraries, archives and museums Protecting classic cars, motor boats and sailing boats from corrosion Increasing operating security in computer and server rooms Regulating room humidity in conservatories and indoor swimming pools Optimising room humidity in wine stores and wine cellars Inhibition of bacterial growth in clinics or laboratories TTK 120 E 1.120.000.119 1.120.010.119 28 l/24h 30 l/24h 240 m³/h 95 m² / 238 m³ 5 °C - 35 °C 30 % - 90 % RH 220 - 240 V/50 Hz 0.62 kW R290 83 g 3 0.00025 t 8 l 52 dB(A) 310 mm 453 mm 635 mm 25 kg TTK 120 E / 2 / / / TTK 120 E S M L 5 4 2 3 2 1 5 4 2 4 3 1 5 4 2 5 3 1 5 4 2 5 4 2 2 1 1 5 4 2 TTK 120 S 1.120.000.122 1.120.010.122 27 l/24h 35 l/24h 510 m³/h 95 m² / 238 m³ 3 °C - 40 °C 40 % - 100 % RH 220 - 240 V/50 Hz 0.6 kW R290 150 g 3 0.00045 t 9 l 59 dB(A) 362 mm 380 mm 605 mm 22.5 kg TTK 120 S / 1 / / / TTK 120 S S M L 5 4 2 5 3 2 5 4 2 5 4 2 5 4 2 5 4 2 5 4 2 5 4 2 5 3 2 5 4 2 TTK 122 E 1.120.000.123 1.120.010.123 38 l/24h 40 l/24h 240 m³/h 120 m² / 300 m³ 5 °C - 35 °C 30 % - 90 % RH 220 - 240 V/50 Hz 0.75 kW R290 96 g 3 0.00029 t 8 l 52 dB(A) 310 mm 453 mm 635 mm 27.5 kg TTK 122 E / 2 / / / TTK 122 E S M L 5 5 3 5 4 3 5 5 3 5 5 4 5 5 3 5 5 3 5 5 3 5 5 3 5 4 3 5 5 3 TTK 127 E 1.120.000.126 1.120.010.126 46.8 l/24h 50 l/24h 353 m³/h 150 m² / 375 m³ 5 °C - 32 °C 35 % - 100 % RH 220 - 240 V/50 Hz 1.06 kW R290 145 g 3 0.00044 t 6 l 50 dB(A) 282 mm 392 mm 616 mm 19.5 kg TTK 127 E / 2 / / / TTK 127 E S M L 5 5 4 5 5 4 5 5 4 5 4 4 5 5 4 5 5 4 5 5 4 5 5 4 5 4 4 5 5 4 Heating Air cooling Air conditioning Ventilation Cleaning Accessories * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. = Standard equipment - = Optional accessories, orderable separately - } = Non-stop dehumidification - 1)4VJUBCJMJUZTDPSFGSPN1FSGFDUMZTVJUFEUP/PUTVJUFE2) S = Small, M = Medium, L = Large An overview of device differences, functional principles and possible applications of the dehumidifiers can be found at: uk.trotec.com/dehumidification-info DEHUMIDIFICATION HOMECOMFORT SERIES 29 HUMIDIFICATION HUMIDIFICATION AND AIR PURIFICATION FOR GENERATING HEALTHY ROOM AND BREATHING AIR Ultrasonic humidifiers For improving the air quality B 2 E #&#& Evaporation humidifiers For an optimum regulation of the humidity level #& B 7 E #&#& # Air washers For odour elimination, air purification and humidification "84 "84 30 HUMIDIFICATION Constantly updated: www.trotec.com/catalogs Trotec HBuefmieduicfihctautinogn Dehumidification SecoSan Air cleaning HUMIDIFICATION USING ULTRASOUND 7PNKMGEQNFGXCRQTCVKQPJWOKFKGTUQTTQVCVKQPCNJWOKFKGTUVJCVJWOKFKH[ +PQTFGTHQTWNVTCUQPKEJWOKFKGTUVQQRGTCVGJ[IKGPKECNN[VJGYCVGT FT[TQQOCKTD[DNQYKPIKVVJTQWIJCNVGTGGEGGPTKEJGFYKVJYCVGT needs to be demineralized and ideally disinfected. Some devices come WNVTCUQPKEJWOKFKGTUCVQOK\GYCVGTFKTGEVN[VQRTQFWEGCPWNVTCPGURTC[ YKVJKPVGITCVGF78|NCORUHQTVJKURWTRQUG#NVGTPCVKXGN[[QWOC[YCPVVQ mist, which is why they are often referred to as atomizers or nebulizers. WUGC5GEQUCP5VKEMVQRTQVGEVVJGYCVGTVCPMQHVJGWNVTCUQPKEJWOKFKGT from germ infestation and bacterial growth on a permanent basis. When 7NVTCUQWPFRTQEGFWTGYKVJCPWPJGCTFQHGEKGPE[ TGNNKPIYCVGTVJGUVKEMECPUKORN[TGOCKPKPVJGVCPMKVUGGEVNCUVUUKZ months without interruption. Water is next to incompressible and makes for a very poor pressure absorber. You may have noticed this watching a glass of water positioned Instead of using a Secosan Stick you can exchange the water every day on a speaker. Turning up the volume the water begins to ripple. In a VCRYCVGTOWUVJCXGDGGPDQKNGFTUVCPFVJGPEQQNGFFQYPVQTQQO way, the water surface "dances" to the beat and so renders the sounds temperature, else you can use demineralized water). visible in form of waves. A high-pitched note connotes a high frequency CUECPDGUGGPHTQOVJGJKIJGTYCXG6JGWNVTCUQPKEJWOKFKGTVCMGU #EVWCNN[FKUVKNNGFYCVGTKUKFGCNHQTWUGKPCPWNVTCUQPKEJWOKFKGTUKPEG advantage of this principle. A piezoelectric transducer converts electric the distillation to a great extent already cleans the water from salts, energy to mechanical energy. organic matter, micro-organisms and other contaminations which con- VTKDWVGUVQCNNJ[IKGPGTGNCVGFGQTVU An ultrasonic transducer located at the bottom of the water tank uses high-frequency sound to generate high pressure surges which then Unfortunately, truly distilled water, i.e. manufactured by distillation, is in- release tiny air bubbles (cavitation). The simultaneously triggered creasingly hard to obtain nowadays because in most cases the production RTGUUWTGYCXGUGPVTCKPVJGUGDWDDNGUCPFECTT[VJGOQVQVJGUWTHCEG is cheaper using ion exchangers. where a water column is created above the transducer. The bursting QHVJGUGDWDDNGUCVVJGUWTHCEGQHVJGYCVGTEQNWOPTGUWNVUKPWNVTCPG Water demineralized by means of ionization is often incorrectly referred OKUVFTQRNGVUYKVJCFKCOGVGTQHCRRTQZ|OYJKEJECPDGCDUQTDGF VQCUFKUVKNNGFYCVGTCPFQGTGFHQTWUGKPECTDCVVGTKGUCPFCVKTQPU by the air particularly fast. However, this is no indication of it being free of germs unless the packaging bears the express declaration "suitable for medical purposes". This entire process is repeated over and over at an incredible speed. 9KVJCRRTQZ|/*\VJGWNVTCUQWPFHTGSWGPE[NKXGUWRVQKVUPCOGCPF ;QWYKNNDGOWEJDGVVGTQWUKPIFGEQEVGFVCRYCVGTCPFGZEJCPIKPI is no longer audible for human ears hence this noiseless procedure it daily. This saves you the purchase of expensive distilled water and is can be used for an agreeable, quiet atmosphere. This truly sets the perfectly adequate from a hygienic point of view. Boiling not only kills YCVGTKPOQVKQPHQT|/*\OGCPVJCV|OKNNKQPQUEKNNCVKQPE[ENGUCTG most of the microorganisms and germs in the water, it also reduces the transferred to the water each second! As a result minuscule cavities YCVGT UJCTFPGUUYJKEJKPVWTPUKIPKECPVN[TGFWEGUUECNGDWKNFWRKPVJG CTGHQTOGFCVVJGYCVGTUWTHCEGCPFWNVTCPGOKUVFTQRNGVUCTGTGNGCUGF immediate surroundings of the device even with an already installed from the wave crest. FGECNEKECVKQPECTVTKFIG %NGCPJWOKFKGFCKTsCUCOCVVGTQHJ[IKGPG Ultrasonic technology is tried and tested and has been successfully CRRNKGF KP C XCTKGV[ QH GNFU HQT OCP[ [GCTU PQY s YJGPGXGT VJG JWmidity level had to be regulated with high precision and simultaneously NQYQRGTCVKPIEQUVU7NVTCUQPKEJWOKFKGTUCTGQHVGPCEEWUGFQHDGKPI unhygienic and of promoting an increased formation of germs in the water reservoir with the corresponding spread by way of atomization. It's a fact that water stagnating in containers leads to the formation of IGTOU+PVJKUTGURGEVGXGT[YCVGTNNGFFGXKEGNCEMKPIVJGPGEGUUCT[ care and maintenance tends to build up dirt regardless of the deployed JWOKFKECVKQPOGVJQF (QT RTQEGUUTGNCVGF TGCUQPU JQYGXGT WNVTCUQPKE JWOKFKGTU TGSWKTG a higher degree of discipline when it comes to hygiene. Here water is not evaporating, leaving potential germs behind in the container, instead the water is turned into mist using ultrasound and then emitted to the air. Even though the ultrasound already kills germs and bacteria, to permanently preserve the functionality of such devices in daily operation it is necessary to clean them regularly and thoroughly according to the manufacturer's instructions. Extended periods of water stagnation inside the tank must be prevented. Heating Air cooling Air conditioning Ventilation Cleaning Accessories HUMIDIFICATION 31 HUMIDIFICATION Ultrasonic humidifiers for an agreeable room climate B 2 E Ultrasonic humidifier JOIVNJEJGJFS BSPNBEJGGVTFSBOEBJS cleaner Ultrasound technology for a pleasant room climate and air quality improvement Integrated scented oil diffuser for an optional SPPNBJSBSPNBUJ[BUJPO Improving the room air by means of the carbon air filter MFWFMTGPSTFUUJOHUIFOFCVMJ[FSJOUFOTJUZ 3VOUJNFPGVQUPIPVSTUIBOLTUPBMBSHF water tank Can be used with normal tap water no distilled water required Automatic operation Carbon air filter Water level indicator LED indicator to indicate an empty water tank Automatic switch-off B 3 E / B 4 E Ultrasonic humidifier JOIVNJEJGJFSXJUIBSPNBEJGGVTFSBOE carbon air cleaner Ultrasound technology for a pleasant room climate and air quality improvement Integrated scented oil diffuser for an optional SPPNBJSBSPNBUJ[BUJPO Improving the room air by means of the carbon air filter An integrated anti-bacterial UV lamp in the device interior prevents the growth of bacteria and the formation of germs in the water tank MFWFMTGPSTFUUJOHUIFOFCVMJ[FSJOUFOTJUZ 3VOUJNFPGVQUPIPVSTUIBOLTUPBMBSHF water tank On-demand LED illumination of the 4.2 litre water tank timer function (2-12 hours) Automatic switch-off when water tank is empty Low-maintenance and uncomplicated easy disassembly and cleaning Can be used with normal tap water no distilled water required Low-noise and energy-saving B 5 E Ultrasonic humidifier 2-in-1 humidifier and air cleaner Ultrasound technology for a pleasant room climate and air quality improvement SPUBUBCMFNJTUOP[[MF Improving the room air by means of the carbon air filter MFWFMTGPSTFUUJOHUIFOFCVMJ[FSJOUFOTJUZ 3VOUJNFPGVQUP{IPVSTUIBOLTUPBMBSHF water tank Can be used with normal tap water no distilled water required *POJ[FSGPSCFUUFSBJSRVBMJUZ Automatic operation, baby mode and night mode Timer function Indication of the current humidity level Automatic switch-off On-demand LED lighting of the water tank 32 HUMIDIFICATION B 7 E Ultrasonic humidifier JOIVNJEJGJFS BSPNBEJGGVTFSBOEBJS cleaner Ultrasound technology for a pleasant room climate and air quality improvement Integrated scented oil diffuser for an optional SPPNBJSBSPNBUJ[BUJPO Improving the room air by means of the carbon air filter MFWFMTGPSTFUUJOHUIFOFCVMJ[FSJOUFOTJUZ 3VOUJNFPGVQUPIPVSTUIBOLTUPBMBSHF water tank Can be used with normal tap water no distilled water required Automatic operation and night mode Antibacterial UV lamp reduces bacteria in the water tank Timer function Touchscreen control panel Indication of the current humidity level Automatic switch-off Constantly updated: www.trotec.com/catalogs Trotec HBuefmieduicfihctautinogn Dehumidification Ultrasonic humidifiers for an agreeable room climate AIR EASY TO BREATHE AND OPTIONALLY WITH A STIMULATING FRAGRANCE 5QOGWNVTCUQPKEJWOKFKGTUCTGCFFKVKQPCNN[GSWKRRGFYKVJCTQOCFKHfusers. These models basically house two devices in one shell huOKFKGTCPFHTCITCPEGFKWUGT#PKPVGITCVGFUEGPVGFQKNVCPMRGTOKVU the addition of an essential oil of your choice revitalizing or relaxing. 6JG QPFGOCPF HTCITCPEG FKWUGT CVQOK\GU VJG QKN VQ CP WNVTCPG spray which is evenly distributed in the room leaving nothing but a discreet scent. As such it is fairly predestined for aroma therapy stimulatKPIOGP UQYPJGCNKPIRQYGTU6JGUEGPVQHGUUGPVKCNQKNUCGEVUQWT well-being and can be a natural remedy for stress, bad mood or even sleep problems. To make sure this agreeable room climate can be apRTGEKCVGF D[ CNN UGPUGU UQOG WNVTCUQPKE JWOKFKGTU CTG HWTVJGT RTQvided with an on-demand LED illumination as "wellness for the eyes". SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation Cleaning Accessories HUMIDIFICATION 33 HUMIDIFICATION Ultrasonic humidifiers for an agreeable room climate Overview: Ultrasonic humidifiers Technical data Article number Suitable for rooms sized up to Max. atomization performance Water supply White Black Input voltage Power input Sound pressure level Housing design Length Width H H H Height L W L W L W Weight Equipment and functions Hygrostat-controlled automatic operation Cold evaporation principle based on ultrasonic atomization Selectable ioniser Display of relative humidity Integrated scented oil tank and diffuser for an optional room air aromatization LED display Control panel Atomization intensity Carbon air filter UV lamp Timer function Night mode 360° rotatable mist nozzle Water filling level indicator Water tank indication On-demand LED lighting of the water tank Warning signal to indicate a low water level Automatic switch-off when water tank is empty Accessories SecoSan Stick 10 LiQVit hygiene agent 1000 ml Descaler 1000 ml B 2 E 1.160.000.051 30 m² / 75 m³ 7.2 l/24h 4 l 100 - 240 V/ 50 - 60 Hz 24 W 38 dB(A) Plastic 230 mm 162 mm 295 mm 1.5 kg B 2 E 4-stage B 2 E 6.100.004.110 6.100.004.185 6.100.004.199 B 3 E / B 4 E 1.160.000.052 1.160.000.053 24 m² / 60 m³ 6 l/24h 4.2 l 100 - 240 V/ 50 - 60 Hz 24 W 38 dB(A) Plastic 185 mm 185 mm 305 mm 1.5 kg B 3 E / B 4 E Control buttons 3-stage B 3 E / B 4 E 6.100.004.110 6.100.004.185 6.100.004.199 B 5 E 1.160.000.055 30 m² / 75 m³ 7.2 l/24h 4 l 220 - 240 V/ 50 - 60 Hz 25 W 37 dB(A) Plastic 285 mm 175 mm 290 mm 3 kg B 5 E Membrane keys 3-stage B 5 E 6.100.004.110 6.100.004.185 6.100.004.199 B 7 E 1.160.000.057 30 m² / 75 m³ 7.2 l/24h 5 l 100 - 240 V/ 50 - 60 Hz 24 W 38 dB(A) Plastic 195 mm 195 mm 385 mm 2 kg B 7 E Touch 3-stage B 7 E 6.100.004.110 6.100.004.185 6.100.004.199 34 HUMIDIFICATION Constantly updated: www.trotec.com/catalogs 35 HUMIDIFICATION Accessories Cleaning Ventilation Air cooling Air conditioning Heating Air cleaning SecoSan HBuemfeiduicfhictautniogn Dehumidification Trotec HUMIDIFICATION Humidifiers for an agreeable room climate B 24 E / B 25 E Evaporation humidifier Hygrostat-controlled room air humidification by natural cold evaporation High-quality and stable aluminium housing Integrated scented oil diffuser for an optional SPPNBJSBSPNBUJ[BUJPO &GGFDUJWFEFHSFFBJSEJTUSJCVUJPOJOUIF entire room Various operating modes plus ultra-silent night mode SecoSan® system for water pollution control already integrated Can be used with normal tap water no distilled water required 4 fan stages Automatic switch-off Dimmable LEDs for individual light intensity control Low-maintenance and uncomplicated easy disassembly and cleaning B 400 Evaporation humidifier Hygrostat-controlled room air humidification by natural cold evaporation 3PCVTUDPOTUSVDUJPONBEFPGQPXEFSDPBUFE steel sheet Neatly arranged control panel with hygrostat and fan control as well as status indication 3FWPMWJOHFWBQPSBUJPOGMFFDFDMFBOTPS washes the air Can be used with normal tap water no distilled water required Filling neck with quick release for fast water refilling 2 fan stages Automatic switch-off Adjustable discharge grill Optimum air circulation by means of an integrated wall spacer FRESH AIR WITH AN OPTIONAL FEELGOOD SCENT The B 24 E / B 25 E is equipped with a separate scented oil tank for an optional aromatization of the room air. This way you can turn your home into a scented oasis of well-being for the senses. Scents have a FKTGEVKPWGPEGQPQWTYGNNDGKPICPFECPDGQHJGNRKPECUGQHUVTGUU bad mood or even sleep problem. Since the scented oil is not emitted into the room via the water but sepCTCVGN[D[CFKWUGTVJGGXCRQTCVKQPNVGTQHVJG$'$'FQGUPQV clog. All customary scented oils may be used ideal for an individual and relaxing aroma therapy! 36 HUMIDIFICATION Constantly updated: www.trotec.com/catalogs Trotec HBuefmieduicfihctautinogn Dehumidification SecoSan Air cleaning Humidifiers for an agreeable room climate Overview: Humidifiers Technical data B 24 E / B 25 E B 400 Article number Suitable for rooms sized up to Max. humidification performance Water supply Input voltage Supply voltage Power input Champagne White Sound pressure level 1.160.000.109 1.160.000.110 24 m² / 60 m³ 8.4 l/24h 3 l 230 V/50 - 60 Hz 12 V 6 W 23 dB(A) up to 58 dB(A) 1.160.000.400 360 m² / 900 m³ 60 l/24h 29 l 220 - 240 V/50 Hz 53 W 29 dB(A) up to 42 dB(A) Housing design Length Width Height Weight H L W L H W Equipment and functions Hygrostat-controlled automatic operation Natural cold evaporation principle Integrated scented oil tank and diffuser for an optional room air aromatization Dimmable LED illumination Filter change indicator SecoSan system for water pollution control Operating modes Fan stages Noiseless night operation in whisper mode Adjustable air outlet grille Warning signal to indicate a low water level Automatic switch-off when water tank is empty Accessories Plastic, Aluminium 248 mm 248 mm 305 mm 2.5 kg B 24 E / B 25 E 5 4 B 24 E / B 25 E Sheet steel 316 mm 625 mm 720 mm 18.6 kg B 400 2 B 400 Evaporation filter B 25 E 7.710.000.832 SecoSan Stick 10 6.100.004.110 LiQVit hygiene agent 1000 ml 6.100.004.185 6.100.004.185 Descaler 1000 ml 6.100.004.199 6.100.004.199 Automatic water supply for B 400 6.100.004.028 B 400 round filter 6.100.004.040 B 400 filter fleece 6.100.004.020 SecoSan Stick 30 6.100.004.125 3ULQFLSOHRIFROGHYDSRUDWLRQ: +RQH\FRPEILOWHU vs. UHYROYLQJKXPLGLILFDWLRQGUXP (YDSRUDWRU (+RQH\FRPEILOWHU) 7KLVWHFKQRORJ\DGRSWVWKHQDWXUDOSULQFLSOH RIHYDSRUDWLRQ7KHILOWHUVXFNVWKHZDWHU ZKLFKJUHDWO\LQFUHDVHVWKHVSHFLDOKRQH\ FRPEVWUXFWXUHRIWKHILOWHU 7KXVWKH HYDSRUDWLRQILOWHUQDWXUDOO\UHPDLQV SHUPDQHQWO\PRLVWHQHGZKLFKLVZK\ WKHPHFKDQLFDOZHDUSDUWVDUHFRPSOHWHO\ DEVHQW7KHDLULVGUDZQWKURXJKWKH PRLVWHQHGILOWHUDQGUHFKDUJHVZLWK PRLVWXUH +XPLGLILFDWLRQ Dnd DLUSXULILFDWLRQ (UHYROYLQJKXPLGLILFDWLRQGUXP) 7KHDLULVVXFNHGLQYLDDIDQDQGSDVVHGWKURXJKDURWDU\PRLVWHQLQJ GUXPZKLFKLVPRYHGWKURXJKDZDWHUEDWKZLWKDQHYDSRUDWLRQIOHHFH 'XHWRWKHFRQWLQXRXVURWDWLRQ WKHDLULVFOHDQHGHIIHFWLYHO\ DQGVLPXOWDQHRXVO\FKDUJHG ZLWKKXPLGLW\ZKLFKLVWKHQ DJDLQHPLWWHGWRWKHURRPDLU HYHQO\DQGZLWKRXWSUHFLSLW DWLRQRYHUWZRHOLJLEOHIDQ VWDJHV. SecoSan® DOZD\VWKHEHVWZDWHUTXDOLW\ IRUUHIUHVKLQJO\KXPLGLILHGURRPDLU 0RUHRYHU WKH % ( LV WKH RQO\ VLOYHU LRQV ZKLFK LQKLELW EDFWHULD KXPLGLILHURQWKHPDUNHWWKDWFRPHV DQG JHUPV XSRQ FRQWDFW DQG WKXV ZLWKH[FOXVLYHDGGLWLRQDOHTXLSPHQW SUHYHQWWKHLUUHSURGXFWLRQ 7R NHHS WKH ZDWHU UHVHUYH DXWRPDWLFDOO\ DV FOHDQ DV RQ WKH ILUVW GD\WKHUHLVDKROGHUIRUD6HFR6DQp 6WLFN HPEHGGHG LQ WKH ERWWRP RI WKH WDQN 7KH 6HFR6DQp 6WLFN KHOSV WR NHHS WKH ZDWHU SHUPDQHQWO\ FOHDQ FOHDU DQG IUHH RI ELRORJLFDO JURZWKRUXQSOHDVDQWRGRXUV 7KHXQLTXHIHDWXUHRI6HFR6DQpLVLWV DQWLPLFURELDOVXUIDFHZLWKPRELOH 7KHLU DGYDQWDJH FRPSDUHG WR FRQYHQWLRQDOVLOYHUSUHSDUDWLRQV7KH HQWLUHO\ VHOIGRVLQJ 6HFR6DQp LRQ UHVHUYRLU QRW RQO\ NHHSV WKH ZDWHU GHPRQVWUDEO\ IUHH IURP JHUPV EXW DOVREDVLFDOO\IUHHIURPVLOYHULRQV 7KH VXSSOLHG VWLFN WKXV JXDUDQWHHV FOHDQZDWHUIRUXSWRPRQWKVHYHQ LIWKHZDWHULVFKDQJHGRUFRQVXPHG GDLO\ Heating Air cooling Air conditioning Ventilation Cleaning Accessories HUMIDIFICATION 37 HUMIDIFICATION Air washers for a healthy room climate AW 10 S JODPNCJOBUJPOEFWJDFGPSPEPVS Plasma generator for the elimination of elimination, air purification and humidification odours and pollutants in the room air Sensor control for energy-saving automatic operation EJGGFSFOUPQFSBUJOHNPEFTQMVTVMUSBTJMFOU night modes 3FMJBCMZSFNPWFTIPVTFEVTU QPMMFOBOE animal hair from the air and simultaneously keeps it ideally humidified Air washing without filter mats low follow-up costs for maintenance and care Display of relative humidity Large water reservoir for long maintenancefree operations Only tap water required Variable fan control for need-based room adjustment AW 20 S JODPNCJOBUJPOEFWJDFGPSPEPVS Plasma generator for the elimination of elimination, air purification and humidification odours and pollutants in the room air Intelligent combined sensor for simultaneous measurement of air humidity and quality enables energy-saving automatic operation An exchangeable pre-filter frees the air reliably from coarse house dust or animal hair Separately selectable HEPA filter function filters fine particulates such as pollen, mite faeces, mould spores and fine dust Display of relative humidity EJGGFSFOUPQFSBUJOHNPEFTQMVTVMUSBTJMFOU night mode TUBHFMJHIUTJHOBMJOEJDBUFTUIFBJSRVBMJUZJO the room (blue, yellow, red) Large water reservoir for long maintenancefree operations Only tap water required Variable fan control for need-based room adjustment AIR PURIFICATION AND HUMIDIFICATION IN ONE DEVICE EFFECTIVE FUNCTIONAL PRINCIPLE The air washers of Trotec's AW-S series guide the sucked-in air past TQVCVKPIJWOKFKGTFKUMUYJGTGKVCDUQTDUYCVGTOQNGEWNGUYJKNGFKTV particles such as pollen, animal hair and house dust cling to the disk and are bound in the water reservoir. The water molecules are absorbed by self-regulating cold evaporation ensuring optimum humidity values. Before emerging into the room the air is additionally ionised on a natural basis, whereby contaminants are neutralized and odours reduced. 9KVJ VJG #9 5 C *'2# NVTCVKQP QH VJG JWOKFKGF CKT KU GGEVGF optionally depending on the selected operating mode. Dust Viruses Bacteria Mold spores ION Clean Air Ventilation HEPA FILTER Ionization ION Pollen Animal hair Lint Dust mite residues Pre-Filter Pre-Filter Air washing 38 HUMIDIFICATION AW-S SERIES Constantly updated: www.trotec.com/catalogs Trotec HBuefmieduicfihctautinogn Dehumidification SecoSan Air washers for a healthy room climate Overview: Air washers Technical data Article number Suitable for rooms sized up to Max. humidification performance Max. air volume Water supply Input voltage Power input Sound pressure level Housing design Length Width H Height LW Weight Equipment and functions Display of relative humidity Humidification function can be switched on or off separately Binds pollen, animal hair and house dust Prefilter (replaceable) for higher filter efficiency 99.97 % effective HEPA filtering of pollen, dust mite residue, mould fungus spores and other allergens HEPA function can be switched on or off as needed Reduces odours and electrostatic charges Effective functional principle without limescale or wet spots Sensor-controlled automatic operation Combined air quality and humidity sensor for automatic control Indication of the current air quality Operating modes Night mode (ultrasilent) AirgoPro ion isolator for odour reduction / selectable Water filling level indicator Warning signal to indicate a low water level Automatic switch-off when water tank is empty Accessories SecoSan Stick 10 LiQVit hygiene agent 1000 ml Descaler 1000 ml Pre-filter (set of 2) HEPA filter (set of 2) AW 10 S 1.160.000.010 25 m² / 63 m³ 400 ml/h 126 m³/h 9 l 230 V/50 - 60 Hz 11 W F$ # Plastic 315 mm 310 mm 390 mm 6 kg AW 10 S 3 / AW 10 S 6.100.004.110 6.100.004.185 6.100.004.199 AW 20 S 1.160.000.020 55 m² / 138 m³ 750 ml/h 228 m³/h 9 l 230 V/50 Hz 24 W F$ # Plastic 410 mm 325 mm 420 mm 10 kg AW 20 S 9 / AW 20 S 6.100.004.110 6.100.004.185 6.100.004.199 7.710.000.831 7.710.000.830 GOOD DESIGN. GOOD AIR. With our compact air washers AW 10 S and AW 20 S you can bring healthy room air easily and conveniently right into your home. Once commissioned, the air washers immediately generate RGTEGRVKDN[ENGCPRNGCUCPVN[JWOKFKGFCKT#FFKVKQPCNN[VJG TQQOCKTKUGGEVKXGN[ENGCPGFCPFTGNKCDN[HTGGFHTQORQNNGP FWUVCPFCPKOCNJCKTsKFGCNHQTCNNGTI[UWGTGTU/QTGQXGT both air washers reduce odours and electrostatic charges. #95sGZVTGOGN[NQYOCKPVGPCPEG The AW 10 S is a 3-in-1 combination device it does not only humidify the air by means of self-regulating cold evaporation, it also washes the air and cleans it of animal hair, house dust and pollen. Before emerging into the room the air is additionally ionised on a natural basis, whereby contaminants are neutralized and odours reduced. #95YKVJEQODKPGFUGPUQTCPF*'2#NVGTs our best recommendation for a perfect room The air washer AW 20 S is perfectly equipped to ensure optimum room air quality at all times. In addition to the relative humidity, the intelligent combined sensor also permanently detects the particle burden of the room air and autonomousN[EQPVTQNUVJGCWVQOCVKEOQFGHQTRGTHGEVN[JWOKFKGFCPF cleaned air. 9KVJVJG#95GXGPCNNGTI[UWGTGTUECPDTGCVJGCUKIJ QHTGNKGHVJCPMUVQGGEVKXG*'2#NVTCVKQPVJGCKTKUPQVQPN[ freed from house dust, pollen and animal hair even the tiniGUVFKTVRCTVKENGUEQPUKUVKPIQHPGRCTVKEWNCVGUCNNGTIGPUQT OQWNFURQTGUCTGNVGTGFQWVTGNKCDN[ 4GUVHWNUNGGRKUCNUQIWCTCPVGGF+PPKIJVOQFGVJG#9||5 operates ultra-silently and reliably frees the room air of pollutants while maintaining an ideal humidity level thanks to the natural principle of self-regulating cold evaporation so that your skin, nose and eyes are protected against drying QWVCPF[QWECPDGPGVHTQOCIQQFPKIJV UUNGGR Air cleaning Heating Air cooling Air conditioning Ventilation Cleaning Accessories HUMIDIFICATION AW-S SERIES 39 SECOSAN Pure water thanks to silver ion technology SecoSan Drinking water conservation "made in Germany" with unique operating principle Self-dosing and self-regulating system over- or underdosing is impossible Six-month long-term protection against new microbial growth Reliably prevents microbial, algae, mould and bacterial growth (biofilm) in your potable and non-potable tap water Certified by leading German testing institutes International patent MODERN WATER HYGIENE FOR A HEALTHY, CONSCIOUS LIFESTYLE 9JGVJGTCEQGGOCEJKPGYCVGTNVGTFGPVCNYCVGTLGVRGVDQYNQTVCPMU HQTECORKPIDQCVCPFECTCXCPCVJQOGCPFCYC[9GWUGXCTKQWUFTKPM KPICPFYCVGTEQPVCKPGTUCUCEQPXGPKGPVYC[VQCNYC[UJCXGHTGUJYCVGT HQTXCTKQWUCRRNKECVKQPUGCUKN[CPFSWKEMN[CEEGUUGFFKTGEVN[ But is the water really fresh? (TQOVJGYCVGTUWRRN[VQ[QWTJQOGKPCP[ECUG$WVKHVJGYCVGTKUVJGPKP RKRGUQTEQPVCKPGTUKVECPDGEQOGEQPVCOKPCVGFCHVGTCUJQTVVKOG*GTG VJG5GEQ5CP5VKEMRTQXKFGU[QWYKVJCUKORNGCPFUGEWTGYC[VQEQPUGTXG YCVGT,WUVRWVKVKPVQVJGYCVGTVCPMCPFFQPG6JGEQPVCKPGTUECPDG TGNNGFYKVJQWVKPVGTKOUVQTCIGQPCTGIWNCTDCUKUYKVJHTGUJYCVGT #NUQ VJG UKNXGT EQPEGPVTCVKQP KP VJG YCVGT KU UQ NQY VJCV KV KU PQV GXGP OGCUWTCDNG 6JG UKNXGT KQPU KP VJG 5GEQ5CP UVKEM GPUWTG RWTG ENGCP YCVGT 0GKVJGT EJNQTKPGPQTCP[QVJGTEJGOKECNRTGUGTXCVKXGUCTGWUGF6JKUKUYJ[5G EQ5CPKURCTVKEWNCTN[UWKVCDNGHQTFTKPMKPIYCVGT.GCFKPI)GTOCPVGUVKPI KPUVKVWVGU JCXG EQPTOGF VJKU 6JCPMU VQ KVU URGEKCN UWTHCEG 5GEQ5CP ECPPGKVJGTVCTPKUJPQTTWUVCPFJGPEGENQIVJGUVKEM+PVJKUYC[VJGGH HGEVECPCNUQTGOCKPWPTGUVTKEVGFHQTCNQPIRGTKQFQHVKOGCPF5GEQ5CP JGPEGGPUWTGURWTGENGCPYCVGTRNGCUWTG 6JGUGNHTGIWNCVKPI5GEQ5CPCEVKXGEQORQWPFOCKPVCKPUVJGRWTGYCVGT CWVQOCVKECNN[ KU CDUQNWVGN[ VCUVGNGUU CPF QGTU UKZ OQPVJU RTQVGEVKQP CICKPUV EQPVCOKPCVKQP 6JG 5GEQ5CP 5VKEM KU UWKVCDNG HQT VJG OQUV FK XGTUGCTGCUQHCRRNKECVKQPCPFKUCXCKNCDNGKPXCTKQWUUK\GUHQTMGGRKPI UOCNNVQXGT[NCTIGXQNWOGYCVGTTGUGTXQKTUQDVCKPGF Powerful silver against bacteria 5GEQ5CPYQTMUCEEQTFKPIVQCXGT[QNFCPFENGXGTRTKPEKRNG$CEVGTKCFQ PQVNKMGUKNXGT#UCPKPVGNNKIGPVUKNXGTKQPUVQTCIGWPKVVJG5GEQ5CPUVKEM CNYC[UTGNGCUGULWUVCUOCP[UKNXGTKQPUKPVQVJGYCVGTCUCTGTGSWKTGF VQ MGGR KV HTGG QH DCEVGTKC CPF IGTOU &WG VQ VJKU KPFGRGPFGPV FQUKPI 5GEQ5CPNCUVUUKIPKECPVN[NQPIGTVJCPPQTOCNUKNXGTRTQFWEVUKPVCDNGV RQYFGTQTNKSWKFHQTO 40 SECOSAN Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Pure water thanks to silver ion technology Overview: SecoSan Sticks for up to 30 litres Technical data #TVKENGPWODGT #EVKXGCIGPV 1RGTCVKPIVGORGTCVWTG /CZVCPMUK\G 2GTKQFQHCEVKQP 'ZRQUWTGVKOG 2QNNWVKQPEQPVTQNECRCEKV[ &WTCDKNKV[ .GPIVJ 9GKIJV 1) When emptying the tank twice a day SecoSan Stick 1 5KNXGT #I /CZ% N OQPVJU J N #VNGCUV[GCTU OO´OO MI SecoSan Stick 2 5KNXGT #I /CZ% N OQPVJU J N #VNGCUV[GCTU OO´OO MI SecoSan Stick 10 5KNXGT #I /CZ% N OQPVJU J N #VNGCUV[GCTU OO´OO MI SecoSan Stick 20 5KNXGT #I /CZ% N OQPVJU J N #VNGCUV[GCTU OO´OO MI SecoSan Stick 30 5KNXGT #I /CZ% N OQPVJU J N #VNGCUV[GCTU OO´OO MI SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation Cleaning Accessories SECOSAN 41 AIR CLEANING AIRGOCLEAN® AIR CLEANERS FOR A BETTER AIR QUALITY AirgoClean® AirgoClean® 10 E 11 E AirgoClean® 15 E AirgoClean® 100 E AirgoClean® 110 E AirgoClean® AirgoClean® 140 E 145 E AirgoClean® 150 E Fine dust an invisible danger for the lung, heart and vessels, more dangerous and more widespread than previously assumed (KPGFWUVKUQPGXGT[QPGoUNKRUCPFVJCVKPVJGVTWGUVUGPUGQHVJGYQTF 5EKGPVKEKPUVKVWVKQPUFGOCPFCFFKVKQPCNGQTVUHTQOGPXKTQPOGPVCN CPF JGCNVJ RQNKE[ OCMGTU VQ HWTVJGT TGFWEG VJG CKT RQNNWVKQP YKVJ RCTVKEWNCVGOCVVGT6JG[UC[VJCVVJGUQWTEGUQHRCTVKEWNCVGOCVVGT CTGOQTGFKXGTUGCPFVJGTGUWNVKPIFCOCIGVQJGCNVJOQTGUGTKQWU VJCPRTGXKQWUN[CUUWOGF Fine dust favours the development of serious diseases (KPGFWUVRCTVKENGUCNUQMPQYPCURCTVKEWNCVGOCVVGTCTGTGURKTCDNG RCTVKENGUYKVJCFKCOGVGTQHNGUUVJCP|O6JGUOCNNGTVJGUGPG RCTVKENGU CTG VJG FGGRGT VJG[ ECP RGPGVTCVG VJG DQF[ CPF QTICP U[UVGOU2CTVKEWNCVGOCVVGTECPECWUGKPCOOCVKQPKPVJGDTQPEJK CPFNWPIUCPFUNQYFQYPEJKNFTGPoUNWPIITQYVJ1VJGTEQPUGSWGPEGU QHRCTVKEWNCVGOCVVGTKPENWFGJGCTVCVVCEMUUVTQMGUCPFCEEGNGTCVGF CTVGTKQUENGTQUKU+PCOOCVQT[RTQEGUUGUJCXGCNUQDGGPQDUGTXGFKP VJGDTCKPCPFJCXGDGGPNKPMGFVQCHCUVGTFGXGNQROGPVQHFGOGPVKC KPQNFGTRGQRNGCUYGNNCUFGNC[GFKPVGNNKIGPEGFGXGNQROGPVKPEJKN FTGP+PCFFKVKQPVQKPCOOCVQT[TGCEVKQPUPGFWUVECPCNUQECWUG FCOCIGVQVJGECTFKQXCUEWNCTU[UVGOKPQVJGTYC[U AirgoClean® 170 E / 171 E AirgoClean® 200 E AIR CLEANING AIRGOCLEAN SERIES AirgoClean® 250 E AirgoClean® 350 E AirgoClean® One Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Comfort air cleaners for fresher and better breathing air AirgoClean® 10 E Two-stage room air filter system with pre-filter and HEPA filter Suited for the fully automatic air purification of rooms sized up to 40 m³ Purification volume max. 135 m³/h Uncomplicated, quick filter change Can be positioned on the floor thanks to its feet Low energy consumption 3 Fan stages Improved air cleaning thanks to ionizer Compactness and high performance combined with simple operation AirgoClean® 11 E Three-stage room air filter system with prefilter, carbon filter and HEPA filter Effective HEPA carbon filtering of pollutants and odours Suited for the fully automatic air purification of rooms sized up to 38 m³ Purification volume max. 120 m³/h Automatic mode Air quality display 3 Fan stages Improved air cleaning thanks to ionizer Compactness and high performance combined with simple operation Uncomplicated, quick filter change Timer function Low noise level: max. 43 dB(A) Low energy consumption SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation Cleaning AirgoClean® 15 E Two-stage room air filter system with prefilter Compactness and high performance combined and HEPA filter with simple operation The optionally available carbon HEPA filter does not only eliminate pollutants, but odours as well Suited for the fully automatic air purification of rooms sized up to 53 m³ Uncomplicated, quick filter change Low noise level: max. 45 dB(A) Integrated carrying handle Low energy consumption Purification volume max. 180 m³/h 3 fan stages Improved air cleaning thanks to ionizer AirgoClean® 100 E Three-stage room air filter system with prefilter, carbon filter and HEPA filter Effective HEPA carbon filtering of pollutants and odours Suited for the fully automatic air purification of rooms sized up to 53 m³ Purification volume max. 180 m³/h Automatic mode Air quality display 3 Fan stages Improved air cleaning thanks to ionizer Compactness and high performance combined with simple operation Uncomplicated, quick filter change Indicator light for filter Timer function Night mode (ultra-silent) IR remote control Low noise level: max. 49 dB(A) Low energy consumption AIR CLEANING AIRGOCLEAN SERIES 43 Accessories AIR CLEANING Comfort air cleaners for fresher and better breathing air AirgoClean® 110 E Three-stage room air filter system with prefilter, carbon filter and HEPA filter Effective HEPA carbon filtering of pollutants and odours Suited for the fully automatic air purification of rooms sized up to 63 m³ Purification volume max. 205 m³/h Automatic mode Air quality display 4 fan stages with turbo mode Improved air cleaning thanks to ionizer Compactness and high performance combined with simple operation Uncomplicated, quick filter change Indicator light for filter Timer function Child lock Night mode (ultra-silent) Low energy consumption AirgoClean® 140 E / 145 E Three-stage room air filter system with prefilter, activated carbon filter and HEPA filter Effective HEPA carbon filtration of pollutants and odours Suited for the fully automatic air purification of rooms sized up to 100 m³ Max. purification volume 330 m³/h Automatic mode / night mode (ultra-silent) Air quality indicator incl. temperature and humidity indication 3 fan stages with turbo mode Improved air cleaning thanks to ionizer UV lamp additionally protects against the formation of germs for even more hygienic cleaning Compactness and high performance combined with simple operation Uncomplicated, quick filter change IR remote control Timer function Indicator light for filter Child lock Low-noise level: max. 50 dB(A) Low energy consumption Can be used as wall-mounted or floor-standing device AirgoClean® 150 E Three-stage room air filter system with prefilter, carbon filter and HEPA filter Effective HEPA carbon filtering of pollutants and odours Suited for the fully automatic air purification of rooms sized up to 105 m³ Purification volume max. 355 m³/h Automatic mode Air quality display 4 fan stages with turbo mode Improved air cleaning thanks to ionizer Compactness and high performance combined with simple operation Uncomplicated, quick filter change Indicator light for filter Timer function Child lock Night mode (ultra-silent) Low-noise level: max. 52 dB(A) Low energy consumption 44 AIR CLEANING AIRGOCLEAN SERIES AirgoClean® 170 E / 171 E Three-stage room air filter system with prefilter, carbon filter and HEPA filter Effective HEPA carbon filtering of pollutants and odours Suited for the fully automatic air purification of rooms sized up to 105 m³ Purification volume max. 350 m³/h Automatic mode Air quality display 5 fan stages with turbo mode Compactness and high performance combined with simple operation Uncomplicated, quick filter change Indicator light for filter Night mode (ultra-silent) Low-noise level: max. 50 dB(A) Low energy consumption 99,97 % filter efficiency (171 E) Constantly updated: www.trotec.com/catalogs Comfort air cleaners for fresher and better breathing air Trotec Humidification Dehumidification SecoSan Air cleaning Heating Air cooling Air conditioning AirgoClean® 200 E Three-stage room air filter system with prefilter, carbon filter and HEPA filter Effective HEPA carbon filtering of pollutants and odours Suited for the fully automatic air purification of rooms sized up to 165 m³ Purification volume max. 550 m³/h Automatic mode Air quality display 4 fan stages turbo mode Improved air cleaning thanks to ionizer Compactness and high performance combined with simple operation Uncomplicated, quick filter change Indicator light for filter Timer function Child lock Night mode (ultra-silent) Low energy consumption AirgoClean® 250 E Three-stage room air filter system with prefilter, carbon filter and HEPA filter Effective HEPA carbon filtering of pollutants and odours Suited for the fully automatic air purification of rooms sized up to 220 m³ Purification volume max. 740 m³/h Automatic mode Air quality display 4 fan stages with turbo mode Improved air cleaning thanks to ionizer Compactness and high performance combined with simple operation Uncomplicated, quick filter change Indicator light for filter Child lock Night mode (ultra-silent) Low-noise level: max. 46.3 dB(A) Low energy consumption H14 HEPA FILTER AirgoClean® 350 E Three-stage room air filter system with prefilter, activated carbon filter and HEPA filter Effective HEPA carbon filtration of pollutants and odours Suited for the fully automatic air purification of rooms sized up to 300 m³ Max. purification volume 1,000 m³/h Automatic mode / night mode (ultra-silent) Air quality indicator incl. temperature and humidity indication 4 fan stages with turbo mode Improved air cleaning thanks to ionizer Compactness and high performance combined with simple operation Uncomplicated, quick filter change IR remote control Timer function Indicator light for filter Child lock Low energy consumption AirgoClean® One Four-stage room air filter system with coarse filter, activated carbon filter and HEPA filter Multi-stage HEPA filter system certified according to EN 1822 Highly efficient room air purification removes 99.995 % of all airborne viruses, bacteria, fine dust particles and pollen Proven to reduce the aerosol concentration of the room air scientifically tested Suited for the fully automatic air purification of rooms sized up to 195 m³ Purification volume max. 600 m³/h Automatic output control through sensorsupported air quality monitoring Measurement and display of the CO2 concentration 6 Fan stages with turbo mode Omnidirectional clean air distribution with 360° working radius Uncomplicated, quick filter change App control possible Elegant design with effective airflow air intake close to the floor, room-filling clean air flow AIR CLEANING AIRGOCLEAN SERIES 45 Ventilation Cleaning Accessories AIR CLEANING Comfort air cleaners for fresher and better breathing air Overview: Comfort air cleaners Technical data #TVKENGPWODGT 5WKVCDNGHQTTQQOUUK\GFWRVQ (KNVGTGHHKEKGPE[ 2TGHKNVGT 9JKVG $NCEM *'2#HKNVGT OKP #KTHNQYTCVG OCZ +PRWVXQNVCIG 2QYGTKPRWV 'NGEVTKEEQPPGEVKQP 5QWPFNGXGN FKUVCPEGO .GPIVJ 9KFVJ *GKIJV 9GKIJV 'SWKROGPVCPFHWPEVKQPU (CPUVCIGU 6WTDQOQFG &KIKVCNFKURNC[ +QPK\GT (KNVGTEJCPIGKPFKECVKQP #KTSWCNKV[UGPUQT 81% &WUVUGPUQT %1UGPUQT #KTSWCNKV[FKURNC[ #WVQOCVKEQRGTCVKQP .KIJVFGVGEVKQPHWPEVKQP 78NCOR 2NWIV[RG %CDNGNGPIVJ OKP OCZ H H L W L W 6KOGTHWPEVKQP 0KIJVOQFG 2NCUOCIGPGTCVQT /GOQT[HWPEVKQP %JKNFNQEM +PHTCTGFTGOQVGEQPVTQN #RREQPVTQN #EEGUUQTKGU %CTDQPHKNVGT *'2#ECTDQPHKNVGT *'2#ECTDQPHKNVGT *'2#HKNVGT *'2#HKNVGT *'2#HKNVGT* '0 #KTHKNVGT 5KNGPEGT 2TGHKNVGT( 2TGHKNVGT/CV * already integrated in the combination filter. AirgoClean® 10 E AirgoClean® 11 E AirgoClean® 15 E AirgoClean® 100 E AirgoClean® 110 E AirgoClean® 140 E / 145 E OO 5[PVJGVKEHKDTG OO 5[PVJGVKEHKDTG OO 5[PVJGVKEHKDTG OO 5[PVJGVKEHKDTG OO 5[PVJGVKEHKDTG OO 5[PVJGVKEHKDTG *'2#HKNVGT *'2#ECTDQP HKNVGT *'2#HKNVGT *'2#HKNVGT *'2#ECTDQP *'2#ECTDQP HKNVGT HKNVGT OJ OJ OJ OJ OJ OJ OJ OJ OJ OJ OJ OJ 8 *\ 8 *\ 8 *\ 8 *\ 8 *\ 8 *\ 9 %'' O F$ # 11 W %'' O F$ # 9 %'' O F$ # 9 %'' O F$ # 9 %'' O F$ # 9 %'' O F$ # F$ # F$ # F$ # F$ # F$ # F$ # OO OO OO OO OO OO OO OO OO OO OO OO OO OO OO OO OO OO MI MI MI MI MI #KTIQ%NGCP® 10 E #KTIQ%NGCP® 11 E #KTIQ%NGCP®' #KTIQ%NGCP® 100 E #KTIQ%NGCP® 110 E 4 MI '' JJJJ J JJJJ J #KTIQ%NGCP® 10 E #KTIQ%NGCP® 11 E #KTIQ%NGCP®' #KTIQ%NGCP® 100 E #KTIQ%NGCP® 110 E * * * * * * * * * '' 46 AIR CLEANING AIRGOCLEAN SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification SecoSan Air cleaning Comfort air cleaners for fresher and better breathing air Overview: Comfort air cleaners Technical data #TVKENGPWODGT 9JKVG $NCEM AirgoClean® 150 E AirgoClean® 170 E / 171 E AirgoClean® 200 E AirgoClean® 250 E AirgoClean® 350 E AirgoClean® One 5WKVCDNGHQTTQQOUUK\GFWRVQ OO OO OO OO OO OO (KNVGTGHHKEKGPE[ 2TGHKNVGT 5[PVJGVKEHKDTG 5[PVJGVKEHKDTG 5[PVJGVKEHKDTG 5[PVJGVKEHKDTG 5[PVJGVKEHKDTG 5[PVJGVKEHKDTG *'2#HKNVGT *'2#ECTDQP *'2#ECTDQP *'2#ECTDQP *'2#ECTDQP *'2#ECTDQP HKNVGT HKNVGT HKNVGT HKNVGT HKNVGT *'2#* '0 #KTHNQYTCVG OKP OJ OJ OJ OJ OJ OJ OJ OCZ OJ OJ OJ OJ OJ OJ +PRWVXQNVCIG 8 *\ 8 *\ 8 *\ 8 *\ 8 *\ 8 *\ 2QYGTKPRWV 'NGEVTKEEQPPGEVKQP 5QWPFNGXGN FKUVCPEGO .GPIVJ 9KFVJ *GKIJV 9GKIJV 'SWKROGPVCPFHWPEVKQPU (CPUVCIGU 6WTDQOQFG &KIKVCNFKURNC[ +QPK\GT (KNVGTEJCPIGKPFKECVKQP 2NWIV[RG %CDNGNGPIVJ OKP OCZ H H L W L W 9 %'' O F$ # F$ # OO OO OO MI #KTIQ%NGCP®' 4 9 %'' O F$ # F$ # OO OO OO MI '' 9 9 9 9 %'' %'' %'' %'' O O O O F$ # F$ # F$ # F$ # F$ # F$ # F$ # F$ # OO OO OO OO OO OO OO OO OO OO OO OO MI MI MI MI #KTIQ%NGCP®' #KTIQ%NGCP®' #KTIQ%NGCP®' #KTIQ%NGCP®1PG 4 4 4 6 #KTSWCNKV[UGPUQT 81% &WUVUGPUQT %1UGPUQT #KTSWCNKV[FKURNC[ #WVQOCVKEQRGTCVKQP .KIJVFGVGEVKQPHWPEVKQP 78NCOR 6KOGTHWPEVKQP JJJJ JJJ J 5VCTVUVQRVKOGT YGGMN[UEJGFWNG 0KIJVOQFG 2NCUOCIGPGTCVQT /GOQT[HWPEVKQP %JKNFNQEM +PHTCTGFTGOQVGEQPVTQN #RREQPVTQN #EEGUUQTKGU %CTDQPHKNVGT *'2#ECTDQPHKNVGT *'2#ECTDQPHKNVGT *'2#HKNVGT *'2#HKNVGT *'2#HKNVGT* '0 #KTHKNVGT 5KNGPEGT #KTIQ%NGCP®' * * * '' #KTIQ%NGCP®' #KTIQ%NGCP®' #KTIQ%NGCP®' #KTIQ%NGCP®1PG 2TGHKNVGT( 2TGHKNVGT/CV * already integrated in the combination filter. ** HEPA carbon filter (99.97%) included in the standard scope of delivery. Heating Air cooling Air conditioning Ventilation Cleaning Accessories AIR CLEANING AIRGOCLEAN SERIES HEATING INFRARED RADIANT HEATERS OF THE IR-S SERIES / IR SERIES SELECTIVE HEATING AND NO WARM-UP TIME REQUIRED IP24 IR 1200 S IP34 IR 2000 S IP34 IR 2010 S IR 2570 S IP34 IP65 -80% LOW GLARE IR 2001 IR 2005 IP55 -80% LOW GLARE IP65 -80% LOW GLARE IR 2050 IR 2200 HEATING IR-S SERIES / IR SERIES IPX0 -80% LOW GLARE IP55 IR 2400 IR 3050 IP65 -80% LOW GLARE Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Radiant heaters with a heating capacity up to 2,500 W IR 1200 S Infrared heat without preheating 2 heating levels, up to 1,200 watts 2 quartz elements Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash-proof, protection type IP24 Adjustable inclination angle with a wide effective range Suitable for wall mounting Integrated suspension device Energy-efficient IR 2000 S Infrared heat without preheating 3 heating levels, up to 2,000 watts 3 quartz elements Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash-proof, protection type IP34 Adjustable inclination angle with a wide effective range Suitable for wall mounting Integrated suspension device Energy-efficient SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning IR 2010 S Infrared heat without preheating 3 heating levels, up to 2,000 watts High-quality carbon infrared tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash-proof, protection type IP34 24-hour timer LED display Robust aluminium housing Adjustable inclination angle with a wide effective range Suitable for wall mounting or attachment to a telescopic tripod Integrated suspension device IR remote control Energy-efficient IR 2570 S Infrared heat without preheating 3 heating levels, up to 2,500 watts 1 quartz element Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers 24-hour timer LED display Robust aluminum housing Adjustable inclination angle with a wide effective range For mounting on walls or on the telescopic tripod Integrated suspension device IR remote control Energy-efficient HEATING IR-S SERIES Accessories HEATING Radiant heaters with a heating capacity up to 2,500 W Overview: Radiant heaters of the IR-S with a heating capacity of up to 2,500 W Technical data #TVKENGPWODGT *GCVKPIECRCEKV[ *GCVKPIGNGOGPV 5VCIG 5VCIG 5VCIG +PRWVXQNVCIG 0QOKPCNEWTTGPVEQPUWORVKQP +2V[RGQHRTQVGEVKQP 'NGEVTKEEQPPGEVKQP 2NWIV[RG %CDNGNGPIVJ .GPIVJ 9KFVJ *GKIJV H W L 9GKIJV 'SWKROGPVCPFHWPEVKQPU *GCVKPINGXGNU 5VGRNGUUN[CFLWUVCDNGVJGTOQUVCV #FLWUVCDNGOWNVKUVCIGVJGTOQUVCV 1RGTCVKPIEQPVTQNNCOR #WVQOCVKEUYKVEJQHHWRQPTGCEJKPIVJGUGVXCNWG #FLWUVCDNGKPENKPCVKQPCPING 6KOGTHWPEVKQP .'&FKURNC[ +PHTCTGFTGOQVGEQPVTQN 9CNNOQWPVKPI%GKNKPIOQWPVKPI6TKRQF #EEGUUQTKGU 6GNGUEQRKEVTKRQF IR 1200 S 600 W 9 3WCTV\ |8 |*\ # +2 %'' O OO OO OO MI +45 / / +45 = Standard equipment - = Optional accessories IR 2000 S 9 9 9 3WCTV\ 8 *\ # +2 %''| O OO OO OO MI +45 / / +45 IR 2010 S 9 9 9 %CTDQPKPHTCTGF 8 *\ # +2 %'' O OO OO OO MI +45 / / +45 IR 2570 S 9 9 9 3WCTV\ 8 *\ # +2 %''| O OO OO OO MI +45 / / +45 HEATING IR-S SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg EFFICIENT SELECTIVE HEATING AND NO WARM-UP TIME REQUIRED (QNNQYKPIVJGPCVWTCNRTKPEKRNGQHVJGUWPVJGOQFGTPTCFKCPVJGCVGTUQHVJG +4|UGTKGU+45|UGTKGURTQFWEGFKTGEVYCTOVJXKCKPHTCTGFTCFKCVKQP5GGKPICU VJGUGTCFKCPVJGCVGTUEQPXGTVCITGCVFGCNQHVJGGPGTI[KPRWVKPVQFKTGEVJGCV VJG[CTGRCTVKEWNCTN[GPGTI[GEKGPVCUEQORCTGFVQUC[JQVCKTDNQYGTU6JG FGUKTGFJGCVKURTQFWEGFUGNGEVKXGN[CPFYKVJQWVVJGPGGFHQTRTGJGCVKPIsC ENGCPYC[QHJGCVKPIYKVJQWVECWUKPIPQKUGUUOGNNUQTFWUVEKTEWNCVKQPJGPEG CNUQ UWKVCDNG HQT CNNGTI[ UWGTGTU6JG TCFKCPV JGCVGT RTQXKFGU EQU[ YCTOVJ TKIJVCHVGTUYKVEJQP+4|TCFKCVQTUJGCVWRVJGKTKOOGFKCVGUWTTQWPFKPIUSWKEMN[ CPFGEQPQOKECNN[YJKEJOCMGUVJGOVJGKFGCNJGCVKPIUQNWVKQPHQTVJGVKOG DGVYGGPUGCUQPUQTGNUGCUUVCPFD[JGCVKPIUQNWVKQPRQUUKDNGCRRNKECVKQP CTGCUKPENWFGVJGDCVJTQQOURCCTGCUDCD[EJCPIKPIVCDNGUYQTMDGPEJGU JQDD[TQQOUKPVJGDCUGOGPVEQPUGTXCVQTKGUTQQHGFQXGTVGTTCEGUOCTSWGGU QTJCNNUWPFGTPGCVJRCTCUQNUQTCYPKPIUKPVJGECVGTKPIUGEVQTCPFUQQP IP65 TYPE OF PROTECTION +2V[RGQHRTQVGEVKQP+PHTCTGFTCFKCPVJGCVGTUCTGCXCKNCDNGKPOCP[ FKGTGPVXGTUKQPUHQTKPFQQTCPFQWVFQQTWUG#PKORQTVCPVETKVGTKQP HQTFGXKEGUGNGEVKQPKUYJGVJGTQTPQV[QWTTCFKCPVJGCVGTOC[DGGZ RQUGFVQYCVGTQTRNGPV[QHFWUVCVKVUUKVGQHCUUGODN[QTKPUVCNNCVKQP +HCPKPHTCTGFTCFKCPVJGCVGTKUOQWPVGFKPVJGDCVJTQQOHQTKPUVCPEG KVQRGTCVGUCVJKIJJWOKFKV[NGXGNU /QTGQXGTFGRGPFKPIQPVJGUKVGQHKPUVCNNCVKQPYCVGTLGVUOC[TGCEJ VJGJQWUKPIKPUQOGYC[QTQVJGT#PKPHTCTGFTCFKCPVJGCVGTKPUVCNNGF QP[QWTVGTTCEGUJQWNFDGCDNGVQYKVJUVCPFQEECUKQPCNFQYPRQWTU *GCVGTUWUGFKPVJGYQTMUJQRJQYGXGTUJQWNFDGRTQVGEVGFCICKPUV FWUVVQCEGTVCKPGZVGPV 6JG+2V[RGQHRTQVGEVKQPRTQOKUGUVJCVFWUVECPPQVGPVGTVJGJQWUKPI CPFVJCVVJGTCFKCPVJGCVGTYKNNYKVJUVCPFYCVGT LGVUHTQOCNNUKFGU6JGTQDWUVFGUKIP KUUWKVCDNGHQTDQVJKPUVCNNCVKQPQP DCNEQPKGU QT VGTTCEGU CPF WUG FWTKPIYKPVGTURQTVUGXGPVU1Y KPIVQVJGKTFWUVRTQVGEVKQPVJGUG TCFKCPVJGCVGTUECPCNUQDGWUGF KPKPFWUVTKCNDWKNFKPIUYKVJJKIJ FWUVEQPEGPVTCVKQPU Ventilation Cleaning Accessories HEATING IR-S SERIES / IR SERIES HEATING Radiant heaters with a heating capacity up to 2,200 W IR 205010 Infrared heat without preheating 1 heating level, up to 2,000 watts High-quality low-glare short-wave infrared tube approx. 6,000 operating hours with a light reduction of 80 % Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers IP65 type of protection water-jet-proof professional device, rainproof from all directions Robust aluminium housing Adjustable inclination angle with a wide effective range Suitable for mounting on walls and ceilings Integrated suspension device Energy-efficient IR 3205005 Infrared heat without preheating 4 heating levels, up to 2,000 watts High-quality carbon infrared tube approx. 10,000 operating hours with a light reduction of 80 % Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Timer function IP55 type of protection water-jet-proof professional device, rainproof from all directions LED display Robust aluminium housing Adjustable inclination angle with a wide effective range For mounting on walls and ceilings or on the telescopic tripod Integrated suspension device IR remote control Energy-efficient IR 2050 Infrared heat without preheating 3 heating levels, up to 2,000 watts High-quality low-glare short-wave infrared UVCFBQQSPY PQFSBUJOHIPVSTXJUIB light reduction of 80 % Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers *1UZQFPGQSPUFDUJPO water-jet-proof professional device, rainproof from all directions Robust aluminium housing Adjustable inclination angle with a wide effective range Can be used in open outdoor areas IR remote control Suitable for wall mounting Energy-efficient HEATING IR SERIES IR 3220050 Infrared heat without preheating 2 heating levels, up to 2,200 watts 2 high-quality low-glare short-wave infrared tube approx. 6,000 operating hours with a light reduction of 80 % Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers LED display Robust aluminium housing Adjustable inclination angle with a wide effective range Suitable for mounting on walls and ceilings Integrated suspension device IR remote control Energy-efficient Constantly updated: www.trotec.com/catalogs Radiant heaters with a heating capacity up to 3,000 W Trotec Humidification Dehumidification SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg IR 2400 Infrared heat without preheating 2 heating levels, up to 2,400 watts 2 high-quality halogen infrared tubes Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers IP55 type of protection water-jet-proof professional device, rainproof from all directions Robust aluminium housing Adjustable inclination angle with a wide effective range Suitable for wall mounting Integrated suspension device IR remote control Energy-efficient IR 3050 Infrared heat without preheating 3 heating levels, up to 3,000 watts 2 high-quality low-glare short-wave infrared tube approx. 6,000 operating hours with a light reduction of 80 % Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers *1UZQFPGQSPUFDUJPO water-jet-proof professional device, rainproof from all directions Robust aluminium housing Adjustable inclination angle Can be used in open outdoor areas IR remote control Suitable for wall mounting Energy-efficient LOW-GLARE SHORT-WAVE TECHNOLOGY 100 % WARMTH WITH 80 % LIGHT REDUCTION! 'PLQ[VJGUQQVJKPIYCTOVJKPCRNGCUCPVECPFNGNKIJVCVOQURJGTGYKVJ TGFWEGF NKIJV GOKUUKQP 6JG YGCVJGTRTQQH NQYINCTG TCFKCPV JGCVGTU ECPJGCVQWVFQQTCTGCUHQTRTKXCVGQTEQOOGTEKCNRWTRQUGUYKVJCJKIJ NGXGNQHGEKGPE[CPFEQUVGGEVKXGPGUU+PFQKPIUQVJG[JCTFN[KPW GPEGVJGGZKUVKPINKIJVKPIEQPEGRV .QYINCTGUJQTVYCXGURTQFWEGCNCTIGTRQTVKQPQHKPHTCTGFNKIJVKPVJG KPXKUKDNGTCPIG6JGKPHTCTGFTCFKCVKQPKUHWTVJGTEQNNKOCVGFD[CPKPPQ XCVKXG EQCVKPI RTQEGFWTG VJCV TGFWEGU VJG UECVVGTKPI NQUU 6JCPMU VQ VJKUVGEJPQNQI[6TQVGETCFKCPVJGCVGTUCEJKGXGCNKIJVTGFWEVKQPQHWR VQ|YJKNUVNCUVKPIWRVQ|QRGTCVKPIJQWTU6JGFKUVTCEVKPITGF NKIJVKUUWDUVCPVKCNN[TGFWEGF6JGTGHQTGNQYINCTGTCFKCPVJGCVGTUCTG VJGRGTHGEVEJQKEGHQTVJQUGYJQRTGHGTVJGFCTM$GPGVHTQOQWTPGY KPPQXCVKXG NQYINCTG UJQTVYCXG VGEJPQNQI[ CPF KPFWNIG KP VJG EQU[ YCTOVJYKVJQWVDGKPIGZRQUGFVQVJGFKUVWTDKPINKIJV HEATING IR SERIES Ventilation Cleaning Accessories BEHEIZUNG Radiant heaters with a heating capacity up to 3,000 W Overview: Radiant heaters of the IR with a heating capacity of up to 3,000 W Technical data #TVKENGPWODGT *GCVKPIECRCEKV[ *GCVKPIGNGOGPV 5VCIG 5VCIG 5VCIG 5VCIG +PRWVXQNVCIG 0QOKPCNEWTTGPVEQPUWORVKQP +2V[RGQHRTQVGEVKQP 'NGEVTKEEQPPGEVKQP 2NWIV[RG %CDNGNGPIVJ .GPIVJ 9KFVJ *GKIJV H W L 9GKIJV 'SWKROGPVCPFHWPEVKQPU *GCVKPINGXGNU 5VGRNGUUN[CFLWUVCDNGVJGTOQUVCV #FLWUVCDNGOWNVKUVCIGVJGTOQUVCV 1RGTCVKPIEQPVTQNNCOR #WVQOCVKEUYKVEJQHHWRQPTGCEJKPIVJGUGVXCNWG #FLWUVCDNGKPENKPCVKQPCPING 6KOGTHWPEVKQP .'&FKURNC[ +PHTCTGFTGOQVGEQPVTQN 9CNNOQWPVKPI%GKNKPIOQWPVKPI6TKRQF #EEGUUQTKGU 6GNGUEQRKEVTKRQF IR 2001 9 *CNQIGP 8 *\ # +2 %'' O OO OO OO MI +4 1 / / +4 IR 2005 9 9 9 9 %CTDQP KPHTCTGF 8 *\ # +2 %'' O OO OO OO MI +4 4 / / +4 IR 2050 9 9 9 *CNQIGP 8 *\ # +2 %'' O OO OO OO MI +4 / / +4 IR 2200 9 9 *CNQIGP 8 *\ # +2: %'' O OO OO OO MI +4 / / +4 IR 2400 9 9 *CNQIGP 8 *\ # +2 %'' O OO OO OO MI +4 / / +4 IR 3050 9 9 9 *CNQIGP 8 *\ # +2 %'' O OO OO OO MI +4 / / +4 = Standard equipment - = Optional accessories HEATING IR SERIES Constantly updated: www.trotec.com/catalogs HEATING IR SERIES Accessories Cleaning Ventilation Air cooling Air conditioning BHeheeaitzinungg Air cleaning SecoSan Humidification Dehumidification Trotec HEATING INFRARED RADIANT HEATERS OF THE IRD SERIES CONTEMPORARY HEATING WITHOUT THE BYPRODUCT OF LIGHT Direct heat supplied in style +4& +4& HEATING IRD SERIES +4& +4& Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification SecoSan Air cleaning CHARACTERISTICS OF AN INFRARED RADIANT HEATER +PHTCTGFTCFKCPVJGCVGTUCTGKFGCNN[UWKVGFHQTWUGKPQWVFQQTCTGCUVJCVCTGUJGNVGTGFHTQOVJGYKPFUWEJCUDCNEQPKGUCPFVGTTCEGU#UUWEJVJG[ ECPDGCRRNKGFKPVJGECVGTKPIVTCFGDWVCNUQKPKPVGTKQTURCEGUGIKPKPFQQTUYKOOKPIRQQNUOCTSWGGUEQPUGTXCVQTKGUQTTQQOUVJCVCTGQPN[ WUGFURQTCFKECNN[&WTKPIQRGTCVKQPVJGFGXKEGUGOKVPQXKUKDNGNKIJVRQTVKQP 9JGTGQVJGTFGXKEGUCTGVVGFYKVJCVWDGKPHTCTGFTCFKCPVJGCVGTUEQOGGSWKRRGFYKVJCUVCKPNGUUUVGGNJGCVKPIEQKNGPENQUGFKPCNWOKPKWO /QUVQHVJGTCFKCVKQPGPGTI[GOKVVGFNKGUKPVJGNQPIYCXGKPHTCTGFURGEVTWO+PHTCTGFTCFKCPVJGCVGTUCTGVJGRTGHGTTGFJGCVKPIOGVJQFYJGPKV KUDGVVGTVQCXQKFVJGGOKUUKQPQHNKIJV5KPEGPQKNNWOKPCPVUJCXGVQDGTGRNCEGFKPHTCTGFTCFKCPVJGCVGTUFQPQVTGSWKTGOCKPVGPCPEG INCONSPICUOUS YET ELEGANT 6JGKPHTCTGFTCFKCPVJGCVGTUQHVJG+4&|UGTKGUCVVCKPRGTHGEVKQPKPVGTOU QHDQVJVGEJPQNQI[CPFFGUKIP&WGVQKPPQXCVKXGKPHTCTGFVGEJPQNQI[ CPFCPQFK\GFCNWOKPKWOVJGKPFKXKFWCNOQFGNUCTGRGTHGEVN[UWKVGFHQT WUGKPVJGECVGTKPIVTCFGQTKPCUQRJKUVKECVGFRTKXCVGCODKGPEG9KVJ VJGKT WPQDVTWUKXG NQYMG[ CPF [GV UQRJKUVKECVGF FGUKIP VJG KPHTCTGF TCFKCPVJGCVGTUVKPUGCONGUUN[YKVJCNOQUVCP[GPXKTQPOGPVCPFUV[NG 6JGFGXKEGUnFKUVKPIWKUJKPIFGUKIPHGCVWTGKUVJGKTOCTMGFWPRTGVGP VKQWUOKPKOCNKUVKEGNGICPEG6JGGNQPICVGFUJCRGKUDQVJUOCTVCPF UKORNGEQPUGSWGPVN[VJGTCFKCPVJGCVGTECPDGOQWPVGFVQGKVJGTYCNN QT EGKNKPI YKVJQWV CVVTCEVKPI WPUGGON[ CVVGPVKQP 6JKU KU HQT VJG OQUV RCTVGPUWTGFD[VJGDNCEMUWTHCEGCPFCNWOKPKWOEQNQWTGFUKFGRCPGNU QHVJGTCFKCPVJGCVGT6JGUWTHCEGUCTGFQPGGPVKTGN[KPOCVVDNCEMCPF CNWOKPKWOITG[ The advantages: 6JGKTKPEQPURKEWQWUGNGICPVFGUKIPTGPFGTUKPHTCTGFTCFKCPVJGCVGTUXKTVWCNN[KPXKUKDNG *KIJSWCNKV[OCVGTKCNUCTGEQODKPGFYKVJGZEGNNGPVYQTMOCPUJKRVQRTQFWEGUWEJCPCRRGCNKPIUQNWVKQPHQTCTEJKVGEVWTCNN[UQRJKUVKECVGF KPVGTKQTURCEGUCPFYKPFRTQVGEVGFQWVFQQTCTGCU 0QFKUVWTDKPIPQKUGUQTFKUVTCEVKPITGFNKIJV 7PKXGTUCNN[CRRNKECDNG UWKVCDNGHQTQWVFQQTKPUVCNNCVKQPQPVGTTCEGUDCNEQPKGUCPFTQQHGFQWVFQQTCTGCU %QPUKFGTCDNGEQUVTGFWEVKQPFWGVQ\GTQOCKPVGPCPEGUGGKPICUPQKNNWOKPCPVPGGFUVQDGTGRNCEGF IP55 TYPE OF PROTECTION +PHTCTGFTCFKCPVJGCVGTUCTGCXCKNCDNGKPOCP[FKGTGPVXGTUKQPUHQTKPFQQTCPFQWVFQQTWUG#PKORQTVCPVETKVGTKQPHQTFGXKEGUGNGEVKQPKUYJGVJGT QTPQV[QWTTCFKCPVJGCVGTOC[DGGZRQUGFVQYCVGTQTRNGPV[QHFWUVCVKVUUKVGQHCUUGODN[QTKPUVCNNCVKQP+HCPKPHTCTGFTCFKCPVJGCVGTKUOQWPVGF KPVJGDCVJTQQOHQTKPUVCPEGKVQRGTCVGUCVJKIJJWOKFKV[NGXGNU/QTGQXGTFGRGPFKPIQPVJGUKVGQHKPUVCNNCVKQPYCVGTLGVUOC[TGCEJVJGJQWUKPI KPUQOGYC[QTQVJGT#PKPHTCTGFTCFKCPVJGCVGTKPUVCNNGFQP[QWTVGTTCEGUJQWNFDGCDNGVQYKVJUVCPFQEECUKQPCNFQYPRQWTU*GCVGTUWUGFKPVJG YQTMUJQRJQYGXGTUJQWNFDGRTQVGEVGFCICKPUVFWUVVQCEGTVCKPGZVGPV 6JG+2V[RGQHRTQVGEVKQPRTQOKUGUVJCVFWUVECPPQVUGVVNGYKVJKPVJGJQWUKPICPFVJCVVJGTCFKCPVJGCVGTECPYKVJUVCPFYCVGTLGVUHTQOCNNUKFGU 6JGTQDWUVFGUKIPRGTOKVUDQVJVJGKPUVCNNCVKQPQPDCNEQPKGUQTVGTTCEGUCPFVJGWUGCVYKPVGTURQTVUGXGPVU1YKPIVQVJGKTFWUVRTQVGEVKQPVJGUG TCFKCPVJGCVGTUECPCNUQDGWUGFKPKPFWUVTKCNDWKNFKPIU Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING IRD SERIES HEATING Infrared radiant heaters with a heating capacity of up to 3,200 W IRD 1200 Appealing solution for architecturally sophisticated interior spaces and wind-protected outdoor areas 3 heating levels, up to 1,200 watts IR-B and IR-C provide cosy warmth without light emission Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash- and water-jet-proof, protection type IP55 Aluminium design housing 24-hour timer LED display Adjustable inclination angle with a wide effective range Suitable for mounting on walls and ceilings Infrared remote control Wall and ceiling holder included IRD 1800 Appealing solution for architecturally sophisticated interior spaces and wind-protected outdoor areas 3 heating levels, up to 1,800 watts IR-B and IR-C provide cosy warmth without light emission Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash- and water-jet-proof, protection type IP55 Aluminium design housing 24-hour timer LED display Adjustable inclination angle with a wide effective range Suitable for mounting on walls and ceilings Infrared remote control Wall and ceiling holder included IRD 2400 Appealing solution for architecturally sophisticated interior spaces and wind-protected outdoor areas 3 heating levels, up to 1,400 watts IR-B and IR-C provide cosy warmth without light emission Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash- and water-jet-proof, protection type IP55 Aluminium design housing 24-hour timer LED display Adjustable inclination angle with a wide effective range Suitable for mounting on walls and ceilings Infrared remote control Wall and ceiling holder included HEATING IRD SERIES IRD 3200 Appealing solution for architecturally sophisticated interior spaces and wind-protected outdoor areas 3 heating levels, up to 3,200 watts IR-B and IR-C provide cosy warmth without light emission Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash- and water-jet-proof, protection type IP55 Aluminium design housing 24-hour timer LED display Adjustable inclination angle with a wide effective range Suitable for mounting on walls and ceilings Infrared remote control Wall and ceiling holder included Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Infrared radiant heaters with a heating capacity of up to 3,200 W Overview: Infrared radiant heaters of the IRD series with a heating capacity of up to 3,200 W Technical data #TVKENGPWODGT *GCVKPIECRCEKV[ *GCVKPIGNGOGPV 5VCIG 5VCIG 5VCIG +PRWVXQNVCIG 0QOKPCNEWTTGPVEQPUWORVKQP +2V[RGQHRTQVGEVKQP 'NGEVTKEEQPPGEVKQP 2NWIV[RG %CDNGNGPIVJ .GPIVJ 9KFVJ *GKIJV H W L 9GKIJV 'SWKROGPVCPFHWPEVKQPU *GCVKPINGXGNU 5VGRNGUUN[CFLWUVCDNGVJGTOQUVCV 1RGTCVKPIEQPVTQNNCOR #WVQOCVKEUYKVEJQHHWRQPTGCEJKPIVJGUGVXCNWG #FLWUVCDNGKPENKPCVKQPCPING 6KOGTHWPEVKQP .'&FKURNC[ +PHTCTGFTGOQVGEQPVTQN 9CNNOQWPVKPI%GKNKPIOQWPVKPI6TKRQF IRD 1200 400 W 9 9 5VCKPNGUUUVGGN JGCVKPIGNGOGPV 8 *\ # +2 %'' O OO OO OO MI +4& / / IRD 1800 600 W 9 9 5VCKPNGUUUVGGN JGCVKPIGNGOGPV 8 *\ # +2 %'' O OO OO OO MI +4& / / IRD 2400 9 9 9 5VCKPNGUUUVGGN JGCVKPIGNGOGPV 8 *\ # +2 %'' O OO OO OO MI +4& / / IRD 3200 9 9 9 5VCKPNGUUUVGGN JGCVKPIGNGOGPV 8 *\ # +2 %'' O OO OO OO MI +4& / / SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING IRD SERIES HEATING Design radiant ceiling heater with a heating capacity up to 2,000 W IR 1500 SC Infrared heat without preheating 3 heating levels, up to 1,500 watts High-quality carbon infrared tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers IR remote control Splash-proof, protection type IP34 Operating control lamp Energy-efficient IR 1510 SC Infrared heat without preheating 3 heating levels, up to 1,500 watts High-quality halogen tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers IR remote control Splash-proof, protection type IP34 Operating control lamp Energy-efficient IR 1550 SC Infrared heat without preheating 3 heating levels, up to 1,500 watts High-quality halogen tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers LED illumination timer function (1-24 hours) LED display IR remote control Splash-proof, protection type IP24 Operating control lamp Energy-efficient 60 HEATING IR-SC SERIES IR 2000 SC Infrared heat without preheating 3 heating levels, up to 2,000 watts High-quality halogen tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers IR remote control Splash-proof, protection type IP34 Operating control lamp Energy-efficient Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Design radiant ceiling heater with a heating capacity up to 2,000 W IR 2000 C Infrared heat without preheating 2 heating levels, up to 2,000 watts High-quality halogen tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers LED illumination Touchscreen control panel Robust aluminium housing IR remote control Splash- and water-jet-proof, protection type IP55 Energy-efficient IR 2005 SC Infrared heat without preheating 3 heating levels, up to 2,000 watts High-quality halogen tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Robust aluminium housing Simple operation Maximum safety thanks to tilt protection Splash-proof, protection type IP34 Space-saving when not in use, the three foldable arms of the radiator allow for compact storage Energy-efficient SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning IR 2010 SC Infrared heat without preheating 1 heating level, 2,000 watts High-quality halogen tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers LED illumination Touchscreen control panel Robust aluminium housing IR remote control Splash- and water-jet-proof, protection type IP45 Operating control lamp Energy-efficient HEATING IR-SC SERIES 61 Accessories HEATING Design radiant ceiling heater with a heating capacity up to 2,000 W Overview: Radiant ceiling heaters of the IR-SC series with a heating capacity of up to 2,000 W Technical data Article number Heating capacity Heating element Stage 1 Stage 2 Stage 3 Input voltage Nominal current consumption IP type of protection Electric connection Plug type Cable length Length H Width Height L W Weight Equipment and functions Heating levels Steplessly adjustable thermostat Adjustable multi-stage thermostat Operating control lamp Automatic switch-off upon reaching the set value Timer function LED display LED lighting Infrared remote control Wall mounting / ceiling mounting / tripod IR 1500 SC 1.410.003.810 500 W 1,000 W 1,500 W Carbon fibre tube 220 - 240 V/ 50 - 60 Hz 6.5 A IP34 CEE 7/7 1.8 m 420 mm 420 mm 240 mm 1.5 kg IR 1500 SC 3 / / IR 1510 SC 1.410.003.811 500 W 1,000 W 1,500 W Halogen tube 220 - 240 V/ 50 - 60 Hz 6.5 A IP34 CEE 7/7 1.85 m 425 mm 425 mm 300 mm 2.5 kg IR 1510 SC 3 / / IR 1550 SC 1.410.003.812 600 W 900 W 1,500 W Halogen tube 220 - 240 V/ 50 - 60 Hz 6.5 A IP24 CEE 7/7 1.7 m 450 mm 450 mm 140 mm 2.5 kg IR 1550 SC 3 / / IR 2000 SC 1.410.003.820 650 W 1,350 W 2,000 W Halogen tube 220 - 240 V/ 50 - 60 Hz 8.7 A IP34 CEE 7/7 1.85 m 605 mm 605 mm 300 mm 3 kg IR 2000 SC 3 / / 62 HEATING IR-SC SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Design radiant ceiling heater with a heating capacity up to 2,000 W Overview: Radiant ceiling heaters of the IR-SC series with a heating capacity of up to 2,000 W Technical data Article number Heating capacity Heating element Input voltage Nominal current consumption IP type of protection Electric connection Length Width Height Weight Equipment and functions Heating levels Steplessly adjustable thermostat Adjustable multi-stage thermostat Operating control lamp Automatic switch-off upon reaching the set value Timer function LED display LED lighting Infrared remote control Wall mounting / Ceiling mounting / Parasol stand Stage 1 Stage 2 Stage 3 Plug type Cable length H L W IR 2000 C 1.410.003.205 1,000 W 2,000 W Halogen tube 220 - 240 V/ 50 - 60 Hz 8.6 A IP55 CEE 7/7 1.75 m 385 mm 690 mm 110 mm 5 kg IR 2000 C 2 / / IR 2005 SC 1.410.003.825 700 W 1,300 W 2,000 W Halogen tube 220 - 240 V/ 50 Hz 8.6 A IP34 CEE 7/7 1.8 m 900 mm 900 mm 100 mm 3.5 kg IR 2005 SC 3 / / IR 2010 SC 1.410.003.827 2,000 W Halogen tube 220 - 240 V/ 50 Hz 8.6 A IP45 CEE 7/7 1.8 m 460 mm 460 mm 100 mm 3 kg IR 2010 SC 1 / / SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING IR-SC SERIES 63 HEATING Pedestal radiant heaters with a heating capacity up to 2,000 W IRS 1200 E Infrared heat without preheating Heating capacity 1,200 watts High-quality carbon infrared tube approx. 5,500 operating hours with a light reduction of 80 % Even, 360° all-round heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Simple operation Aluminium design housing Protective grid with velour coating Splash- and water-jet-proof, protection type IP55 Maximum safety thanks to tilt protection Carrying handle for easy transport Space-saving pillar design with round base Fits underneath the table perfectly Energy-efficient IRS 1500 E Infrared heat without preheating Heating capacity 1,500 watts High-quality low-glare short-wave infrared tube approx. 5,000 operating hours with a light reduction of 80 % Even, all-round heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers LED element with 16 colours and 4 light effects LED element dimmable in 8 levels LED illumination and infrared tube can be used independently IR remote control for LED illumination Splash- and water-jet-proof, protection type IP55 Aluminium design housing Tilt protection switch integrated in the device Space-saving pillar design with round base Energy-efficient IRS 2000 E Infrared heat without preheating 3 heating levels, up to 2,000 watts High-quality carbon infrared tube approx. 5,500 operating hours with a light reduction of 80 % Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers 24-hour timer LED display Infrared remote control Splash-proof, protection type IP34 Robust aluminium housing Operating control lamp Tilt protection switch integrated in the device Space-saving pillar design with round base Energy-efficient 64 HEATING IRS-E SERIES IRS 2010 E Infrared heat without preheating 2 heating levels, up to 2,000 watts High-quality carbon infrared tube approx. 10,000 operating hours with a light reduction of 80 % Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Timer function Simple operation LED display IR remote control Splash-proof, protection type IP44 Robust aluminium housing Maximum safety thanks to tilt protection Carrying handle for easy transport Space-saving pillar design with rectangular base Energy-efficient Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Pedestal radiant heaters with a heating capacity up to 2,000 W IRS 2050 E Infrared heat without preheating 9 heating levels, up to 2,000 watts High-quality carbon infrared tube approx. 5,500 operating hours Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers 24-hour timer LED display 45° oscillation with switch-off function IR remote control Splash- and water-jet-proof, protection type IP25 Robust aluminium housing Operating control lamp Tilt protection switch integrated in the device Space-saving pillar design with round base Energy-efficient SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING IRS-E SERIES 65 HEATING Pedestal radiant heaters with a heating capacity up to 2,100 W IRS 2005 Infrared heat without preheating 3 heating levels, up to 2,000 watts High-quality halogen infrared tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash-proof, protection type IP34 Robust tube made of stainless steel Tilt protection switch integrated in the device Space-saving when not in use, the three collapsible radiator arms compact storage Can be used as a pedestal heater or parasol heater Energy-efficient IRS 2010 Infrared heat without preheating 2 heating levels, up to 2,000 watts High-quality halogen infrared tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers LED illumination Touchscreen control panel IR remote control Splash- and water-jet-proof, protection type IP55 Steplessly adjustable in height between 180 and 220 cm Robust telescopic rod made of stainless steel Tilt protection switch integrated in the device Energy-efficient IRS 2020 Infrared heat without preheating 2 heating levels, up to 2,000 watts High-quality halogen infrared tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash-proof, protection type IP34 Steplessly adjustable in height between 194 and 209 cm Robust telescopic rod made of stainless steel Tilt protection switch integrated in the device Energy-efficient 66 HEATING IRS SERIES IRS 2110 Infrared heat without preheating 3 heating levels, up to 2,100 watts High-quality halogen infrared tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Timer function LED illumination Touchscreen control panel LED display IR remote control Splash- and water-jet-proof, protection type IP45 Steplessly adjustable in height between 190 and 220 cm Robust aluminium housing Tilt protection switch integrated in the device Energy-efficient Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Pedestal radiant heaters with a heating capacity up to 3,000 W 1111231726 1111231726 IRS 2520 Infrared heat without preheating 2 heating levels, up to 2,500 watts High-quality halogen infrared tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash-proof, protection type IP34 Robust telescopic rod made of stainless steel Tilt protection switch integrated in the device Energy-efficient IRS 3020 Infrared heat without preheating 2 heating levels, up to 3,000 watts High-quality halogen infrared tube Even and targeted heat distribution Clean, non-condensing, odourless and free from noise No dust circulation, thus suitable for allergy sufferers Splash-proof, protection type IP34 Robust telescopic rod made of stainless steel Tilt protection switch integrated in the device Energy-efficient SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING IRS SERIES 67 HEATING Pedestal radiant heaters with a heating capacity up to 2,000 W Overview: Pedestal radiant heaters of the IRS-E series with a heating capacity of up to 2,000 W Technical data Article number Heating capacity Heating element Input voltage Nominal current consumption IP type of protection Electric connection Length Width Height Weight Equipment and functions Heating levels Operating control lamp Timer function LED display Adjustable in height Tilt protection switch Oscillation Infrared remote control Accessories Socket thermostat BN30 Radio-controlled socket thermostat BN35 Stage 1 Stage 2 Stage 3 Plug type Cable length H H L W L W IRS 1200 E 1.410.003.908 1,200 W Carbon fibre tube 220 - 240 V/ 50 - 60 Hz 5.2 A IP55 CEE 7/7 1.8 m 200 mm 200 mm 650 mm 3 kg IRS 1200 E 1 IRS 1200 E 6.100.007.009 6.100.007.008 IRS 1500 E 1.410.003.910 1,500 W Low-glare 220 - 240 V/ 50 - 60 Hz 6.5 A IP55 CEE 7/7 1.8 m 280 mm 280 mm 1,100 mm 5.5 kg IRS 1500 E 1 IRS 1500 E IRS 2000 E 1.410.003.920 650 W 1,350 W 2,000 W Carbon fibre tube 220 - 240 V/ 50 - 60 Hz 8.6 A IP34 CEE 7/7 1.8 m 300 mm 300 mm 1,000 mm 5 kg IRS 2000 E 3 IRS 2000 E IRS 2010 E 1.410.003.919 1,000 W 2,000 W Carbon fibre tube 220 - 240 V/ 50-60 Hz 8.6 A IP44 CEE 7/7 1.95 m 200 mm 270 mm 1,065 mm 6 kg IRS 2010 E 2 IRS 2010 E IRS 2050 E 1.410.003.921 1,000 W 2,000 W Carbon fibre tube 220 - 240 V/ 50 - 60 Hz 8.7 A IP25 CEE 7/7 1.5 m 300 mm 300 mm 1,000 mm 6 kg IRS 2050 E 2 45° IRS 2050 E 68 HEATING IRS-E SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Pedestal radiant heaters with a heating capacity up to 3,000 W Overview: Pedestal radiant heaters of the IRS series with a heating capacity of up to 3,000 W Technical data Article number Heating capacity Heating element Stage 1 Stage 2 Stage 3 Input voltage Nominal current consumption IP type of protection Electric connection Plug type Cable length Length Width H H Height Weight L W L W Equipment and functions Heating levels Operating control lamp Timer function LED display Adjustable in height Tilt protection switch Oscillation Infrared remote control Accessories Socket thermostat BN30 Radio-controlled socket thermostat BN35 IRS 2005 1.410.003.922 700 W 1,300 W 2,000 W Halogen tube 220 - 240 V/ 50 Hz 8.6 A IP34 CEE 7/7 1.8 m 900 mm 900 mm 2,100 mm 14 kg IRS 2005 3 IRS 2005 6.100.007.009 6.100.007.008 IRS 2010 1.410.003.925 1,000 W 2,000 W Halogen tube 220 - 240 V/ 50 - 60 Hz 8.6 A IP55 CEE 7/7 1.75 m 385 mm 690 mm 2,200 mm 20 kg IRS 2010 2 IRS 2010 IRS 2020 1.410.003.930 1,000 W 2,000 W Halogen tube 220 - 240 V/ 50 - 60 Hz 8.7 A IP34 CEE 7/7 1.75 m 590 mm 590 mm 2,090 mm 11.5 kg IRS 2020 2 IRS 2020 6.100.007.009 6.100.007.008 IRS 2110 1.410.003.931 800 W 1,300 W 2,100 W Halogen tube 220 - 240 V/ 50 Hz 9.1 A IP45 CEE 7/7 1.8 m 520 mm 520 mm 2,200 mm 19 kg IRS 2110 3 IRS 2110 IRS 2520 1.410.003.932 1,250 W 2,500 W Halogen tube 220 - 240 V/ 50 Hz 8.7 A IP34 CEE 7/7 1.75 m 590 mm 590 mm 1,880 mm 11.5 kg IRS 2520 2 IRS 2520 6.100.007.009 6.100.007.008 IRS 3020 1.410.003.933 1,500 W 3,000 W Halogen tube 220 - 240 V/ 50 - 60 Hz 8.7 A IP34 CEE 7/7 1.75 m 590 mm 590 mm 1,900 mm 11.5 kg IRS 3020 2 IRS 3020 6.100.007.009 6.100.007.008 SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING IRS SERIES 69 HEATING FAN HEATERS OF THE TFH-E SERIES FOR QUICK WARM-UP HOT& COOL TFH 22 E 70 HEATING TFH-E SERIES HOT& COOL TFH 20 E HOT& COOL TFH 19 E Constantly updated: www.trotec.com/catalogs HOT& COOL TFH 2000 E FAN HEATER WITH TURBO SPIN TECHNOLOGY Thanks to patented mechanics, this fan heater sucks in the room air in one direction; the air is then expanded in a forward spin by means QHGURGEKCNN[UJCRGFCZKCNKORGNNGTUCPFUWDUGSWGPVN[GOKVVGFVJTQWIJQYQRVKOK\GFNQWXTGUCUEQORTGUUGFURKTCNUJCRGFCKTEWTTGPV 6JGVWTDQURKPRTKPEKRNGECPGPUWTGDQVJCEQPUKUVGPVIGPVNGDTGG\GCPFCOGCUWTCDN[JKIJGTCKTQYTCVGCUEQORCTGFVQEQPXGPVKQPCNHCPJGCVGTU 6JGFKUEJCTIGFCKTEWTTGPVKUVJGPFGGEVGFD[VJGYCNNQTEGKNKPIKPCYC[VQETGCVGCENQUGFNQQRVQVJGFGXKEGsGPUWTKPIVJGEKTEWNCVKQPQHVJG entire room air as well as an agreeable room climate with consistent temperatures. HEATING TFH-E SERIES 71 HEATING Fan heaters for quick and effective heat with up to 2,000 W HOT& COOL HOT& COOL TFH 19 E Quick warmth without preheating 2 heating levels (1,000 W / 2,000 W) Fan operation also possible without heating function Steplessly adjustable thermostat Overheating protection 1PTJUJPOJOH PQUJPOT r WFSUJDBM{ IPSJ[POUBM Operation indicator light Easy transport and operation Secure footing Energy-efficient HOT& COOL TFH 20 E Quick warmth without preheating 2 heating levels (1,000 W / 2,000 W) Fan operation also possible without heating function Steplessly adjustable thermostat Overheating protection Tilt protection switch integrated in the device base Operation indicator light Easy transport and operation Secure footing Energy-efficient HOT& COOL TFH 22 E Quick warmth without preheating 2 heating levels (1,000 W / 2,000 W) Fan operation also possible without heating function On-demand 90° oscillation for a faster air distribution Steplessly adjustable thermostat Overheating protection Tilt protection switch integrated in the device base Operation indicator light Easy transport and operation Secure footing Energy-efficient 72 HEATING TFH-E SERIES TFH 2000 E 2-in-1 fan heater and fan 2 heating levels (1,200 W / 2,000 W) 2 cold settings ventilation mode Fan rundown function Optimum heat circulation due to urbospin technology Thermostat-controlled automatic operation with target value preselection between 18 and 30 °C Energy-efficient operation thanks to automatic switch-off upon reaching the set value LED display Overheating protection Tilt protection switch integrated in the device Operation indicator light Particularly silent Secure footing Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Fan heaters for quick and effective heat with up to 2,000 W Overview: Fan heaters of the TFH-E series with a heating capacity of up to 2,000 W Technical data Article number Suitable for rooms sized up to Heating capacity Input voltage Nominal current consumption Electric connection Sound pressure level Length Width Height Weight Equipment and functions Heating levels Fan function Thermostat Operating control lamp Timer function LED display Tilt protection switch Oscillation Overheating protection Automatic switch-off upon reaching the set value Anthracite Brown White Stage 1 Stage 2 Plug type Cable length H H L W L W TFH 19 E 1.410.000.609 24 m² / 60 m³ 1,000 W 2,000 W 220 - 240 V/ 50 - 60 Hz 8.7 A CEE 7/17 1.2 m 48 dB(A) 240 mm 120 mm 255 mm 1 kg TFH 19 E 2 TFH 20 E 1.410.000.610 24 m² / 60 m³ 1,000 W 2,000 W 220 - 240 V/ 50 - 60 Hz 8.7 A CEE 7/17 1.2 m 45 dB(A) 120 mm 210 mm 260 mm 0.8 kg TFH 20 E 2 TFH 22 E 1.410.000.615 24 m² / 60 m³ 1,000 W 2,000 W 220 - 240 V/ 50 - 60 Hz 8.7 A CEE 7/17 1.2 m 50 dB(A) 150 mm 230 mm 300 mm 1 kg TFH 22 E 2 90° TFH 2000 E 1.410.000.630 24 m² / 60 m³ 1,200 W 2,000 W 220 - 240 V/ 50 Hz 8.7 A CEE 7/17 1.65 m 53 dB(A) 185 mm 255 mm 250 mm 2 kg TFH 2000 E 2 SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING TFH-E SERIES 73 HEATING FAN HEATERS OF THE TFC-E SERIES COMFORTABLE WARMTH IN THE BLINK OF AN EYE! TFC 1 E TFC 2 E TFC 20 E TFC 220 E TFC 19 E TFC 17 E HOT& COOL TFC 13 E TFC 14 E TFC 25 E HOT& COOL HOT& COOL TFC 21 E TFC 16 E FASTER AIR HEATING MORE AGREEABLE FEEL-GOOD CLIMATE ACHIEVED BY MORE EVEN ROOM TEMPERATURES Compared to the conventional JGCVKPI EQKN VGEJPQNQI[| $ VJG shorter heat-up times are not the °C only distinguishing feature of Tro- CERAMIC HEATER t A VGEHCPJGCVGTUYKVJ26%|EGTCOKE JGCVKPI GNGOGPVU| # 6JGTG CTG also substantial process-related FKGTGPEGUKPVJGTGURQPUGDGJCXKQWTQHVJGJGCVKPIGNGOGPVU#NVJQWIJ both devices maintain the preselected target temperature (orange) in a similar manner by means of thermostat control, the respective VGORGTCVWTG CFCRVCVKQP VCMGU RNCEG CV C UKIPKECPVN[ TGFWEGF URGGF and with greater deviations from the desired target temperature in ECUGQHFGXKEGUYKVJJGCVKPIYKTGU6JGTGCUQPHQTVJKUKUVJGFKGTGPV EQPFWEVKXKV[DGJCXKQWTQHVJGJGCVKPIGNGOGPVUKHEWTTGPVQYUVJTQWIJ the heating coils or wires, they will always retain the same temperature once they have heated up. For controlling the desired room temperature, VJGRQYGTUWRRN[KUTUVKPVGTTWRV ed, causing the coil/wire to cool down, and then re-activated by °C the thermostat so that the coil/ ELECTRIC HEATER t B wire heats up again completely DGHQTGKVKUUYKVEJGFDCEMQWRQP reaching the set target tempera- VWTG6JKUpQPQRTQEGUUqECWUGUITGCVGTVGORGTCVWTGWEVWCVKQPUVJCP with ceramic heating elements, for the material of the latter provides an integrated temperature self-regulation. The hotter PTCs get, the higher KU VJGKT GNGEVTKECN TGUKUVKXKV[ TGUWNVKPI KP NGUU EWTTGPV QYKPI VJTQWIJ the heating element and in a reduced heating capacity, and thus in UKIPKECPVN[ NQYGT VGORGTCVWTG WEVWCVKQPU CPF NGUU UYKVEJQP CPF UYKVEJQRTQEGUUGUKPVJGTOQUVCVEQPVTQNNGFQRGTCVKQP(QTVJKUTGCUQP ceramic fan heaters are able to create more even room temperatures for a pleasant working climate. 74 HEATING TFC-E SERIES Constantly updated: www.trotec.com/catalogs Ceramic fan heaters for quick and effective heat with up to 2,000 W HOT& COOL Trotec Humidification Dehumidification SecoSan Air cleaning TFC 1 E / TFC 2 E nSilent and compact ceramic fan heater nPTC ceramic heating element n Economical 500 W n2 fan settings nThermostat-controlled automatic operation with target value preselection between 15 and 30 °C n Timer function nEnergy-efficient operation thanks to automatic switch-off upon reaching the set value nLED display nOverheating protection nOperation indicator light nSimple plug-in design perfect for use while you are on the move nEnergy-efficient HOT& COOL TFC 13 E / TFC 14 E nSilent and compact ceramic fan heater nPTC ceramic heating element n2 heating levels (700 W / 1,400 W) nFan operation also possible without heating function nSteplessly adjustable thermostat nOverheating protection nTilt protection switch integrated in the device base nOperation indicator light nEasy transport and operation nSecure footing nEnergy-efficient Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning TFC 16 E nSilent and compact ceramic fan heater nPTC ceramic heating element n2 heating levels (1,200 W/2,000 W) nFan operation also possible without heating function nSteplessly adjustable thermostat nOverheating protection nTilt protection switch integrated in the device base nOperation indicator light nEasy transport and operation nSecure footing nEnergy-efficient HEATING TFC-E SERIES 75 Accessories HEATING Ceramic fan heaters for quick and effective heat with up to 2,000 W TFC 17 E Silent and compact ceramic fan heater PTC ceramic heating element 2 heating levels (1,200 W / 2,000 W) On-demand 60° oscillation for a faster air distribution Steplessly adjustable thermostat Overheating protection Tilt protection switch integrated in the device base Operation indicator light Easy transport and operation Secure footing Energy-efficient TFC 19 E Silent and compact ceramic fan heater PTC ceramic heating element 2 heating levels (1,200 W / 2,000 W) On-demand 70° oscillation for a faster air distribution Steplessly adjustable thermostat Overheating protection Tilt protection switch integrated in the device Operation indicator light Easy transport and operation Secure footing Energy-efficient TFC 20 E Silent and compact ceramic fan heater PTC ceramic heating element 2 heating levels (1,000 W / 2,000 W) On-demand 80° oscillation for a faster air distribution Steplessly adjustable thermostat Overheating protection Tilt protection switch integrated in the device Operation indicator light Easy transport and operation Secure footing Energy-efficient 76 HEATING TFC-E SERIES TFC 21 E Silent and compact ceramic fan heater 2 heating levels (1,300 W / 2,000 W) Thermostat-controlled automatic operation with target value preselection between 15 and 35 °C Display of the preselected room temperature or the set timer Switchable 80° oscillation for faster air distribution Timer function Energy-efficient operation thanks to auto- matic switch-off upon reaching the set value Anti-tilt switch integrated in the unit Memory function Fan run-on function Frost monitor function Overheating protection IR remote control Intuitive control panel with LED display lighting can be switched off Easy to transport and operate Secure footing Constantly updated: www.trotec.com/catalogs Ceramic fan heaters for quick and effective heat with up to 2,500 W HOT& COOL Trotec Humidification Dehumidification SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg TFC 25 E Silent and compact ceramic fan heater 2 heating levels (1,300 W / 2,000 W) and cold air mode Can also be used as a freshening cold air fan Thermostat-controlled automatic operation with target value preselection between 5 and 35 °C Display of the preselected room temperature or the set timer Switchable 80° oscillation for faster air distribution Timer function Energy-efficient operation thanks to automatic switch-off upon reaching the set value Anti-tilt switch integrated in the unit Memory function Fan run-on function Overheating protection IR remote control Intuitive control panel with LED display lighting can be switched off Easy to transport and operate Secure footing TFC 220 E Silent and compact ceramic fan heater 2,200 W heating capacity 2 fan stages Thermostat-controlled automatic operation with target value preselection between 15 and 35 °C Comfort mode, night mode and energy saving mode Current room temperature indication Timer function Energy-efficient operation thanks to automatic switch-off upon reaching the set value Fan rundown function Frost monitor function Overheating protection IR remote control Safety glass with touchscreen and LC display Secure footing QUICK ADDITIONAL HEATING AT A SMALL PRICE #U C OQDKNG JGCV UQWTEG HCP JGCVGTU CTG VJG TUV EJQKEG YJGPGXGT heat must be provided quickly and without delay. Since they supply non-condensing heat without consuming oxygen they are ideally suitGFHQTJGCVKPIKPVGTKQTURCEGU1YKPIVQVJGKTXCTKGV[QHFGUKIPUFKGTent construction, size and heating capacity, mobile fan heaters can be GQTVNGUUN[CFCRVGFVQVJGKPFKXKFWCNQPUKVGEQPFKVKQPURTGUGPVKPNKXKPI spaces and basements. (CPJGCVGTUCTGKFGCNN[UWKVGFHQTVJGGZKDNGCRRNKECVKQPCUVGORQTCT[ or additional heating solution in private living quarters or at the workplace. They are particularly useful in rooms without a permanently installed heating system, e.g. in garages or in hobby rooms that are rarely heated. Moreover, fan heaters are welcome heat sources in guestrooms or guest toilets and also perform well when applied as frost monitor in basements or garages. At any desired location the electrical direct heaters produce an agreeable warmth right after switch-on all it takes is a nearby socket. +PCFFKVKQPVQVJGKTGZKDKNKV[HQTRQUUKDNGCRRNKECVKQPUOQDKNGHCPJGCVers are normally characterized by compact dimensions and a low RTKEG6JG[QGTEQOHQTVHWPEVKQPUHQTPGCTN[GXGT[KPFKXKFWCNTGSWKTGment such as an on-demand oscillation function or a timer function. HEATING TFC-E SERIES 77 Ventilation Cleaning Accessories HEATING Ceramic fan heaters for quick and effective heat with up to 2,000 W Overview: Fan heaters of the TFC-E series with a heating capacity of up to 2,000 W Technical data Article number Suitable for rooms sized up to Heating capacity Input voltage Nominal current consumption IP type of protection Electric connection Sound pressure level Length Width Height Weight Equipment and functions Heating levels Fan function Thermostat Frost monitor function Operating control lamp Timer function LED display Tilt protection switch Oscillation Overheating protection Automatic switch-off upon reaching the set value Current room temperature display LCD display Safety glass with touch screen Infrared remote control Black White Stage 1 Stage 2 Plug type Cable length H H L WL W TFC 1 E / 2 E 1.410.000.641 1.410.000.640 10 m² / 25 m³ 500 W 220 - 240 V/ 50 Hz 2.17 A CEE 7/17 51 dB(A) 110 mm 130 mm 202 mm 0.4 kg TFC 1 E / 2 E 1 TFC 13 E / 14 E 1.410.000.655 1.410.000.656 20 m² / 50 m³ 700 W 1,400 W 220 - 240 V/ 50 Hz 6.1 A IP20 CEE 7/17 1.5 m 48 dB(A) 120 mm 195 mm 255 mm 1 kg TFC 13 E / 14 E 2 TFC 16 E 1.410.000.658 24 m² / 60 m³ 1,200 W 2,000 W 220 - 240 V/ 50 Hz 8.7 A CEE 7/17 1.5 m 60 dB(A) 175 mm 135 mm 228 mm 1.5 kg TFC 16 E 2 TFC 17 E 1.410.000.659 24 m² / 60 m³ 1,200 W 2,000 W 220 - 240 V/ 50 Hz 8.7 A CEE 7/17 1.5 m 57 dB(A) 185 mm 155 mm 262 mm 2 kg TFC 17 E 2 60° TFC 19 E 1.410.000.661 24 m² / 60 m³ 1,200 W 2,000 W 220 - 240 V/ 50 Hz 8.7 A CEE 7/17 1.5 m 54 dB(A) 186 mm 186 mm 440 mm 2 kg TFC 19 E 2 70° 78 HEATING TFC-E SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Ceramic fan heaters for quick and effective heat with up to 2,500 W Overview: Fan heaters of the TFC-E series with a heating capacity of up to 2,500 W Technical data Article number Suitable for rooms sized up to Heating capacity Input voltage Nominal current consumption IP type of protection Electric connection Sound pressure level Length Width Height Weight Equipment and functions Heating levels Fan function Thermostat Frost monitor function Operating control lamp Timer function LED display Tilt protection switch Oscillation Overheating protection Automatic switch-off upon reaching the set value Current room temperature display LCD display Safety glass with touch screen Infrared remote control Black White Stage 1 Stage 2 Plug type Cable length H H L WL W TFC 20 E 1.410.000.670 24 m² / 60 m³ 1,000 W 2,000 W 220 - 240 V/ 50 Hz 8.6 A IP20 CEE 7/17 1.4 m 48 dB(A) 200 mm 200 mm 520 mm 2.5 kg TFC 20 E 2 80° TFC 21 E 1.410.000.671 24 m² / 60 m³ 1,300 W 2,000 W 220 - 240 V/ 50 - 60 Hz 8,7 A CEE 7/17 1.6 m 50 dB(A) 178 mm 230 mm 660 mm 3 kg TFC 21 E 2 80° TFC 25 E 1.410.000.678 30 m² / 75 m³ 1,800 W 2,500 W 220 - 240 V/ 50 - 60 Hz 10,9 A CEE 7/17 1.6 m 50 dB(A) 260 mm 260 mm 800 mm 3,5 kg TFC 25 E 2 80° TFC 220 E 1.410.000.690 26 m² / 65 m³ 2,200 W 230 V/ 50 - 60 Hz 9.6 A CEE 7/17 1.3 m 200 mm 520 mm 400 mm 6 kg TFC 220 E 1 SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING TFC-E SERIES 79 HEATING CONVECTORS OF THE TCH-E SERIES CLEAN HEAT FOR TRANSITION OR ADDITIONAL HEATING Strong heating power, clean heat and odourless in operation! TCH 2010 E TCH 2011 E TCH 23 E TCH 21 E TCH 19 E TCH 18 E TCH 20 E TCH 22 E TCH 1 E TCH 2510 E TCH 1510 E TCH 25 E TCH 2310 E TCH 2311 E 80 HEATING TCH-E SERIES TCH 26 E TCH 2050 E Constantly updated: www.trotec.com/catalogs Convectors with a heating capacity of up to 2,000 W Trotec Humidification Dehumidification SecoSan Air cleaning TCH 1 E Economical heating capacity of 450 W for clean, non-condensing and odourless heat Infinitely variable thermal control Thermostat-controlled automatic operation Frost monitor function Energy-efficient operation thanks to automatic switch-off upon reaching the set value Particularly easy handling Overheating protection Noiseless heating TCH 18 E Heating capacity of up to 2,000 W for clean, non-condensing and odourless heat 3 heating levels (750 W / 1,250 W / 2,000 W) Infinitely variable thermal control Thermostat-controlled automatic operation Frost monitor function Energy-efficient operation thanks to automatic switch-off upon reaching the set value Overheating protection Noiseless heating Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning TCH 19 E Heating capacity of up to 2,000 W for clean, non-condensing and odourless heat 3 heating levels (750 W / 1,250 W / 2,000 W) Infinitely variable thermal control Thermostat-controlled automatic operation Frost monitor function Energy-efficient operation thanks to automatic switch-off upon reaching the set value Overheating protection Noiseless heating TCH 20 E Heating capacity of up to 2,000 W for clean, non-condensing and odourless heat 3 heating levels (750 W / 1,250 W / 2,000 W) Infinitely variable thermal control Thermostat-controlled automatic operation Frost monitor function Energy-efficient operation thanks to automatic switch-off upon reaching the set value Overheating protection Noiseless heating HEATING TCH-E SERIES 81 Accessories HEATING Convectors with a heating capacity of up to 2,000 W TCH 21 E Heating capacity of up to 2,000 W for clean, non-condensing and odourless heat 3 heating levels (800 W / 1,200 W / 2,000 W) Infinitely variable thermal control Thermostat-controlled automatic operation Frost monitor function Energy-efficient operation thanks to automatic switch-off upon reaching the set value Overheating protection Noiseless heating TCH 22 E Heating capacity of up to 2,000 W for clean, non-condensing and odourless heat 3 heating levels (750 W / 1,250 W / 2,000 W) On-demand turbo blower for quicker air circulation Infinitely variable thermal control Thermostat-controlled automatic operation Frost monitor function 24-hour timer Energy-efficient operation thanks to automatic switch-off upon reaching the set value Overheating protection Noiseless heating TCH 23 E Heating capacity of up to 2,000 W for clean, non-condensing and odourless heat 2 heating levels (1,000 W / 2,000 W ) On-demand turbo blower for quicker air circulation Infinitely variable thermal control Thermostat-controlled automatic operation Frost monitor function Energy-efficient operation thanks to automatic switch-off upon reaching the set value Overheating protection Noiseless heating 82 HEATING TCH-E SERIES TCH 25 E / TCH 26 E Heating capacity of up to 2,000 W for clean, non-condensing and odourless heat 3 heating levels (750 W / 1,250 W / 2,000 W) On-demand turbo blower for quicker air circulation Infinitely variable thermal control Thermostat-controlled automatic operation Frost monitor function 24-hour timer Energy-efficient operation thanks to automatic switch-off upon reaching the set value Overheating protection Noiseless heating Constantly updated: www.trotec.com/catalogs Convectors with a heating capacity of up to 2,300 W Trotec Humidification Dehumidification SecoSan Air cleaning TCH 1510 E Heating capacity of 1,500 W for clean, noncondensing and odourless heat Thermostat-controlled automatic operation Automatic temperature control Frost monitor function Timer function Weekly timer LCD display Energy saving mode Energy-efficient operation thanks to automatic switch-off upon reaching the set value Maximum security thanks to overheating protection, tilt protection and child lock Noiseless heating TCH 2010 E / TCH 2011 E Heating capacity of up to 2,000 W for clean, non-condensing and odourless heat 2 heating levels (1,000 W / 2,000 W) Infinitely variable thermal control Thermostat-controlled automatic operation with target value preselection between 15 and 35 °C Automatic temperature control Frost monitor function Current room temperature indication Timer function IR remote control Safety glass with touchscreen and LCD display Overheating protection and memory function Easy to transport thanks to integrated castors Parking brake to prevent the device from rolling away inadvertently Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning TCH 2050 E Heating capacity of up to 2,000 W for clean, non-condensing and odourless heat 2 heating levels (1,200 W / 2,000 W) Thermal wave heater with high-quality Mica element Thermostat-controlled automatic operation with target value preselection between 5 and 35 °C Automatic temperature control Current room temperature indication Timer function IR remote control LCD display Energy-efficient operation thanks to automatic switch-off upon reaching the set value Maximum security thanks to overheating and tilt protection Easy to transport thanks to integrated castors Noiseless heating TCH 2310 E / TCH 2311 E Heating capacity of up to 2,300 W for clean, non-condensing and odourless heat 3 heating levels (1,000 W / 1,300 W / 2,300 W) On-demand turbo blower for quicker air circulation Automatic temperature control Frost monitor function Current room temperature indication Timer function Energy-efficient operation thanks to automatic switch-off upon reaching the set value IR remote control LCD display Overheating protection Noiseless heating HEATING TCH-E SERIES 83 Accessories HEATING Convectors with a heating capacity of up to 2,500 W TCH 2510 E Heating capacity of 2,500 W for clean, non-condensing and odourless heat Thermostat-controlled automatic operation Automatic temperature control Frost monitor function Timer function Weekly timer LCD display Energy saving mode Energy-efficient operation thanks to automatic switch-off upon reaching the set value Maximum security thanks to overheating protection, tilt protection and child lock Noiseless heating 84 HEATING TCH-E SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Convectors with a heating capacity of up to 2,000 W Overview: Convectors of the TCH-E series with a heating capacity of up to 2,000 W Technical data Article number Suitable for rooms sized up to Heating capacity Black White Silver Stage 1 Stage 2 Stage 3 Input voltage Nominal current consumption IP type of protection Electric connection Sound level without / with turbo blower Length 1) Width 1) Height 1) Weight Plug type Cable length H L W Equipment and functions Heating levels Thermostat Steplessly adjustable thermostat Frost monitor function Operating control lamp Timer function 24-hour timer Tilt protection switch Overheating protection Automatic switch-off upon reaching the set value Current room temperature display Selectable turbo blower LCD display Safety glass with touch screen Infrared remote control 1) with feet TCH 1 E 1.410.000.501 10 m² / 25 m³ 450 W 220 - 240 V/ 50 Hz 2 A IP20 CEE 7/7 1.4 m / 177 mm 275 mm 276 mm 1 kg TCH 1 E 1 TCH 18 E 1.410.000.508 24 m² / 60 m³ 750 W 1,250 W 2,000 W 220 - 240 V/ 50 - 60 Hz 8.7 A IP20 CEE 7/7 1.2 m / 200 mm 520 mm 345 mm 2 kg TCH 18 E 3 TCH 19 E 1.410.000.509 24 m² / 60 m³ 750 W 1,250 W 2,000 W 220 - 240 V/ 50 - 60 Hz 8.7 A IP20 CEE 7/7 1.2 m / 200 mm 470 mm 332 mm 2 kg TCH 19 E 3 TCH 20 E 1.410.000.510 24 m² / 60 m³ 750 W 1,250 W 2,000 W 230 V/ 50 Hz 8.7 A CEE 7/7 1.2 m / 160 mm 520 mm 390 mm 2 kg TCH 20 E 3 TCH 21 E 1.410.000.511 24 m² / 60 m³ 800 W 1,200 W 2,000 W 220 - 240 V/ 50 Hz 8 A CEE 7/7 1.7 m / 172 mm 530 mm 378 mm 3 kg TCH 21 E 3 TCH 22 E 1.410.000.515 24 m² / 60 m³ 750 W 1,250 W 2,000 W 230 V/ 50 Hz 8.7 A CEE 7/7 1.2 m / 40 dB(A) 160 mm 520 mm 390 mm 2.5 kg TCH 22 E 3 SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING TCH-E SERIES 85 HEATING Convectors with a heating capacity of up to 2,300 W Overview: Convectors of the TCH-E series with a heating capacity of up to 2,300 W Technical data Article number Suitable for rooms sized up to Heating capacity Black White Stage 1 Stage 2 Stage 3 Input voltage Nominal current consumption IP type of protection Electric connection Sound level without / with turbo blower Length 1) Width 1) Height 1) Weight Plug type Cable length H L W Equipment and functions Heating levels Thermostat Steplessly adjustable thermostat Frost monitor function Operating control lamp Timer function 24-hour timer Tilt protection switch Overheating protection Automatic switch-off upon reaching the set value Current room temperature display Selectable turbo blower LCD display Safety glass with touch screen Infrared remote control 1) with feet TCH 23 E 1.410.000.516 24 m² / 60 m³ 1,000 W 2,000 W 220 - 240 V/ 50 Hz 8 A CEE 7/7 1.7 m / 50 dB(A) 172 mm 530 mm 378 mm 3 kg TCH 23 E 2 TCH 25 E / TCH 26 E 1.410.000.521 1.410.000.522 24 m² / 60 m³ 750 W 1,250 W 2,000 W 220 - 240 V/ 50 - 60 Hz 8.7 A CEE 7/7 1.5 m / 46 dB(A) 220 mm 600 mm 380 mm 3.5 kg TCH 25 E / TCH 26 E 3 TCH 1510 E 1.410.000.529 20 m² / 50 m³ 1,500 W 220 - 240 V/ 50 Hz 6.5 A IP24 CEE 7/7 1.8 m / 260 mm 690 mm 480 mm 6 kg TCH 1510 E 1 TCH 2010 E / TCH 2011 E 1.410.000.532 1.410.000.531 24 m² / 60 m³ 1,000 W 2,000 W 220 - 240 V/ 50 - 60 Hz 8.7 A IP24 CEE 7/7 1.5 m / 260 mm 840 mm 490 mm 8 kg TCH 2010 E / TCH 2011 E 2 TCH 2050 E 1.410.000.540 24 m² / 60 m³ 1,200 W 2,000 W 230 V/ 50 - 60 Hz 8.7 A CEE 7/7 1.2 m / 260 mm 640 mm 660 mm 5 kg TCH 2050 E 2 TCH 2310 E / TCH 2311 E 1.410.000.551 1.410.000.550 27 m² / 67 m³ 1,000 W 1,300 W 2,300 W 220 - 240 V/ 50 - 60 Hz 10 A IP20 CEE 7/7 1.5 m / 220 mm 690 mm 435 mm 5 kg TCH 2310 E / TCH 2311 E 3 86 HEATING TCH-E SERIES HIGH-QUALITY THERMAL WAVE HEATER WITH MICA ELEMENT With its 3D heating system, the TCH 2050 E cleverly combines the advantages of a convector and those of an infrared radiator and in this way provides for real all-round warmth within less than one minute. The integrated mica JGCVKPIGNGOGPVUIKXGQKPHTCTGFJGCVTCFKCVKQPVQVJGHTQPVCPFVJGDCEM across the whole surface. The functionality of infrared radiation follows the natural principle of the sun. It does not only heat the air, but the surfaces of the objects at which it is directed. Furthermore, the warm objects emit the heat to the room again, so that the warmth remains even when the thermal YCXG JGCVGT JCU CNTGCF[ DGGP UYKVEJGF Q CICKP 1P VJG UMKP KPHTCTGF radiation creates the pleasant sensation of natural sunlight. Additionally, the hot mica heating elements emit warm air that also rises upwards. This produces a soft air current that distributes the warmth homogenously in the whole room. This principle is referred to as convection. The infrared radiation and the convection heat together form a three-dimensional all-round heating system. For quick feel-good warmth in the whole room! Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Convectors with a heating capacity of up to 2,500 W Overview: Convectors of the TCH-E series with a heating capacity of up to 2,500 W Technical data Article number Suitable for rooms sized up to Heating capacity Black White Stage 1 Stage 2 Stage 3 Input voltage Nominal current consumption IP type of protection Electric connection Sound level without / with turbo blower Length 1) Width 1) Height 1) Weight Plug type Cable length H L W Equipment and functions Heating levels Thermostat Steplessly adjustable thermostat Frost monitor function Operating control lamp Timer function 24-hour timer Tilt protection switch Overheating protection Automatic switch-off upon reaching the set value Current room temperature display Selectable turbo blower LCD display Safety glass with touch screen Infrared remote control 1) with feet TCH 2510 E 1.410.000.560 30 m² / 75 m³ 2,500 W 220 - 240 V/ 50 Hz 10.8 A IP24 CEE 7/7 1.8 m / 280 mm 1,250 mm 480 mm 9.5 kg TCH 2510 E 1 SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING TCH-E SERIES 87 HEATING OIL-FILLED RADIATORS OF THE TRH-E SERIES GREAT HEATING CAPACITY AT LITTLE COST TRH 22 E TRH 23 E TRH 20 E TRH 21 E TRH 28 E TRH 25 E TRH 26 E TRH 27 E 88 HEATING TRH-E SERIES TRH 24 E Constantly updated: www.trotec.com/catalogs Oil-filled radiators with a capacity of up to 2,900 W Trotec Humidification Dehumidification SecoSan Air cleaning TRH 20 E Capacity of up to 2,000 W for quick and cosy warmth Maximum security thanks to overheating and tilt protection 3 heating levels (800 W / 1,200 W / 2,000 W) Operation indicator light Effective 9-fin radiator Practical cable winder for quick organization Short heating time: maximum heat output BGUFSPOMZ{NJOVUFT Integrated castors and carrying handle for safe transport even when hot Heat accumulator with liquid heating medium: prolonged heat radiation even after switch-off Steplessly adjustable thermostat Frost monitor function Noiseless heating TRH 21 E Capacity of up to 2,500 W for quick and cosy warmth Maximum security thanks to overheating and tilt protection 3 heating levels (1,000 W / 1,500 W / 2,500 W) Operation indicator light Effective 11-fin radiator Practical cable winder for quick organization Short heating time: maximum heat output BGUFSPOMZ{NJOVUFT Integrated castors and carrying handle for safe transport even when hot Heat accumulator with liquid heating medium: prolonged heat radiation even after switch-off Steplessly adjustable thermostat Frost monitor function Noiseless heating Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning TRH 22 E Capacity of up to 2,400 W for quick and cosy warmth 3 heating levels (800 W / 1,200 W / 2,400 W) Effective 9-fin radiator Frost monitor function Noiseless heating Maximum security thanks to overheating and tilt protection Short heating time: maximum heat output Operation indicator light BGUFSPOMZ{NJOVUFT Practical cable winder with plug holder Heat accumulator with liquid heating medium: for quick organization prolonged heat radiation even after switch-off Integrated castors and carrying handle On-demand turbo blower with PTC heating for safe transport even when hot element for faster initial heating Steplessly adjustable thermostat TRH 23 E Capacity of up to 2,900 W for quick and Frost monitor function cosy warmth Noiseless heating 3 heating levels (1,000 W / 1,500 W / 2,900 W) Maximum security thanks to overheating Effective 11-fin radiator and tilt protection Short heating time: maximum heat output Operation indicator light BGUFSPOMZ{NJOVUFT Practical cable winder with plug holder Heat accumulator with liquid heating medium: for quick organization prolonged heat radiation even after switch-off Integrated castors and carrying handle On-demand turbo blower with PTC heating for safe transport even when hot element for faster initial heating Steplessly adjustable thermostat HEATING TRH-E SERIES 89 Accessories HEATING Oil-filled radiators with a capacity of up to 2,500 W TRH 24 E Capacity of up to 2,200 W for quick and Energy-efficient operation thanks to auto- cosy warmth matic switch-off upon reaching the set value 3 heating levels (1,000 W / 1,200 W / 2,200 W) Noiseless heating Effective 11-fin radiator Maximum security thanks to overheating Short heating time: maximum heat output after only 8 minutes and tilt protection Operating control lamp Heat accumulator with liquid heating medium: Integrated castors and carrying handle for prolonged heat radiation even after switch-off safe transport even when hot Thermostat-controlled automatic operation with target value preselection between 15 and 35 °C Automatic temperature control TRH 25 E / TRH 26 E Capacity of up to 2,500 W for quick and Timer function cosy warmth IR remote control 3 heating levels (1,000 W / 1,500 W / 2,500 W) Energy-efficient operation thanks to automatic Effective 11-fin radiator switch-off upon reaching the set value Short heating time: maximum heat output Noiseless heating after only 8 minutes Maximum security thanks to overheating Heat accumulator with liquid heating medium: and tilt protection prolonged heat radiation even after switch-off Operating control lamp Thermostat-controlled automatic operation Practical cable winder for quick organization with target value preselection between 15 and 35 °C Automatic temperature control Integrated castors and carrying handle for safe transport even when hot TRH 27 E Capacity of up to 2,500 W for quick and Automatic temperature control cosy warmth Energy-efficient operation thanks to automat- 3 power levels (1,200 W / 1,300 W / 2,500 W) ic switch-off upon reaching the set value Effective 11-fin radiator Noiseless heating Short heating time: maximum heat output after only 8 minutes Maximum security thanks to overheating and tilt protection Heat accumulator with liquid heating medium: Operating control lamp prolonged heat radiation even after switch-off Integrated castors and carrying handle for Thermostat-controlled automatic operation safe transport even when hot with target value preselection between 10 and 30 °C 90 HEATING TRH-E SERIES TRH 28 E Capacity of up to 2,500 W for quick and cosy warmth Thermostat-controlled automatic operation with target value preselection between 3 power levels (1,200 W / 1,300 W / 2,500 W) 16 and 30 °C Effective 11-fin radiator Frost monitoring function Digital LED touch display with key lock (child Timer function lock) Noiseless heating Short heating time: maximum heat output after only 8 minutes Maximum security thanks to overheating and tilt protection Heat accumulator with liquid heating medium: Operating control lamp prolonged heat radiation even after switch-off Integrated castors and carrying handle for safe transport even when hot Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Oil-filled radiators with a capacity of up to 2,900 W FUNCTIONAL PRINCIPLE OF A TYPICAL OIL-FILLED RADIATOR 9J[KUCTCFKCVQTNNGFYKVJQKNCPFPQVYKVJYCVGT!6JGTGCUQPHQTVJKU is the fact that water expands when it is heated, and that it does not store heat quite as well. The thermal oil used in radiators, in contrast, JCU C OWEJ JKIJGT UVQTCIG ECRCEKV[ 'XGP CHVGT VJG QKNNNGF TCFKCVQT KU UYKVEJGF Q KV IKXGU Q JGCV HQT CPQVJGT IQQF JCNH CP JQWT 5KPEG thermal oil is also a good insulator, heating resistors can be directly immersed in the oil, which makes the heat exchange again more effective. Then there is also the weight, because oil is lighter than water. 6JKUOCMGUQKNNNGFTCFKCVQTUEQPUKFGTCDN[OQTGNKIJVYGKIJVCPFGCU[ VQVTCPURQTV1KNNNGFTCFKCVQTUCTGFGUKIPGFHQTEQPVKPWQWUWUGUKPEG they can fully substitute a wall radiato. time faster than normal heating systems. They work without a fan, which means that they do not whirl up any dust and are therefore allergy friendly. And they usually develop their maximum heat output within CSWCTVGTQHCPJQWT1KNNNGFTCFKCVQTUCTGUWKVGFCUPQKUGNGUUCPFUCHG on-demand heaters and also as ground heaters, for instance to prevent pipelines from freezing. The devices are positioned on wheels and CTGXGT[NKIJVYGKIJVCPFOQDKNG2WTEJCUKPICPQKNNNGFTCFKCVQTKUC YQTVJYJKNGCPFCQTFCDNGEJQKEGKHHQTGZCORNG[QWTEGPVTCNJGCVKPI system fails all of a sudden, you will have a heating device immediately to hand and do not have to endure the cold. Selectable turbo blower 5KPEGQKNNNGFTCFKCVQTUCTGTCVJGTUNWIIKUJCUEQORCTGFVQHCPJGCVers with regard to their heat generation during start-up, there are also EQODKPCVKQPUQHCPQKNNNGFTCFKCVQTCPFCUOCNNHCPJGCVGTCXCKNCDNG #HCUVGTCPFOQTGGGEVKXGKPKVKCNJGCVKPIQHVJGTQQOECPDGCEJKGXGF by using a turbo blower equipped with an additional PTC heating element that can be switched on separately. This way, the room is heated up quickly until the thermal oil has reached its temperature and can develop its full heating capacity. 1RVKOCNWUCIGQHQKNNNGFTCFKCVQTU 1KNNNGFTCFKCVQTURTQXKFGEQU[YCTOVJKPVJGTQQOCPFCTGRGTHGEVN[ suited for heating garages as well as basements or attics. In doing so, VJG[CTGOQTGGEKGPVCPFENGCPGTVJCPHCPJGCVGTUCPFCVVJGUCOG SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING TRH-E SERIES 91 HEATING Oil-filled radiators with a capacity of up to 2,900 W Overview: Oil-filled radiators of the TRH-E series with a capacity of up to 2,900 W Technical data Article number Suitable for rooms sized up to Capacity Black White Stage 1 Stage 2 Stage 3 Input voltage Nominal current consumption IP type of protection Electric connection Plug type Cable length Sound level without / with turbo blower Length Width H Height L W Weight Equipment and functions Heating levels Number of heating fins Steplessly adjustable thermostat Adjustable multi-stage thermostat Frost monitor function Operating control lamp Overheating protection Tilt protection Automatic switch-off upon reaching the set value Current room temperature display Selectable turbo blower Timer function Infrared remote control Cable winder / with plug holder TRH 20 E 1.410.000.710 25 m² / 60 m³ 800 W 1,200 W 2,000 W 220 - 240 V/ 50 - 60 Hz 8.7 A IP20 CEE 7/7 1.4 m / 390 mm 235 mm 558 mm 7 kg TRH 20 E 3 9 / TRH 21 E 1.410.000.711 30 m² / 75 m³ 1,000 W 1,500 W 2,500 W 220 - 240 V/ 50 - 60 Hz 10.9 A IP20 CEE 7/7 1.4 m / 480 mm 235 mm 548 mm 8 kg TRH 21 E 3 11 / FROST MONITOR FUNCTION Ideal for short-term property vacancies or temporarily used rooms. 7UKPI VJG UVGRNGUU VJGTOCN EQPVTQN QH QWT OQDKNG QKNNNGF TCFKCVQTU you can also operate the devices in frost monitor operating mode. The heating device is then automatically activated by a thermostat to protect the rooms from frost and prevent excessive cooling. (WPEVKQPKPICUHTQUVIWCTFUVJGQKNNNGFTCFKCVQTUCTGPQVQPN[KFGCNN[ UWKVGFHQTNCPFNQTFUCPFTGCNGUVCVGEQORCPKGUsVJG[CNUQQGTDGPGVUHQTRTKXCVGCPFDWUKPGUURGQRNGYJQECPVJWUMGGRXCECPVTQQOU and garages free from frost. Particularly rooms, conservatories or cellars which are not connected to a central heating system can be kept warm reliably in this way. TRH 22 E 1.410.000.715 25 m² / 60 m³ 800 W 1,200 W 2,400 W 220 - 240 V/ 50 - 60 Hz 10.4 A IP20 CEE 7/7 1.4 m / 48 dB(A) 420 mm 240 mm 650 mm 9 kg TRH 22 E 3 9 / TRH 23 E 1.410.000.716 30 m² / 75 m³ 1,000 W 1,500 W 2,900 W 220 - 240 V/ 50 - 60 Hz 12.6 A IP20 CEE 7/7 1.4 m / 48 dB(A) 490 mm 235 mm 635 mm 10 kg TRH 23 E 3 11 / TRH 24 E 1.410.000.717 22 m² / 55 m³ 1,000 W 1,200 W 2,200 W 220 - 240 V/ 50 Hz 9.5 A IP20 CEE 7/7 1.8 m / 442 mm 240 mm 639 mm 9 kg TRH 24 E 3 11 / TRH 25 E / 26 E 1.410.000.720 1.410.000.721 30 m² / 75 m³ 1,000 W 1,500 W 2,500 W 220 - 240 V/ 50 - 60 Hz 10.9 A IP20 CEE 7/7 1.4 m / 470 mm 240 mm 600 mm 9.5 kg TRH 25 E / 26 E 3 11 / 92 HEATING TRH-E SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Oil-filled radiators with a capacity of up to 2,500 W Overview: Oil-filled radiators of the TRH-E series with a capacity of up to 2,500 W Technical data Article number Suitable for rooms sized up to Capacity Black White Stage 1 Stage 2 Stage 3 Input voltage Nominal current consumption IP type of protection Electric connection Plug type Cable length Sound level without / with turbo blower Length Width H Height L W Weight Equipment and functions Heating levels Number of heating fins Steplessly adjustable thermostat Adjustable multi-stage thermostat Frost monitor function Operating control lamp Overheating protection Tilt protection Automatic switch-off upon reaching the set value Current room temperature display Selectable turbo blower Timer function Infrared remote control Cable winder / with plug holder TRH 27 E 1.410.000.722 30 m² / 75 m³ 1,200 W 1,300 W 2,500 W 220 - 240 V/ 50 Hz 10.9 A IP20 CEE 7/7 1.8 m / 465 mm 245 mm 645 mm 9.5 kg TRH 27 E 3 11 / TRH 28 E 1.410.000.723 30 m² / 75 m³ 1,200 W 1,300 W 2,500 W 220 - 240 V/ 50 Hz 10.9 A IP20 CEE 7/7 1.8 m / 446 mm 240 mm 635 mm 9.5 kg TRH 28 E 3 11 / SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING TRH-E SERIES 93 HEATING INFRARED HEATING PANELS OF THE TIH-S SERIES MODERN HEATING TECHNOLOGY WITH AN APPEALING DESIGN TIH 1100 S TIH 900 S TIH 700 S TIH 500 S TIH 400 S TIH 300 S 94 HEATING TIH-S SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Infrared heating panels with a heating capacity of up to 700 W TIH 300 S Efficient heating procedure with environmentally friendly IR-C radiation Heat transport via light waves direct object heating without convective loss Maximum efficiency: 100 % of the electrical energy input is converted into heat output Clean warmth no noise, no odour, no condensate, no oxygen consumption, no unpleasant dust circulation Integrated suspension device for mounting on a wall or on assembly supports Can also be positioned on the floor Ready for immediate use no additional installations or expensive modifications required TIH 400 S Efficient heating procedure with environmentally friendly IR-C radiation Heat transport via light waves direct object heating without convective loss Maximum efficiency: 100 % of the electrical energy input is converted into heat output Clean warmth no noise, no odour, no condensate, no oxygen consumption, no unpleasant dust circulation Integrated suspension device for mounting on a wall or on assembly supports Can also be positioned on the floor Ready for immediate use no additional installations or expensive modifications required SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning TIH 500 S Efficient heating procedure with environmentally friendly IR-C radiation Heat transport via light waves direct object heating without convective loss Maximum efficiency: 100 % of the electrical energy input is converted into heat output Clean warmth no noise, no odour, no condensate, no oxygen consumption, no unpleasant dust circulation Integrated suspension device for mounting on a wall or on assembly supports Can also be positioned on the floor Ready for immediate use no additional installations or expensive modifications required TIH 700 S Efficient heating procedure with environmentally friendly IR-C radiation Heat transport via light waves direct object heating without convective loss Maximum efficiency: 100 % of the electrical energy input is converted into heat output Clean warmth no noise, no odour, no condensate, no oxygen consumption, no unpleasant dust circulation Integrated suspension device for mounting on a wall or on assembly supports Can also be positioned on the floor Ready for immediate use no additional installations or expensive modifications required HEATING TIH-S SERIES 95 Accessories HEATING Infrared heating panels with a heating capacity of up to 1,100 W TIH 900 S Efficient heating procedure with environmentally friendly IR-C radiation Heat transport via light waves direct object heating without convective loss Maximum efficiency: 100 % of the electrical energy input is converted into heat output Clean warmth no noise, no odour, no condensate, no oxygen consumption, no unpleasant dust circulation Integrated suspension device for mounting on a wall or on assembly supports Can also be positioned on the floor Ready for immediate use no additional installations or expensive modifications required TIH 1100 S Efficient heating procedure with environmentally friendly IR-C radiation Heat transport via light waves direct object heating without convective loss Maximum efficiency: 100 % of the electrical energy input is converted into heat output Clean warmth no noise, no odour, no condensate, no oxygen consumption, no unpleasant dust circulation Integrated suspension device for mounting on a wall or on assembly supports Can also be positioned on the floor Ready for immediate use no additional installations or expensive modifications required THIS IS HOW INFRARED HEATING WORKS IN INTERIOR SPACES Infrared rays cannot heat up the room air directly but they heat up all objects inside the room, which will then permanently emit the stored thermal energy into the room, similar to a tiled stove. In contrast to classical convection heatings, this indirect heating method thus warms up objects instead of directly warming up the room air. The latter cannot, in principle, store the warmth itself, but can only transport them to objects, which entails high energy losses on the one hand and, on the other hand, causes dust circulation which can be completely avoided when using an infrared heating. 96 HEATING TIH-S SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Infrared heating panels with a heating capacity of up to 1,100 W Overview: Infrared heating panels of the TIH-S series up to 1,100 W heating capacity Technical data Article number Heating capacity Effective range Input voltage Nominal current consumption IP type of protection Electric connection Length Width Height Weight Accessories Plug type Cable length H L W Set of 2 feet TIH 300 S 1.410.003.008 300 W 0.31 m² 230 V/50 Hz 1.3 A IP54 CEE 7/7 1.9 m 22 mm 605 mm 505 mm 3 kg TIH 300 S 1.410.003.001 TIH 400 S 1.410.003.010 450 W 0.43 m² 230 V/50 Hz 2 A IP54 CEE 7/7 1.9 m 22 mm 705 mm 605 mm 4 kg TIH 400 S 1.410.003.001 TIH 500 S 1.410.003.012 580 W 0.54 m² 230 V/50 Hz 2.6 A IP54 CEE 7/7 1.9 m 22 mm 905 mm 605 mm 5 kg TIH 500 S TIH 700 S 1.410.003.014 700 W 0.72 m² 230 V/50 Hz 3.2 A IP54 CEE 7/7 1.9 m 22 mm 1,205 mm 605 mm 6 kg TIH 700 S TIH 900 S 1.410.003.016 900 W 0.91 m² 230 V/50 Hz 3.9 A IP54 CEE 7/7 1.9 m 22 mm 1,205 mm 755 mm 7.5 kg TIH 900 S TIH 1100 S 1.410.003.018 1,100 W 1.09 m² 230 V/50 Hz 4.8 A IP54 CEE 7/7 1.9 m 25 mm 1,205 mm 905 mm 9 kg TIH 1100 S Set of 2 feet Assembly support fastening clamps Socket thermostat BN30 Radio-controlled socket thermostat BN35 Transport bag 1.410.003.099 1.410.003.099 1.410.003.099 1.410.003.099 1.410.003.004 1.410.003.004 1.410.003.004 1.410.003.004 1.410.003.004 1.410.003.004 6.100.007.009 6.100.007.009 6.100.007.009 6.100.007.009 6.100.007.009 6.100.007.009 6.100.007.008 6.100.007.008 6.100.007.008 6.100.007.008 6.100.007.008 6.100.007.008 1.410.003.005 SecoSan Air cleaning Air cooling Air conditioning BeHheeaitiznungg Ventilation Cleaning Accessories HEATING TIH-S SERIES 97 AIR CONDITIONING PORTABLE COMFORT AIR CONDITIONERS ULTIMATE CLIMATE IN OFFICES, WORKSHOPS OR AT HOME AIR CONDITIONER WITHOUT EXTERNAL UNIT PRACTICAL KNOWLEDGE GUIDE A comprehensive overview of device ROOM COOLING EVERYTHING YOU NEED TO KNOW! differences, functional principles and possib- le applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info PAC-W 2200 S HOT& COOL PAC-W 2650 SH HOT& COOL PAC 2010 SH PAC 2100 X PAC 2010 E PAC 2600 X PAC 2610 E PAC 2610 S PAC 3000 X A + HOT& COOL PAC 3500 SH PAC 3500 PAC 3500 E PAC 3500 S PAC 3800 S PAC 3810 S 98 AIR CONDITIONING PAC SERIES PAC 3900 X PAC 4600 Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification TROTEC AIR HANDLING UNITS FOR MOBILE AIR CONDITIONING *GCVCPFUVW[CKTTGFWEGQWTGEKGPE[CPFCDKNKV[VQEQPEGPVTCVG# remedy provide the air conditioners of the PAC series. Instead of installing expensive stationary air conditioning systems, with a mobile air conditioner you can generate welcome cool air exactly where needed. PAC air conditioners refrigerate and dehumidify the room air and ensure [QWTYGNNDGKPIKPQEGUFQEVQTnUQEGUDQWVKSWGUICNNGTKGUJQNKFC[ homes, living or bedrooms and wherever else a pleasant room climate KUQHUKIPKECPEG Furthermore, the air conditioners additionally function as powerful dehuOKFKGTU*GPEGFCORYCNNUOWUV[UOGNNUTWUVEQPFGPUCVKQPYCVGT and mould formation is prevented. MOBILE AIR CONDITIONING SYSTEMS CONVENIENT REFRIGERATION SYSTEMS All air conditioners of our PAC series cool the room air with the help of a powerful compression refrigeration system. A refrigerant is led through two heat exchangers a condenser and an evaporator. By means of a compressor and an expansion valve, the refrigerant is exposed to changing pressures within this closed circuit, which results in the gas heating up during compression and cooling down during decompression. The heat is discharged to the outside at the condenser, and the cold is blown into the room at the evaporator. Cold air EVAPORATOR &GJWOKFKECVKQPCVVJGUCOGVKOG Since the air can cool down to below its dew point at the evaporator, humidity contained in the air condenses simultaneously. This means VJCVVJGCKTKUPQVQPN[EQQNGFDWVCNUQFGJWOKFKGFYJKEJRTQOQVGU personal well-being and creates a more pleasant room climate, since UVW[JWOKFCKTKUIGPGTCNN[RGTEGKXGFCUWPRNGCUCPV COMPRESSOR Compression Refrigerant circuit Decompression EXPANSION VALVE CONDENSER Warm air SecoSan Air cleaning Heating Air cooling AiKrlicmoantidsitierouninngg Ventilation GOING STRONG IN EVERY RESPECT MOBILE AIR CONDITIONERS FROM TROTEC Instead of installing expensive stationary air conditioning systems KPOCP[FKGTGPVTQQOUYKVJCOQDKNGCKTJCPFNKPIWPKVHTQO6TQVGE you can generate welcome cool air exactly where needed. How much power is required to cool my room? 6JGTWNGQHVJWOD Every cubic metre of room volume requires a cooling capacity of 30 watts. The required cooling capacity can quickly and easily be determined YKVJ VJKU TWNG 5CORNG ECNEWNCVKQP HQT C TQQO YKVJ O QH QQT URCEGCPFCTQQOJGKIJVQHO 35 m² x 2.5 m room height = 87.5 m³ cubature x 30 watts = 2,625 watts 6JKUKUQPN[CTQWIJECNEWNCVKQPHQTOWNCHQTV[RKECNNKXKPICPFQEG spaces. The required cooling capacity further depends on the room`s VJGTOCN NQCF KPUQNCVKQP KPUWNCVKQP VJG PWODGT QH RGTUQPU CPF heat sources also play a role in the selection of an air conditioner. 'ZEGRVKQPCVVKECVU +PCVVKETQQOUKVKUOQTGFKEWNVVQFGVGTOKPGVJGRTGEKUGEQQNKPI capacity, since the user often doesn`t know about the exact roof insulationt. Which is why we recommend adding ten per cent to the determined cooling capacity for good measure, especially in old buildings. Experience has shown that one can take a power of 50 to 60 watts per cubic metre room air as a basis. In case of very poorly insulated roofs and many skylights, still more. Our consultants will gladly assist you in calculating the cooling load for your individual requirements! An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info AIR CONDITIONING PAC SERIES 99 Cleaning Accessories AIR CONDITIONING Comfort air conditioners with a cooling capacity of up to 9,000 Btu/h HOT& COOL PAC 2010 SH A A 2,0 kW 1,8 kW 2,6 EER 2,3 COP 0,8 0,8 kWh/60 min* kWh/60 min* 65dB FRIEN O R290 AL REFRIGE PAC 2100 X A 2,0 kW 63dB 2,7 EER 0,8 kWh/60min* FRIEN O R290 AL REFRIGE EC RANT EC RANT DLY N ATUR DLY N ATUR PAC 2010 SH Monobloc air conditioner 4-in-1 air conditioner: cooling, heating, ventilation, dehumidification Energy efficiency class A 2 kW / 7,000 Btu/h cooling capacity 1.8 kW heating capacity Timer function Removable air filter Control panel with easy-to-clean membrane keys Adjustable air discharge direction IR remote control 2 fan stages PAC 2100 X Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Automatic mode Energy efficiency class A 2 kW / 7,000 Btu/h cooling capacity Timer function Removable air filter Practical LED display Temperature indication either in °C or in °F Control panel with easy-to-clean membrane keys Adjustable air discharge direction IR remote control with integrated temperature measurement (Follow Me function) 2 fan stages and automatic fan FRIEN O R290 AL REFRIGE PAC 2600 X A 2,6 kW 63dB 2,6 EER 1,0 kWh/60min* FRIEN O R290 AL REFRIGE EC RANT EC RANT DLY N ATUR DLY N ATUR PAC 2010 E Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Energy efficiency class A 2.1 kW / 7,200 Btu/h cooling capacity Timer function Removable air filter Control panel with easy-to-clean membrane keys Temperature indication either in °C or in °F Adjustable air discharge direction IR remote control 3 fan stages and automatic fan 100 AIR CONDITIONING PAC SERIES PAC 2600 X Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Automatic mode Energy efficiency class A 2.6 kW / 9,000 Btu/h cooling capacity Timer function Removable air filter Practical LED display Temperature indication either in °C or in °F Control panel with easy-to-clean membrane keys Adjustable air discharge direction IR remote control with integrated temperature measurement (Follow Me function) 2 fan stages and automatic fan Constantly updated: www.trotec.com/catalogs Trotec Comfort air conditioners with a cooling capacity of up to 9,000 Btu/h FRIEN O R290 AL REFRIGE PAC 2610 S A 2,6 kW 65dB 2,6 EER 1,0 kWh/60min* EC RANT EC FRIEN O R290 AL REFRIGE RANT Humidification Dehumidification DLY N ATUR DLY N ATUR SecoSan Air cleaning Heating Air cooling AiKrlicmoantidsitierouninngg PAC 2610 E Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Energy efficiency class A 2.6 kW / 9,000 Btu/h cooling capacity Timer function Removable air filter Control panel with easy-to-clean membrane keys Temperature indication either in °C or in °F Adjustable air discharge direction IR remote control 3 fan stages and automatic fan PAC 2610 S Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Energy efficiency class A 2.6 kW / 9,000 Btu/h cooling capacity Timer function Removable air filter Control panel with easy-to-clean membrane keys Adjustable air discharge direction IR remote control 2 fan stages FEEL-GOOD CLIMATE ON 365 DAYS PER YEAR BY COMBINING COOLING AND HEATING FUNCTION On hot summer days there is nothing more agreeable than having an air conditioner in your own four walls that provides the much longed-for cooling. And with a combination device for optional heating you can basically programme your own individual feel-good climate for the entire year. Especially in the time between seasons the daytime temperatures QHVGP WEVWCVG SWKVG UWDUVCPVKCNN[ %QOHQTV CKT EQPFKVKQPGTU YKVJ CFFKVKQPCNJGCVKPIHWPEVKQPUWEJCUVJG2#%5*QTVJG2#%5*ECP not only provide cool refreshment to oppose midday heat, but also an agreeable warmth to counter the cool of the evening. All combined in just QPGFGXKEGsXGPVKNCVKQPCPFFGJWOKFKECVKQPKPENWFGF6JGUGETGVVQVJKU versatility lies in the functional principle of the integrated reversible heat RWOR6JGTGHTKIGTCPVEKTEWKVQHUWEJFGXKEGUECPDGTGXGTUGFCUPGGFGF Instead of generating cool room air and in turn discharging hot process air to the outside, the reversed process means that now hot air is produced for the room whilst the colder process air is discharged into the open air. 6JGRTQEGUUKUTGXGTUGFHWNN[CWVQOCVKECNN[CNN[QWPGGFVQFQKUVQUGV the desired target temperature at the device. Depending on the current room temperature the air conditioner automatically switches between cooling and heating function via thermostat control so as to maintain the preselected room temperature at all times. By the way:*GCVKPIYKVJVJGUGV[RGUQHCKTEQPFKVKQPGTUKUOWEJOQTG economical than using purely electric heating devices. Whilst the latter convert the electrical energy input virtually 1:1 into heat output, air conditioners with heating function operating in accordance with the JGCVRWORRTKPEKRNGEQOGYKVJC%12QHOQTGVJCP#EQGEKGPVQH RGTHQTOCPEGQHOGCPUVJCVQPGM9QHGNGEVTKECNRQYGTIGPGTCVGUC JGCVQWVRWVQHM9 An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info AIR CONDITIONING PAC SERIES 101 Ventilation Cleaning Accessories AIR CONDITIONING Comfort air conditioners with a cooling capacity of up to 9,000 Btu/h Overview: Comfort air conditioners of the PAC series with a cooling capacity of up to 9,000 Btu/h Technical data PAC 2010 SH PAC 2100 X PAC 2010 E PAC 2600 X PAC 2610 E PAC 2610 S Article number 5WKVCDNGHQTTQQOUUK\GFWRVQCRRTQZ Device type Max. cooling capacity *GCVKPIECRCEKV[ Max. air flow rate Dehumidifying capacity max. Input voltage Max. power input 6[RGQHTGHTKIGTCPV #OQWPVQHTGHTKIGTCPV )92HCEVQT %1GSWKXCNGPV 5QWPFRTGUUWTGNGXGN (Abstand 1 m) Noise emission according to '0+51 =M9J? =$VWJ? Internal unit External unit Internal unit External unit OO OO Monobloc Monobloc M9 M9 $VWJ $VWJ M9 OJ OJ NJ NJ 8*\ 8*\ M9 M9 4 4 I I V V F$ # F$ # F$ # F$ # OO Monobloc M9 $VWJ OJ 1 l/h 8*\ M9 4 I V F$ # F$ # OO Monobloc M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # OO Monobloc M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # OO Monobloc M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # Exhaust air hose, length / Ø OO OO OO OO OO OO OO OO OO OO OO OO %QPPGEVKQPNKPGNGPIVJ Length internal / external unit Width internal / external unit H *GKIJVKPVGTPCNGZVGTPCNWPKV L W L W Weight internal / external unit 'SWKROGPVCPFHWPEVKQPU Dehumidification function *GCVKPIHWPEVKQP Ventilation function (ventilation without cooling operation) Water-air cooling Fan stages Automatic function (fully automatic operation) Adjustable air discharge direction Manual 5YKPIHWPEVKQP Infrared remote control / storage compartment %QPVTQNRCPGNYKVJOGODTCPGMG[U Display Microprocessor-controlled operation Automatic fault diagnosis system Night mode 6KOGTHWPEVKQP Room thermostat with temperature indication Anti-bacterial filter for improving VJGCKTSWCNKV[ 5VCPFCTF YCUJCDNG Activated carbon 5NKFKPIYKPFQYUGCNKPIUGV %CDNGJQNFGTECDNGUVQTCIGEQORCTVOGPV Wheels internal / external unit %CTT[KPIJCPFNGUKPVGTPCNGZVGTPCNWPKV 3WKEMEQWRNKPIHQTVJGEQPPGEVKQPQHKPVGTPCNGZVGTPCNWPKV Accessories #KT.QEMYKPFQYUGCN #KT.QEM|FQQTCPFYKPFQYUGCN 2#%TQNNGTUJWVVGTYKPFQYUETGGP 2#%YKPFQYCFCRVGT *QUGENCORHQTYKPFQYCFCRVGT 4CFKQEQPVTQNNGFUQEMGVVJGTOQUVCV$0 sOO sOO sOO sMI 2#%5* / LED / / / 2#%5* sOO sOO sOO sMI 2#%: / LED / / / 2#%: sOO sOO sOO sMI 2#%' / LED / / / 2#%' sOO sOO sOO sMI 2#%: / LED / / / 2#%: sOO sOO sOO sMI 2#%' / LED / / / 2#%' sOO sOO sOO sMI 2#%5 / LED / / / 2#%5 * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. AIR CONDITIONING PAC SERIES Constantly updated: www.trotec.com/catalogs An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info AIR CONDITIONING PAC SERIES Accessories Cleaning Ventilation Air cooling AiKrlicmoantidsitierouninngg Heating Air cleaning SecoSan Humidification Dehumidification Trotec AIR CONDITIONING Comfort air conditioners with a cooling capacity of up to 12,000 Btu/h HOT& COOL PAC 3000 X A+ A+ 2,9 kW 62dB 3,1 EER 1,0 kWh/60min* FRIEN O R290 AL REFRIGE FRIEN O R290 AL REFRIGE EC RANT EC RANT DLY N ATUR DLY N ATUR PAC 3000 X A+ Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Automatic mode Energy efficiency class A+ 2.9 kW / 10,000 Btu/h cooling capacity Timer function Removable air filter Control panel with easy-to-clean membrane keys Swing function for optimum air distribution IR remote control with integrated temperature measurement (Follow Me function) 3 Fan stages PAC 3500 SH Monobloc air conditioner 4-in-1 air conditioner: cooling, heating, ventilation, dehumidification Automatic mode Energy efficiency class A 3.5 kW / 12,000 Btu/h cooling capacity 2.9 kW heating capacity Timer function Removable air filter Control panel with easy-to-clean membrane keys Swing function for optimum air distribution IR remote control with integrated temperature measurement (Follow Me function) 3 Fan stages PAC 3500 A 3,5 kW 65dB 2,6 EER 1,4 kWh/60min* FRIEN O R290 AL REFRIGE FRIEN O R290 AL REFRIGE EC RANT EC RANT DLY N ATUR DLY N ATUR PAC 3500 Monobloc air conditioner High cooling capacity immediately ready for operation 3-in-1 air conditioner: cooling, ventilation, dehumidification Energy efficiency class A 3.5 kW / 12,000 Btu/h cooling capacity Timer function Removable air filter Control panel with easy-to-clean membrane keys Temperature indication either in °C or in °F Adjustable air discharge direction IR remote control 3 Fan stages AIR CONDITIONING PAC SERIES PAC 3500 E Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Energy efficiency class A 3.5 kW / 12,000 Btu/h cooling capacity Timer function Removable air filter Illuminated LCD display Temperature indication either in °C or in °F Swing function for optimum air distribution IR remote control 3 Fan stages Constantly updated: www.trotec.com/catalogs Trotec Comfort air conditioners with a cooling capacity of up to 13,300 Btu/h PAC 3500 S A 3,5 kW 65dB 2,6 EER 1,4 kWh/60min* EC RANT FRIEN O R290 AL REFRIGE PAC 3800 S A 3,8 kW 65dB 2,6 EER 1,5 kWh/60min* EC FRIEN O R290 AL REFRIGE RANT Humidification Dehumidification DLY N ATUR DLY N ATUR SecoSan Air cleaning Heating PAC 3500 S Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Automatic mode Energy efficiency class A 3.5 kW / 12,000 Btu/h cooling capacity Timer function Removable air filter LED display Temperature indication either in °C or in °F Swing function for optimum air distribution IR remote control 3 Fan stages PAC 3800 S Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Automatic mode Energy efficiency class A 3.8 kW / 13,000 Btu/h cooling capacity Timer function Removable air filter LED display Temperature indication either in °C or in °F Swing function for optimum air distribution IR remote control 3 Fan stages PAC 3810 S A 3,8 kW 65dB 2,6 EER 1,5 kWh/60min* FRIEN O R290 AL REFRIGE EC RANT EC FRIEN O R290 AL REFRIGE RANT Air cooling AiKrlicmoantidsitierouninngg DLY N ATUR DLY N ATUR Ventilation Cleaning Accessories PAC 3810 S Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Automatic mode Energy efficiency class A 3.8 kW / 13,000 Btu/h cooling capacity Timer function Removable air filter LED display Temperature indication either in °C or in °F Swing function for optimum air distribution IR remote control 3 Fan stages An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info PAC 3900 X Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Energy efficiency class A {L8{ {#UVIDPPMJOHDBQBDJUZ Timer function Removable air filter Control panel with easy-to-clean membrane keys Temperature indication either in °C or in °F Swing function for optimum air distribution IR remote control 3 Fan stages AIR CONDITIONING PAC SERIES AIR CONDITIONING Comfort air conditioners with a cooling capacity of up to 14,500 Btu/h PAC 4600 Split air conditioner Compact design and minimum storage space 3-in-1 air conditioner: cooling, ventilation, dehumidification 4.3 kW / 14,500 Btu/h cooling capacity Timer function Removable air filter Control panel with easy-to-clean membrane keys Swing function for optimum air distribution Adjustable air discharge direction IR remote control 4 Fan stages AIR CONDITIONING PAC SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification SecoSan Air cleaning AIRLOCK DOOR AND WINDOW SEALING /QPQDNQECKTEQPFKVKQPKPIFGXKEGUTGSWKTGVJGKPUVCNNCVKQPQHCKTJQUGU GXGPYJGPVJG#KT.QEMKUOQWPVGF+VUVTCPUNWEGPVCPFYCVGTTGUKUVCPV YJKEJQHVGPVCMGURNCEGXKCCPQRGPYKPFQYICR6JKUOCMGUVJGEQQNKPI OCVGTKCNJCUNQYVJGTOCNEQPFWEVKXKV[RTQRGTVKGUVJGEQQNKPIGEKGPE[ WPGEQPQOKECNDGECWUGRGTOCPGPVN[YCTOGZVGTPCNCKTCICKPQYUKP is increased, thereby reducing energy costs. through the opening into the refrigerated space, and also uncomfortable and annoying since opening in this way gives insects uncontrolled access. %JQQUGGKVJGTVJG#KT.QEMYKVJQPG\KRQTCP#KT.QEMYKVJVYQ\KR openings for all monobloc air conditioning units, which feature a ducted AirLock protects equally against the entry of hot air and insects XKCCUWRRN[CKTJQUG6JG#KTNQEMKUCNUQGSWKRRGFYKVJVYQ\KRRGT 6JG#KT.QEMJCUC\KRRGTQRGPKPIHQTVJGJQUGPQ\\NGCPFECPDGOQWPVGF openings and is suitable for balcony or patio doors. YKVJCHGYUKORNGUVGRUDGVYGGPYKPFQYCPFHTCOG*GPEGHQTVJVJGUG By the way: The AirLock can also be used for other exhaust air carrying TGNKCDNGRTCEVKECNJGNRGTURTGXGPVDCEMQYQHYCTOGZJCWUVCKTCPFVJG devices all year round. penetration of insects, wherein your window remains closable at all times AirLock 100 #TVKENGPWODGT A few practical benefits: Increasing the cooling capacity, reducing the energy consumption Variably adaptable to all hose diameters Water-repellent and washable Prevents the penetration of warm outdoor air and insects Despite the seal the window can be closed without difficulty An investment that redeems itself in next to no time Simple self-assembly Disassembly leaving no traces AirLock 200 #TVKENGPWODGT AirLock 1000 #TVKENGPWODGT CONVINCING MARKET LEADER QUALITY 0QQVJGTYKPFQYUGCNHQTCKTEQPFKVKQPGTUKUUQNFOQTGHTGSWGPVN[KP'WTQRGVJCP6TQVGE U#KT.QEM(QTCIQQFTGCUQP6JG#KT.QEMYJKEJYCU QTKIKPCNN[FGUKIPGFURGEKECNN[HQT)GTOCPVKNVVWTPYKPFQYUJCUCNUQ become highly popular in other European countries since the transluEGPVDWVYCVGTTGRGNNGPVOCVGTKCNKUEJCTCEVGTK\GFD[JKIJRTQEGUUKPI SWCNKV[FQYPVQVJGUGCOUCPFCVVJGUCOGVKOGJCUNQYURGEKEJGCV conduction characteristics, which reduces the energy demand of air EQPFKVKQPGTUEQPUKFGTCDN[6JKUYC[VJG#KT.QEMXKTVWCNN[RC[UHQTKVUGNH in next to no time! AirLock 100 and AirLock 200 (QTCNNYKPFQYV[RGUECUGOGPVDQVVQOJWPIQTUM[NKIJVYKPFQYUs VJG#KT.QEMCPFCNUQVJG#KT.QEMOCVEJGUCNNVJGEQOOQP YKPFQYEQPUVTWEVKQPUYKVJCOCZKOWORGTKOGVGTQHEO AirLock 1000 (QTRCVKQCPFDCNEQP[FQQTUQTQQTVQEGKNKPIYKPFQYUsVJG#KTNQEM VUCNNFQQTUVTWEVWTGUYKVJCOCZKOWORGTKOGVGTQHEO Heating Air cooling AiKrlicmoantidsitierouninngg Ventilation Cleaning Accessories An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info AIR CONDITIONING PAC SERIES AIR CONDITIONING Comfort air conditioners with a cooling capacity of up to 12,000 Btu/h Overview: Comfort air conditioners of the PAC series with a cooling capacity of up to 14,500 Btu/h Technical data Article number 5WKVCDNGHQTTQQOUUK\GFWRVQCRRTQZ Device type Max. cooling capacity *GCVKPIECRCEKV[ Max. air flow rate Dehumidifying capacity max. Input voltage Max. power input 6[RGQHTGHTKIGTCPV #OQWPVQHTGHTKIGTCPV )92HCEVQT %1GSWKXCNGPV 5QWPFRTGUUWTGNGXGN (distance 1 m) Noise emission according to '0+51 White 5KNXGT =M9J? =$VWJ? Internal unit External unit Internal unit External unit Exhaust air hose, length / Ø %QPPGEVKQPNKPGNGPIVJ Length internal / external unit Width internal / external unit H *GKIJVKPVGTPCNGZVGTPCNWPKV L W L W Weight internal / external unit 'SWKROGPVCPFHWPEVKQPU Dehumidification function *GCVKPIHWPEVKQP Ventilation function (ventilation without cooling operation) Water-air cooling Fan stages Automatic function (fully automatic operation) Adjustable air discharge direction Manual 5YKPIHWPEVKQP Infrared remote control / storage compartment %QPVTQNRCPGNYKVJOGODTCPGMG[U Display Microprocessor-controlled operation Automatic fault diagnosis system Night mode 6KOGTHWPEVKQP Room thermostat with temperature indication Anti-bacterial filter for improving the air SWCNKV[ 5VCPFCTF YCUJCDNG Activated carbon 5NKFKPIYKPFQYUGCNKPIUGV %CDNGJQNFGTECDNGUVQTCIGEQORCTVOGPV Wheels internal / external unit %CTT[KPIJCPFNGUKPVGTPCNGZVGTPCNWPKV 3WKEMEQWRNKPIHQTVJGEQPPGEVKQPQHKPVGTPCNGZVGTPCNWPKV Accessories #KT.QEMYKPFQYUGCN #KT.QEM|FQQTCPFYKPFQYUGCN 2#%TQNNGTUJWVVGTYKPFQYUETGGP 2#%YKPFQYCFCRVGT *QUGENCORHQTYKPFQYCFCRVGT 4CFKQEQPVTQNNGFUQEMGVVJGTOQUVCV$0 PAC 3000 X A+ OO Monobloc M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # OO OO sOO sOO sOO sMI 2#%:# / LED / / / 2#%:# PAC 3500 SH OO Monobloc M9 $VWJ M9 OJ NJ 8*\ M9 4 I V F$ # F$ # OO OO sOO sOO sOO sMI 2#%5* / LED / / / 2#%5* PAC 3500 OO Monobloc M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # OO OO sOO sOO sOO sMI 2#% / LED / / / 2#% PAC 3500 E OO Monobloc M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # OO OO sOO sOO sOO sMI 2#%' / .%& / / / 2#%' PAC 3500 S OO Monobloc M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # OO OO sOO sOO sOO sMI 2#%5 / LED / / / 2#%5 * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. AIR CONDITIONING PAC SERIES Constantly updated: www.trotec.com/catalogs Comfort air conditioners with a cooling capacity of up to 14,500 Btu/h Overview: Comfort air conditioners of the PAC series with a cooling capacity of up to 14,500 Btu/h Trotec Humidification Dehumidification SecoSan Air cleaning Heating Air cooling AiKrlicmoantidsitierouninngg Technical data Article number 5WKVCDNGHQTTQQOUUK\GFWRVQCRRTQZ Device type Max. cooling capacity *GCVKPIECRCEKV[ Max. air flow rate Dehumidifying capacity max. Input voltage Max. power input 6[RGQHTGHTKIGTCPV #OQWPVQHTGHTKIGTCPV )92HCEVQT %1GSWKXCNGPV 5QWPFRTGUUWTGNGXGN (distance 1 m) Noise emission according to '0+51 White 5KNXGT =M9J? =$VWJ? Internal unit External unit Internal unit External unit Exhaust air hose, length / Ø %QPPGEVKQPNKPGNGPIVJ Length internal / external unit Width internal / external unit *GKIJVKPVGTPCNGZVGTPCNWPKV Weight internal / external unit 'SWKROGPVCPFHWPEVKQPU Dehumidification function *GCVKPIHWPEVKQP Ventilation function (ventilation without cooling operation) Water-air cooling Fan stages Automatic function (fully automatic operation) Adjustable air discharge direction Infrared remote control / storage compartment %QPVTQNRCPGNYKVJOGODTCPGMG[U Display Microprocessor-controlled operation Automatic fault diagnosis system Night mode 6KOGTHWPEVKQP Room thermostat with temperature indication #PVKDCEVGTKCNHKNVGTHQTKORTQXKPIVJGCKTSWCNKV[ 5NKFKPIYKPFQYUGCNKPIUGV %CDNGJQNFGTECDNGUVQTCIGEQORCTVOGPV Wheels internal / external unit %CTT[KPIJCPFNGUKPVGTPCNGZVGTPCNWPKV 3WKEMEQWRNKPIHQTVJGEQPPGEVKQPQHKPVGTPCNGZVGTPCNWPKV Accessories #KT.QEMYKPFQYUGCN #KT.QEM|FQQTCPFYKPFQYUGCN 2#%TQNNGTUJWVVGTYKPFQYUETGGP 2#%YKPFQYCFCRVGT *QUGENCORHQTYKPFQYCFCRVGT 4CFKQEQPVTQNNGFUQEMGVVJGTOQUVCV$0 H L W L W Manual 5YKPIHWPEVKQP 5VCPFCTF YCUJCDNG Activated carbon PAC 3800 S OO Monobloc M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # OO OO sOO sOO sOO sMI 2#%5 / LED / / / 2#%5 PAC 3810 S OO Monobloc M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # OO OO sOO sOO sOO sMI 2#%5 / LED / / / 2#%5 PAC 3900 X OO Monobloc M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # OO OO sOO sOO sOO sMI 2#%: / LED / / / 2#%: PAC 4600 OO 5RNKV M9 $VWJ OJ NJ 8*\ M9 4 I V F$ # F$ # F$ # OO1) OO OO OO MI 2#% / LED / / / 2#% * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. 1) Not extendable, the effective length amounts to 2,300 mm An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info AIR CONDITIONING PAC SERIES Ventilation Cleaning Accessories AIR CONDITIONING Air conditioner without external unit with a cooling capacity of up to 9,000 Btu/h FRIEN O R290 AL REFRIGE PAC-W 2200 S Monobloc air conditioner 3-in-1 air conditioner: cooling, ventilation, dehumidification Automatic operation 2.2 kW / 8,000 Btu/h cooling capacity Timer function Noiseless night operation in whisper mode Indication of the current room temperature via app WLAN function for worldwide control 'SFF 5SPUFD{"TTJTUFOU BQQ GPS UFNQFSBUVSF settings as well as all functions and operating modes Self-evaporation function with energy-saving technology Removable air filter LED display Swing function for optimum air distribution IR remote control 3 Fan stages EC RANT DLY N ATUR ELEGANT WALL-MOUNTED AIR CONDITIONER WITHOUT EXTERNAL UNIT WITH PRACTICAL WLAN FUNCTION Monobloc air conditioners without an external unit can be easily and GQTVNGUUN[OQWPVGFQPVJGYCNNCVHQQVQTJGCFJGKIJVCPFCNYC[URTQvide cool and pleasant feel-good temperatures on hot summer days. All you have to do is drill two holes (ventilation slots) through the wall to guide the ventilation hoses to the outside, where they have to be covGTGFYKVJVJGXGPVKNCVKQPCRUKPENWFGFKPVJGUEQRGQHFGNKXGT[6JKUKU CNUQCITGCVCNVGTPCVKXGHQTTGPVGFCVUCUVJGTGKUPQPGGFVQRGTOCnently install a large outdoor system serving as a heat exchanger. 6JCPMU VQ VJG RTQXGP KPXGTVGT VGEJPQNQI[ GPGTI[ EQUVU ECP DG TGFWEGFD[WRVQ|YJKEJKUPQVQPN[IQQFPGYUHQTVJGGPXKTQPOGPV but also for your wallet. Furthermore, the slim and elegant design has nothing to hide and can DGQRVKOCNN[KPVGITCVGFKPCP[NKXKPIURCEGQTQEGGPXKTQPOGPV6JG YCNNOQWPVGFCKTEQPFKVKQPGT2#%9||5*KUCNUQGSWKRRGFYKVJC JGCVKPI CPF C FGJWOKFKECVKQP HWPEVKQP YJKEJ ECP CNUQ DG UGNGEVGF UGRCTCVGN[6JKUYC[VJGUOCTVCPFUKORNGCKTEQPFKVKQPGTECPPQVQPN[ be used in the hot summer, but all year round. +PCFFKVKQPVJG2#%9||5*EQOGUGSWKRRGFYKVJC9.#0HWPEVKQP and can thus be conveniently controlled via WLAN using the smartRJQPGCRR6JGEWTTGPVTQQOVGORGTCVWTGECPCNUQDGTGCFXKCVJGCRR *QYGXGTVJGCKTEQPFKVKQPGTECPDGCFLWUVGFPQVQPN[XKCVJGCRRDWV CNUQXKCVJGFKIKVCNFKURNC[QTVJG+4|TGOQVGEQPVTQN Inverter technology HOT& COOL O FRIEN R290 AL REFRIGE PAC-W 2650 SH Monobloc air conditioner 4-in-1 air conditioner: cooling, heating, ventilation, dehumidification Automatic operation 2.6 kW / 9,000 Btu/h cooling capacity 2.3 kW heating capacity Timer function Noiseless night operation in whisper mode Indication of the current room temperature via app WLAN function for worldwide control 'SFF 5SPUFD{"TTJTUFOU BQQ GPS UFNQFSBUVSF settings as well as all functions and operating modes Self-evaporation function with energy-saving technology Removable air filter LED display Swing function for optimum air distribution IR remote control 3 Fan stages 110 AIR CONDITIONING PAC-W SERIES EC RANT DLY N ATUR (TGG6TQVGE|#UUKUVGPVCRR for temperature settings as well as all functions and operating modes. Available in your App Store! INVERTER AIR CONDITIONERS OPERATE QUIETLY AND ENERGY-EFFICIENTLY +PXGTVGT CKT EQPFKVKQPGTU UWEJ CU VJG 2#%9 5* TGIWNCVG VJG room temperature without switching the cooling compressor on and Q 6JKU MGGRU VJG TQQO VGORGTCVWTG EQPUVCPV YKVJQWV WEVWCVKQPU Although the compressor consumes electricity continuously, it never QRGTCVGU CV HWNN NQCF 6JKU RTQVGEVU VJG VGEJPQNQI[ CPF FWG VQ VJG consistently low power consumption, inverter air-conditioning units EQQNXGT[GPGTI[GEKGPVN[CPFUCXGWRVQGPGTI[EQORCTGFVQC EQPXGPVKQPCNRTQFWEV6JCVRC[UQ PAC air conditioner with heat pump technology: M9 JGCVKPI ECRCEKV[ M9 RQYGT EQPUWORVKQP%12XCNWG FWGVQTQWPFKPI 6JG JGCV QWVRWV QH VJG CKT EQPFKVKQPGT KU VJWU ITGCVGT VJCP VJG RQYGT EQPUWORVKQPD[CHCEVQTQHCPFVJWUEQPUKFGTCDN[OQTGGEKGPV VJCP EQPXGPVKQPCN GNGEVTKE JGCVGTU YKVJ C %12 XCNWG QH FWG VQ identical power consumption and heat output). Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification SecoSan Air conditioner without external unit with a cooling capacity of up to 9,000 Btu/h Overview: Air conditioner without external unit of the PAC-W series with a cooling capacity of up to 9,000 Btu/h Technical data PAC-W 2200 S PAC-W 2650 SH Article number 5WKVCDNGHQTTQQOUUK\GFWRVQCRRTQZ OO OO Device type Monobloc Monobloc Max. cooling capacity =M9J? =$VWJ? M9 $VWJ M9 $VWJ *GCVKPIECRCEKV[ M9 Max. air flow rate OJ OJ Dehumidifying capacity max. NJ NJ Input voltage 8*\ 8*\ Max. power input M9 M9 6[RGQHTGHTKIGTCPV 4 4 #OQWPVQHTGHTKIGTCPV I I )92HCEVQT %1GSWKXCNGPV 5QWPFRTGUUWTGNGXGN (distance 1 m) Internal unit External unit V F$ # V F$ # Noise emission according to '0+51 Internal unit External unit F$ # F$ # Length Width OO OO H 1,000 mm 1,000 mm *GKIJV L W L W OO OO Weight MI MI 'SWKROGPVCPFHWPEVKQPU 2#%95 2#%95* Dehumidification function *GCVKPIHWPEVKQP Ventilation function (ventilation without cooling operation) Fan stages Automatic function (fully automatic operation) Adjustable air discharge direction Manual 5YKPIHWPEVKQP Infrared remote control / storage compartment %QPVTQNRCPGNYKVJOGODTCPGMG[U / / Display LED LED Microprocessor-controlled operation Automatic fault diagnosis system Night mode 6KOGTHWPEVKQP Room thermostat with temperature indication Anti-bacterial filter for 5VCPFCTF YCUJCDNG KORTQXKPIVJGCKTSWCNKV[ Activated carbon 5NKFKPIYKPFQYUGCNKPIUGV %CDNGJQNFGTECDNGUVQTCIGEQORCTVOGPV / / Wheels internal / external unit %CTT[KPIJCPFNGUKPVGTPCNGZVGTPCNWPKV / / / / * Functionally, this device contains a hermetic system with fluorinated greenhouse gas as a refrigerant in the specified specifications and with a greenhouse gas potential corresponding to the indicated GWP factor. Air cleaning Heating Air cooling AiKrlicmoantidsitierouninngg Ventilation Cleaning Accessories An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info AIR CONDITIONING PAC-W SERIES 111 AIR COOLING AIR COOLERS OF THE PAE SERIES MOBILE AIR CONDITIONING RESULTING FROM EFFICIENT EVAPORATION COOLING PRACTICAL KNOWLEDGE A comprehensive overview of device differences, GUIDE functional principles and possible applications of the air conditioners and air coolers can be found at: ROOM COOLING EVERYTHING YOU NEED TO KNOW! uk.trotec.com/air-condition-info PAE 35 HEPA PAE 11 PAE 12 HOT& COOL PAE 19 H PAE 21 PAE 22 PAE 25 PAE 30 PAE 31 PAE 40 PAE 45 PAE 49 / PAE 50 AIR COOLING PAE SERIES PAE 51 PAE 60 / PAE 61 PAE 80 / PAE 81 Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification ADIABATIC COOLING WITH MOBILE AIR COOLERS 6JGEQQNKPIYKVJCKTEQQNGTUKUCEQORNGVGN[PCVWTCNCPFKPGZRGPUKXG During winter, they increase the humidity because of the dry, heated EQQNKPIOGVJQFYKVJQWVJKIJGPGTI[TGSWKTGOGPVUQHCPCKTEQPFKVKQPGT air. Air coolers are therefore used throughout the year: in the summer for the cooling process. CUGXCRQTCVKXGCKTEQQNGTUKPYKPVGTCUCJWOKFKGT $WVCPCKTEQQNGTKUVJGTGHQTGCNUQPQCKTEQPFKVKQPGTTGICTFNGUUQHVGO- A big advantage of air coolers however, is that they have no exhaust perature and humidity, cold air is generated. An air conditioner produces JQUGHQTJQVCKTNKMGCNNOQDKNGCKTEQPFKVKQPKPI6JKUFQGUPQVJCXGVQ EQNFFGJWOKFKGFKGFT[EQNFCKT*QYGXGTCPCKTEQQNGTWUGUVJG DGRNCEGFVJTQWIJCYKPFQYCFQQTQTCYCNNQRGPKPI6JCVOCMGUCKT principle of evaporative moist cooling air. Depending on the humidity EQQNGTUGZVTGOGN[GZKDNGCPFGCU[VQJCPFNGUKPEGVJG[QPN[JCXGVQ and temperature an air cooler can, regardless of the model and the type, be installed and turned on, no matter where. EQQNFQYPVJGQWVNGVCKTVGORGTCVWTGD[CHGYFGITGGU% Air coolers are only suitable for small spaces and dry climates, because ADIABATIC COOLING WATER DEPOT VJGGEKGPE[ECPPQVDGTCKUGFUQUKORN[NKMGD[VJCVQHCPCKTEQPFKVKQPGT In addition, each user of an air cooler should be clear that this is not CDNGVQEQQNFQYPCTQQOQH%VQ% #KTEQQNGTUCTGOQUVGGEVKXGKPTQQOUYKVJFT[CKTCPFVJQUGVJCVCTG CDNGVQFTQRKPVGORGTCVWTGYKVJCPCKTUCVWTCVKQPNKOKV6JGFGXKEGUYQTM D[FKTGEVEQQNKPIKGVJG[EJCPIGVJGCKTFKTGEVN[VQOQKUVWTG6JKUJCU CVVJGUCOGVKOGVJGEQPUGSWGPEGFWGVQVJKURTQEGUUVJGJWOKFKV[KP the room rises noticeably, which is not always desired. Humidified cold air Dry warm air HONEYCOMB FILTER 6JGRJ[UKECNRTKPEKRNGQHCFKCDCVKEEQQNKPIYKVJOQDKNGCKTEQQNGTU SecoSan Air cleaning Heating Air cooling Air conditioning SOME BASICS ABOUT COOLING TECHNOLOGY FOR A BETTER UNDERSTANDING: 9KVJCKTEQQNGTUCPFCKTEQPFKVKQPGTUVJGUKVWCVKQPKUOWEJNKMGVJCVQHCDKMGCPFCECT#VTUVUKIJVDQVJUGGOVQUGTXGVJGUCOGRWTRQUG[GV VGEJPKECNN[VJGUGCTGEQORNGVGN[FKGTGPVU[UVGOUVJCVCNNQYPQVFKTGEVEQORCTKUQPYKVJQPGCPQVJGT #KTEQQNGTUUWEJCUVJG2#'CTGFKTGEVGXCRQTCVKQPCKTEQQNGTUCPFWPNKMGCKTEQPFKVKQPGTUFQPQVEQOGGSWKRRGFYKVJCEQQNKPIWPKV NKMG CHTKFIG#KTEQQNGTUWUGVJGPCVWTCNRTKPEKRNGQHYCVGTGXCRQTCVKQPVQEQQNVJGTQQOCKT'XGT[QPGMPQYUVJKUEQQNKPIGGEVHQTGZCORNGHTQO UYGCVGXCRQTCVKQPQTEQQNGTCKTKPVJGXKEKPKV[QHYCVGTHCNNUTKXGTUCPFNCMGU #RTKPEKRCNN[UKOKNCTOGVJQFKUQHVGPCRRNKGFQWVQHFQQTU QWVFQQTECHÅUOCTSWGGUGVE#PGLGVQHYCVGTKUIWKFGFKPHTQPVQHVJGCKTEWTTGPV QHCHCPTGUWNVKPIKPCPWNVTCPGURTC[OKUV&WTKPIVJKUFKURGTUCNVQETGCVGCUQTVQHCVQOK\GFURTC[VJGFTQRNGVUGXCRQTCVGCPFKPFQKPIUQEQQN VJGCKTUNKIJVN[D[CHGYFGITGGU6JGTGUWNVKUCOQTGCITGGCDNGENKOCVGKPVJKUDGFTK\\NGFCTGC #KTEQQNGTUQPN[QRGTCVGGEKGPVN[KPTQQOUEQPVCKPKPITCVJGTFT[CKT NGUUVJCP4*CPFVJG[ECPQPN[TGFWEGVJGVGORGTCVWTGWPVKNTGCEJKPI VJGCKTUCVWTCVKQPNKOKVHQTGZCORNGHTQO%4*VQCVJGQTGVKECNXCNWGQHOCZKOCNN[%4*#NDGKVVJKUVGORGTCVWTGFKGTGPEGKUC OGTGVJGQT[CPFPQVTGNGXCPVKPRTCEVKEGHQTYKVJCTGNCVKXGJWOKFKV[NGXGNQHKPVJGTQQOVJGRGTEGKXGFENKOCVGYQWNFDGGZVTGOGN[OWII[ and sweltering (see comfort chart). 1TFKPCTKN[VJGOQDKNGCKTEQQNGTUQHVJG2#'UGTKGUECPDGWUGFVQCEJKGXGVGORGTCVWTGFKGTGPEGUQH%KPUOCNNGTTQQOUYKVJQWVKPETGCUKPI the humidity to a disagreeably high level depending on initial humidity level and temperature. 6JGGEKGPE[QHCKTEQQNGTUFGRGPFUQPXCTKQWUHCEVQTUUWEJCUVJGHCPRGTHQTOCPEGCPFVJGUWTHCEGCTGCQHVJGGXCRQTCVKQPNVGT#UECPDG seen from the theoretical example values, the use of direct coolers simultaneously causes the humidity level in the room to rise perceptibly for process-related reasons, which is not always desirable. An increasing humidity level also reduces the devices' cooling capacity. %QPUGSWGPVN[VJGEQQNKPIGEKGPE[QHCKTEQQNGTUKUFKTGEVN[FGRGPFent on the overall weather conditions: Air coolers accomplish maxiOWO GEKGPE[ KP JQV CPF FT[ CKT 5VKEM[ JQV EQPFKVKQPU QP VJG QVJGT hand allow for hardly any cooling. Yet worse: Owing to the additional JWOKFKECVKQP QH VJG CNTGCF[ XGT[ JWOKF CKT VJG TQQO ENKOCVG KU RGTceived as even more unpleasant. 5GGKPICUVJKUEKTEWOUVCPEGKUECWUGFD[VJGRTQEGUUKVEQPEGTPUCNN CKTEQQNGTUQPVJGOCTMGVCNVJQWIJUQOGEQORGVKVQTUoQGTUUWIIGUV otherwise. An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info AIR COOLING PAE SERIES Ventilation Cleaning Accessories AIR COOLING Air coolers with an evaporation performance of up to 0.9 l/h PAE 11 Evaporation air cooler 3-in-1 air cooler: air cooling, ventilation, air freshening Efficient cooling by evaporation with honeycomb technology Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Improving the indoor climate Adjustable discharge direction and automatically swivelling fins Night mode 3 Fan stages Timer function IR remote control Suitable for year-round operation! Air cooler in the summer, humidifier in the winter PAE 12 Evaporation air cooler 3-in-1 air cooler: air cooling, ventilation, air freshening Efficient cooling by evaporation with honeycomb technology Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Improving the indoor climate Adjustable discharge direction and automatically swivelling fins Night mode 3 fan stages Timer function IR remote control Suitable for year-round operation! Air cooler in the summer, humidifier in the winter HOT& COOL PAE 19 H Evaporation air cooler Adjustable discharge direction and auto- 4-in-1 air cooler: air cooling, heating, ventilation and air freshening matically swivelling fins Night mode 2 heating levels (1,400 W / 2,000 W) 3 Fan stages with swing function Intelligent and efficient thermal control of preset Timer function heating values (22/29/36 °C) IR remote control Efficient cooling by evaporation with honeycomb Drying function for hygienically perfect storage technology Easy to transport thanks to sturdy wheels Possibility to operate with included freezer pack and practical carrying handle or ice cubes to increase the cooling capacity Suitable for year-round operation! Air cooler in Improving the indoor climate the summer, heating & humidifier in the winter AIR COOLING PAE SERIES PAE 21 Evaporation air cooler 2-in-1 air cooler: air cooling and ventilation Efficient cooling by evaporation with honeycomb technology Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Improving the indoor climate Adjustable discharge direction and automatically swivelling fins 3 Fan stages Highly energy-efficient Quiet operation Easy to transport thanks to sturdy wheels and light weight Suitable for year-round operation! Air cooler in the summer, humidifier in the winter Constantly updated: www.trotec.com/catalogs Air coolers with an evaporation performance of up to 1.1 l/h Trotec Humidification Dehumidification SecoSan Air cleaning Heating Air cooling Air conditioning PAE 22 Evaporation air cooler 3-in-1 air cooler: air cooling, ventilation, air freshening Efficient cooling by evaporation with honeycomb technology Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Improving the indoor climate Adjustable discharge direction and automatically swivelling fins Night mode 4 Fan stages Timer function IR remote control Suitable for year-round operation! Air cooler in the summer, humidifier in the winter PAE 25 Evaporation air cooler 3-in-1 air cooler: air cooling, ventilation, air freshening Efficient cooling by evaporation with honeycomb technology Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Improving the indoor climate Adjustable discharge direction and automatically swivelling fins Night mode 4 Fan stages Timer function LED display Highly energy-efficient Quiet operation IR remote control Easy to transport thanks to sturdy wheels and light weight Suitable for year-round operation! Air cooler in the summer, humidifier in the winter PAE 30 Evaporation air cooler in tower fan design 3-in-1 air cooler: air cooling, ventilation, air freshening Efficient cooling by evaporation with honeycomb technology Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Improving the indoor climate Adjustable discharge direction and automatically swivelling fins Night mode 4 Fan stages Timer function Highly energy-efficient IR remote control Convenient cable winder Suitable for year-round operation! Air cooler in the summer, humidifier in the winter An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info PAE 31 Evaporation air cooler 3-in-1 air cooler: air cooling, ventilation, air freshening Optimum air circulation thanks to turbospin technology Air ejection distance of up to 10 metres Aerodynamically shaped air outlet fins providing a powerful 360° airflow 3 air filters ensuring effective air cooling Efficient cooling by evaporation with honeycomb technology Improving the indoor climate Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Adjustable air discharge direction Night mode 3 fan levels with swing function Timer function IR remote control Suitable for year-round operation! Air cooler in the summer, humidifier in the winter AIR COOLING PAE SERIES Ventilation Cleaning Accessories AIR COOLING Air coolers with an evaporation performance of up to 0.9 l/h Overview: Air coolers of the PAE series with an evaporation performance of up to 1.1 l/h Technical data PAE 11 PAE 12 PAE 19 H PAE 21 PAE 22 PAE 25 Article number White $NCEM Max. evaporation performance NJ NJ NJ NJ NJ NJ Amount of air OJ OJ OJ OJ OJ OJ *GCVKPIECRCEKV[ 5VCIG 5VCIG M9 M9 Input voltage 8*\ 8*\ 8*\ 8*\ 8*\ 8*\ Power input 9 9 9 9 9 9 Water supply N N N N N N 5QWPFRTGUUWTGNGXGN FKUVCPEGO F$ # F$ # F$ # F$ # F$ # F$ # Length OO OO OO OO OO OO Width H OO OO OO OO OO OO *GKIJV L W OO OO OO OO OO OO Weight MI MI MI MI MI MI 'SWKROGPVCPFHWPEVKQPU PAE 11 2#' 2#'* 2#' 2#' 2#' Operating modes Air cooling function Air freshening function Ventilation function (ventilation without cooling operation) Air purification function *GCVKPIHWPEVKQP 5WKVCDNGHQTQRGTCVKQPYKVJHTGG\GTRCEMUQTKEGEWDGU 5WRRNKGFKEGRCEMU 1 Fan stages Adjustable air discharge direction Manual 5YKPIHWPEVKQP 6WTDQURKPVGEJPQNQI[ CKTEKTEWNCVKQP Ioniser 5YKVEJCDNG Automatically 5EGPVGFQKNVCPMCPFFKHHWUGTHQTQRVKOWOTQQOCKTCTQOCVK\CVKQP Infrared remote control / storage compartment / / / / / / %QPVTQNRCPGN %QPVTQNDWVVQPU %QPVTQNDWVVQPU %QPVTQNDWVVQPU %QPVTQNDWVVQPU %QPVTQNDWVVQPU %QPVTQNDWVVQPU Display LED LED LED LED Night mode 6KOGTHWPEVKQP Water filling level indicator Warning signal to indicate a low water level #WVQOCVKEUYKVEJQHHYJGPYCVGTVCPMKUGORV[ Permanent water connection Filter drying function 5VCPFCTF YCUJCDNG Anti-bacterial filter for improving VJGCKTSWCNKV[ *QPG[EQODHKNVGT *'2#HKNVGT %CDNGJQNFGTECDNGUVQTCIGEQORCTVOGPV / / / / / / 9JGGNURCTMKPIDTCMGHGGV / / / / / / / / / / / / %CTT[JCPFNGU Accessories PAE 11 2#' 2#'* 2#' 2#' 2#' 5RCTGEQQNRCEMU RKGEGU Evaporation filter Air filter *'2#HKNVGT 5GEQ5CP5VKEM Descaler 1000 ml LiQVit hygiene agent 1000 ml 5QEMGVJ[ITQUVCV$* 6JGTOQJ[ITQOGVGT$</ 6JGTOQJ[ITQOGVGT$</ 6JGTOQJ[ITQOGVGT$</ AIR COOLING PAE SERIES Constantly updated: www.trotec.com/catalogs Air coolers with an evaporation performance of up to 1.1 l/h Trotec Humidification Dehumidification SecoSan Air cleaning Heating Overview: Air coolers of the PAE series with an evaporation performance of up to 1.1 l/h Technical data PAE 30 PAE 31 PAE 35 HEPA Article number White $NCEM Max. evaporation performance NJ 1.1 l/h NJ Amount of air OJ OJ OJ *GCVKPIECRCEKV[ 5VCIG 5VCIG Input voltage 8*\ 8*\ 8*\ Power input 9 9 9 Water supply N N N 5QWPFRTGUUWTGNGXGN FKUVCPEGO F$ # F$ # F$ # Length OO OO OO Width H OO OO OO *GKIJV L W OO OO OO Weight MI MI MI 'SWKROGPVCPFHWPEVKQPU 2#' 2#' 2#'*'2# Operating modes Air cooling function Air freshening function Ventilation function (ventilation without cooling operation) Air purification function *GCVKPIHWPEVKQP 5WKVCDNGHQTQRGTCVKQPYKVJHTGG\GTRCEMUQTKEGEWDGU 5WRRNKGFKEGRCEMU 1 Fan stages Adjustable air discharge direction Manual 5YKPIHWPEVKQP 6WTDQURKPVGEJPQNQI[ CKTEKTEWNCVKQP Ioniser 5YKVEJCDNG Automatically 5EGPVGFQKNVCPMCPFFKHHWUGTHQTQRVKOWOTQQOCKTCTQOCVK\CVKQP Infrared remote control / storage compartment / / / %QPVTQNRCPGN %QPVTQNDWVVQPU %QPVTQNDWVVQPU %QPVTQNDWVVQPU Display LED Night mode 6KOGTHWPEVKQP Water filling level indicator Warning signal to indicate a low water level #WVQOCVKEUYKVEJQHHYJGPYCVGTVCPMKUGORV[ Permanent water connection Filter drying function 5VCPFCTF YCUJCDNG Anti-bacterial filter for improving VJGCKTSWCNKV[ *QPG[EQODHKNVGT *'2#HKNVGT %CDNGJQNFGTECDNGUVQTCIGEQORCTVOGPV / / / 9JGGNURCTMKPIDTCMGHGGV / / / / / / %CTT[JCPFNGU Accessories 2#' 2#' 2#'*'2# 5RCTGEQQNRCEMU RKGEGU Evaporation filter Air filter *'2#HKNVGT 5GEQ5CP5VKEM Descaler 1000 ml LiQVit hygiene agent 1000 ml 5QEMGVJ[ITQUVCV$* 6JGTOQJ[ITQOGVGT$</ 6JGTOQJ[ITQOGVGT$</ 6JGTOQJ[ITQOGVGT$</ An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info CONTINUOUS FRESH WATER SUPPLY TO ENSURE A HEALTHY AIR QUALITY 6QCWVQOCVKECNN[MGGRVJGYCVGTUVQTCIG VCPMCUENGCPCUQPVJGTUVFC[YGTGEQOOGPF WUKPI C 5GEQ5CP5VKEM YJKEJ MGGRU VJG YCVGT RGTOCPGPVN[ ENGCP clear and free from germs or unpleasant QFQWTU 6JG WPKSWG HGCVWTG QH 5GEQ5CP is its antimicrobial surface with mobile silver ions, which inhibit bacteria and germs upon contact and thus prevent VJGKTTGRTQFWEVKQP6JGGPVKTGN[UGNHFQUKPI5GEQ5CPKQPTGUGTXQKTMGGRUVJGYCVGT FGOQPUVTCDN[ HTGG HTQO IGTOU 6JG UVKEMVJWUIWCTCPVGGUENGCPYCVGTHQTWR VQOQPVJUGXGPKHVJGYCVGTKUEJCPIGF or consumed daily. USING AIR COOLERS AS HUMIDIFIERS DURING THE WINTERTIME #KT EQQNGTU CTG OQUV GEKGPV KP TQQOU NNGF YKVJ FT[ CKT ,WUV NKMG JWOKFKGTU these devices operate based on the evaporation principle, i.e. they directly supply VJG CKT YKVJ EQQN OQKUVWTG 6JKU OGCPU that for process-related reasons the humidity level in the room is increased perceptibly. During the winter this increase QH JWOKFKV[ KU DGPGEKCN VQ VJG OWEQWU membranes. As a result you might be able to avoid catching a cold that is largely ECWUGFD[VJGFT[JGCVGFCKT6JGRTCEVK- cal and optically attractive thermohyITQOGVGT $</ in cross-needle design shows you at a glance when the humidity level is in the optimum range. AIR COOLING PAE SERIES Air cooling Air conditioning Ventilation Cleaning Accessories AIR COOLING Air coolers with an evaporation performance of up to 2.0 l/h PAE 35 HEPA Evaporation air cooler 4-in-1 air cooler: air cooling, ventilation, air freshening and air purification 95% effective HEPA filtering of viruses, bacteria, pollen, dust mite residue, mould fungus spores and other allergens Air purification function Efficient cooling by evaporation with honeycomb technology Improved air cleaning thanks to HEPA filter and ionizer Colour LED display showing the current humidity level Possibility to operate with an included freezer pack or ice cubes to increase the cooling capacity Adjustable discharge direction and automatically swivelling fins Night mode 3 fan levels with swing function Timer function IR remote control Drying function for hygienically perfect storage Suitable for year-round operation! Air cooler in the summer, humidifier in the winter PAE 40 Evaporation air cooler 3-in-1 air cooler: air cooling, ventilation, air freshening Efficient cooling by evaporation with honeycomb technology Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Improved air cleaning thanks to ionizer Adjustable discharge direction and automatically swivelling fins Night mode 4 fan levels with swing function Timer function IR remote control Suitable for year-round operation! Air cooler in the summer, humidifier in the winter PAE 4125 Evaporation air cooler 3-in-1 air cooler: air cooling, ventilation, air freshening Remarkable wind current range thanks to turbospin technology Air ejection distance of up to 15 metres Aerodynamically shaped air outlet fins providing a powerful 360° airflow 3 air filters ensuring effective air cooling Efficient cooling by evaporation with honeycomb technology Improving the indoor climate Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Adjustable discharge direction and automatically swivelling fins Night mode 5 fan stages Timer function IR remote control Drying function for hygienically perfect storage Suitable for year-round operation! Air cooler in the summer, humidifier in the winter PAE 49 / PAE 50 Evaporation air cooler 4-in-1 air cooler: air cooling, ventilation, air freshening and air purification Efficient cooling by evaporation with honeycomb technology Possibility to operate with four included freezer packs or ice cubes to increase the cooling capacity Improved air cleaning thanks to ionizer Integrated scented oil diffuser for an optional room air aromatization Adjustable discharge direction and automatically swivelling fins Night mode 4 Fan stages Timer function IR remote control Continuous operation enabled by a permanent water connection Suitable for year-round operation! Air cooler in the summer, humidifier in the winter AIR COOLING PAE SERIES Constantly updated: www.trotec.com/catalogs Air coolers with an evaporation performance of up to 2.8 l/h Trotec Humidification Dehumidification SecoSan Air cleaning PAE 51 Evaporation air cooler 3-in-1 air cooler: air cooling, ventilation, air freshening Efficient cooling by evaporation with honeycomb technology Possibility to operate with freezer packs or ice cubes to increase the cooling capacity Improving the indoor climate Adjustable discharge direction and automatically swivelling fins Night mode 4 Fan stages Timer function Energy-efficient Quiet operation IR remote control Easy to transport thanks to sturdy wheels Suitable for year-round operation! Air cooler in the summer, humidifier in the winter PAE 60 / PAE 61 Evaporation air cooler 3-in-1 air cooler: air cooling, ventilation, air freshening Efficient cooling by evaporation with honeycomb technology Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Improving the indoor climate Adjustable discharge direction and automatically swivelling fins Night mode 3 fan stages Timer function IR remote control Space-saving storage Permanent water connection possible for continuous commercial operation Suitable for year-round operation! Air cooler in the summer, humidifier in the winter Suited for large living, business or event spaces sized up to 72 m² or 180 m³ Heating Air cooling Air conditioning Ventilation Cleaning Accessories PAE 80 / PAE 81 Evaporation air cooler 3-in-1 air cooler: air cooling, ventilation, air freshening Efficient cooling by evaporation with honeycomb technology Possibility to operate with two included freezer packs or ice cubes to increase the cooling capacity Improving the indoor climate Adjustable discharge direction and automatically swivelling fins Night mode 3 fan stages Timer function IR remote control Space-saving storage Permanent water connection possible for continuous commercial operation Suitable for year-round operation! Air cooler in the summer, humidifier in the winter Suited for large living, business or event spaces sized up to 80 m² or 200 m³ An overview of device differences, functional principles and possible applications of the air conditioners and air coolers can be found at: uk.trotec.com/air-condition-info AIR COOLING PAE SERIES AIR COOLING Air coolers with an evaporation performance of up to 2.8 l/h Overview: Air coolers of the PAE series with an evaporation performance of up to 2.8 l/h Technical data PAE 40 PAE 45 PAE 49 / 50 PAE 51 PAE 60 / 61 PAE 80 / 81 Article number White Black 1.210.003.017 1.210.003.018 1.210.003.019 1.210.003.020 1.210.003.025 1.210.003.031 1.210.003.030 1.210.003.051 1.210.003.050 Max. evaporation performance 1.1 l/h 1.2 l/h 2 l/h 2 l/h 2.6 l/h 2.8 l/h Amount of air 370 m³/h 1,700 m³/h 750 m³/h 661 m³/h 900 m³/h 1,000 m³/h Input voltage 220 - 240 V/50 Hz 220 - 240 V/50 Hz 220 - 240 V/50 Hz 220 - 240 V/50 Hz 220 - 240 V/50 - 60 Hz 220 - 240 V/50 - 60 Hz Power input 68 W 90 W 145 W 110 W 100 W 125 W Water supply 10 l 10 l 20 l 20 l 40 l 60 l Sound pressure level (distance 1 m) 64 dB(A) 60 dB(A) 63 dB(A) 60 dB(A) 56 dB(A) 59 dB(A) Length Width 380 mm 290 mm 390 mm 390 mm 395 mm 395 mm H 310 mm 368 mm 350 mm 342 mm 405 mm 405 mm Height Weight L W 760 mm 940 mm 880 mm 897 mm 980 mm 1,115 mm 10 kg 7.5 kg 13 kg 8 kg 14 kg 18 kg Equipment and functions PAE 40 PAE 45 PAE 49 / 50 PAE 51 PAE 60 / 61 PAE 80 / 81 Operating modes Air cooling function 3 3 3 3 3 3 Air freshening function Ventilation function (ventilation without cooling operation) Air purification function Suitable for operation with freezer packs or ice cubes Supplied ice packs 2 2 4 4 4 Fan stages 4 5 4 4 4 4 Adjustable air discharge direction Manual Swing function Turbospin technology 360° air circulation Ioniser Switchable Automatically Scented oil tank and diffuser for optimum room air aromatization Infrared remote control / storage compartment Control panel Display Night mode Timer function Water filling level indicator / Membrane keys / Control buttons / Control buttons LED / Control buttons / Control buttons Touch / Control buttons Touch Warning signal to indicate a low water level Automatic switch-off when water tank is empty Permanent water connection Filter drying function Standard (washable) Anti-bacterial filter for improving the air quality Honeycomb filter HEPA filter Cable holder / cable storage compartment Wheels / parking brake / feet Carry handles / / / / / / / / / / / / / / / / / / Accessories PAE 40 PAE 45 PAE 49 / 50 PAE 51 PAE 60 / 61 PAE 80 / 81 Spare cool packs (2 pieces) 7.310.000.367 7.310.000.367 7.310.000.367 7.310.000.367 7.310.000.367 7.310.000.367 Evaporation filter Air filter HEPA filter (95%) 7.710.000.862 7.710.000.021 7.710.000.066 7.710.000.066 7.710.000.862 7.710.000.863 7.710.000.860 7.710.000.859 7.710.000.867 7.710.000.866 / 7.710.000.868 7.710.000.867 7.710.000.866 / 7.710.000.868 SecoSan Stick 10 6.100.004.110 6.100.004.110 6.100.004.110 6.100.004.110 6.100.004.110 6.100.004.110 Descaler 1000 ml 6.100.004.199 6.100.004.199 6.100.004.199 6.100.004.199 6.100.004.199 6.100.004.199 LiQVit hygiene agent 1000 ml 6.100.004.185 6.100.004.185 6.100.004.185 6.100.004.185 6.100.004.185 6.100.004.185 Socket hygrostat BH30 6.100.004.205 6.100.004.205 6.100.004.205 6.100.004.205 6.100.004.205 Thermohygrometer BZ20M 3.510.205.013 3.510.205.013 3.510.205.013 3.510.205.013 3.510.205.013 3.510.205.013 Thermohygrometer BZ21M 3.510.205.018 3.510.205.018 3.510.205.018 3.510.205.018 3.510.205.018 3.510.205.018 Thermohygrometer BZ22M 3.510.205.019 3.510.205.019 3.510.205.019 3.510.205.019 3.510.205.019 3.510.205.019 120 AIR COOLING PAE SERIES Constantly updated: www.trotec.com/catalogs EFFECTIVE. CARE AND PROTECTION BY TROTEC. Descaler Reliable Descaling with colour indication Universally applicable: air conditioners, humidifiers, coffee machines, espresso machines, and much more. 100% biodegradable Suitable for appliances by all manufacturers Safety-lock / child lock LiQVit Hygienic product for humidifiers Ensures hygienically perfect evaporation water in the humidifier Prevents germination, algae, mould and bacteria Lime and mineral deposits are reduced Improves evaporation performance SecoSan Silver-ion sticks for tap water hygiene Active system based on bacteria inhibitory property of silver Completely food-safe Objectively, no change in taste detectable (laboratory tested) Effective for 6 months even with a daily change of water www.trotec.com TRT-ANZ-IMG-HP-LQV_ENK_SCS-HS-003-EN VENTILATION FANS OF THE TVE SERIES REFRESHING COOLNESS ON HOT DAYS TVE 9 TVE 8 TVE 11 TVE 10 TVE 14 TVE 18 TVE 15 TVE 17 TVE 100 TVE 17 S TVE 15 S TVE 16 TVE 18 S TVE 23 S TVE 24 S TVE 25 S TVE 26 S TVE 29 T TVE 30 T TVE 31 T TVE 32 T TVE 36 T TVE 39 T TVE 40 T 122 VENTILATION TVE SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Table fans of the TVE series TVE 8 / TVE 9 Power of 25 watts Low operating costs 2 Speed levels Automatically oscillating by 90° with switch-off function Inclination angle of the fan head adjustable by up to 30° Metal grid for protection at the front and rear Fan blade diameter: 23 cm Convenient carrying handle Stable and non-slip base for secure footing to prevent tipping over Low noise level: max. 56.5 dB(A) TVE 10 / TVE 11 Power of 25 watts Low operating costs 2 Speed levels Automatically oscillating by 80° with switch-off function Inclination angle of the fan head adjustable by up to 30° Metal grid for protection at the front and rear Fan blade diameter: 23 cm Convenient carrying handle Stable and non-slip base for secure footing to prevent tipping over Low noise level: max. 50 dB(A) SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation Cleaning TVE 14 / TVE 18 Power of 50 watts Low operating costs 3 Speed levels Automatically oscillating by 90° with switch-off function Inclination angle of the fan head adjustable by up to 60° Metal grid for protection at the front and rear Fan blade diameter: 40 cm Convenient carrying handle Stable and non-slip base for secure footing to prevent tipping over Low-noise operation: max. 53 dB(A) TVE 15 / TVE 17 Power of 40 watts Low operating costs 3 Speed levels Automatically oscillating by 80° with switch-off function Inclination angle of the fan head adjustable by up to 30° Metal grid for protection at the front and rear Fan blade diameter: 40 cm Convenient carrying handle Stable and non-slip base for secure footing to prevent tipping over Low-noise operation: max. 57 dB(A) VENTILATION TVE SERIES 123 Accessories VENTILATION Table fans of the TVE series TVE 100 Power of 26 watts Optimal air circulation and considerable 32 Speed levels Patented swing design Automatically oscillating by 30° - 360° with range of the wind flow thanks to turbo spin technology Integrated fragrance oil container and diffuser for optional room air aromatisation switch-off function Automatic inclination angle of the fan head by up to 90° Stable base for tilt-proof stand Carrying handle for easy transport Fan blade diameter: 19 cm Timer function (1 - 12 hours) 3 different operating modes including LED display whisper-quiet night mode IR remote control Aerodynamically shaped air outlet blades enable a strong airflow Energy saving mode Quiet operation Overview: Table fans of the TVE series Technical data Article number Fan stages Number of fan blades Fan blade diameter Oscillation White Black Input voltage Power input Sound pressure level Cable length Length Width Height Weight Equipment and functions Operating modes Natural wind mode Night mode Turbospin technology LED display Timer function IR remote control Adjustable inclination angle Adjustable in height Carry handles W H H H L LW LW 124 VENTILATION TVE SERIES TVE 8 / 9 1.510.005.011 1.510.005.010 2 3 9 " / 23 cm 90° TVE 10 / 11 1.510.005.012 1.510.005.013 2 3 9 " / 23 cm 80° TVE 14 / 18 1.510.005.018 1.510.005.022 3 3 16 " / 40 cm 90° TVE 15 / 17 1.510.005.020 1.510.005.021 3 3 16 " / 40 cm 80° TVE 100 1.510.005.100 32 3 7.55 " / 19.2 cm 360° 220 - 240 V / 50 Hz 220 - 240 V / 50 Hz 220 - 240 V / 50 Hz 220 - 240 V / 50 Hz 220 - 240 V / 50 Hz 25 W 56,5 dB(A) 1.5 m 210 mm 270 mm 370 mm 1 kg TVE 8 / 9 25 W 50 dB(A) 1.8 m 220 mm 280 mm 390 mm 1.5 kg TVE 10 / 11 50 W 53 dB(A) 1.45 m 228 mm 406 mm 530 mm 2 kg TVE 14 / 18 40 W 57 dB(A) 1.8 m 280 mm 430 mm 620 mm 2.5 kg TVE 15 / 17 26 W 56 dB(A) 1.75 m 255 mm 237 mm 374 mm 2.5 kg TVE 100 3 Constantly updated: www.trotec.com/catalogs Pedestal fans of the TVE series Trotec Humidification Dehumidification SecoSan Air cleaning TVE 15 S / TVE 17 S Power of 40 watts Low operating costs 3 Speed levels Automatically oscillating by 80° with switch-off function Inclination angle of the fan head adjustable by up to 30° Steplessly adjustable in height between 105 and 122 cm Metal grid for protection at the front and rear Fan blade diameter: 40 cm Convenient carrying handle Broad base for high stability Low-noise operation: max. 57 dB(A) TVE 16 / TVE 18 S Power of 50 watts Low operating costs 3 Speed levels Automatically oscillating by 90° with switch-off function Inclination angle of the fan head adjustable by up to 30° Steplessly adjustable in height between 110 and 129 cm Metal grid for protection at the front and rear Fan blade diameter: 40 cm Convenient carrying handle Broad base for high stability Low-noise operation: max. 52.5 dB(A) Heating Air cooling Air conditioning Ventilation Cleaning TVE 23 S Power of 50 watts Low operating costs 3 Speed levels Automatically oscillating by 80° with switch-off function Inclination angle of the fan head adjustable by up to 30° Height-adjustable between 96 and 130 cm Metal grid for protection at the front and rear Fan blade diameter: 40 cm Broad base for high stability Low-noise operation: max. 60 dB(A) TVE 24 S Power of 48 watts Low operating costs 8 Speed levels Automatically oscillating by 80° with switch-off function Inclination angle of the fan head adjustable by up to 30° Height-adjustable between 70 and 130 cm Metal grid for protection at the front and rear Fan blade diameter: 40 cm Timer function LED display IR remote control Broad base for high stability Low-noise operation: max. 60 dB(A) VENTILATION TVE SERIES 125 Accessories VENTILATION Pedestal fans of the TVE series TVE 25 S Power of 40 watts Low operating costs 3 Speed levels Automatically oscillating by 80° with switch-off function Inclination angle of the fan head adjustable by up to 30° Steplessly adjustable in height between 110 and 130 cm Metal grid for protection at the front and rear Fan blade diameter: 40 cm Timer function IR remote control Convenient carrying handle Broad base for high stability Low-noise operation: max. 57 dB(A) TVE 26 S Power of 30 watts Low operating costs 26 Speed levels Natural wind mode, night mode, comfort mode, silent operation and normal operation Automatically oscillating by 85° with switch-off function Inclination angle of the fan head adjustable by up to 20° Steplessly adjustable in height between 120 and 137 cm Metal grid for protection at the front and rear Fan blade diameter: 40 cm Timer function LED display IR remote control Convenient carrying handle Broad base for high stability Low-noise operation: max. 59 dB(A) 126 VENTILATION TVE SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Pedestal fans of the TVE series Overview: Pedestal fans of the TVE series Technical data Article number Fan stages Number of fan blades Fan blade diameter Oscillation Input voltage Power input Sound pressure level Cable length Length Width Height Weight Equipment and functions Operating modes Natural wind mode Night mode LED display Timer function IR remote control Adjustable inclination angle Adjustable in height Carry handles White Black W H H H L LW LW TVE 15 S / 17 S TVE 16 / 18 S 1.510.005.030 1.510.005.032 3 3 16 " / 40 cm 80° 220 - 240 V / 50 Hz 40 W 57 dB(A) 1.8 m 720 mm 720 mm 1,220 mm 3 kg TVE 15 S / 17 S 1.510.005.031 1.510.005.033 3 3 16 " / 40 cm 90° 220 - 240 V / 50 Hz 50 W 52.5 dB(A) 1.5 m 520 mm 520 mm 1,290 mm 2.414 kg TVE 16 / 18 S TVE 23 S 1.510.005.043 3 3 16 " / 40 cm 80° 220 - 240 V / 50 Hz 50 W 60 dB(A) 1.8 m 400 mm 450 mm 1,300 mm 5.5 kg TVE 23 S TVE 24 S 1.510.005.044 8 5 16 " / 40 cm 80° 220 - 240 V / 50 Hz 48 W 60 dB(A) 1.8 m 450 mm 450 mm 1,300 mm 6 kg TVE 24 S 1 TVE 25 S 1.510.005.045 3 3 16 " / 40 cm 80° 220 - 240 V / 50 Hz 40 W 57 dB(A) 1.5 m 435 mm 435 mm 1,300 mm 5 kg TVE 25 S TVE 26 S 1.510.005.046 26 5 16 " / 40 cm 85° 220 - 240 V / 50 Hz 30 W 59 dB(A) 1.5 m 453 mm 450 mm 1,370 mm 7 kg TVE 26 S 5 SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation Cleaning Accessories VENTILATION TVE SERIES 127 VENTILATION Tower fans of the TVE series TVE 29 T Power of 45 watts Modern, space-saving pillar design Low operating costs 3 Speed levels Automatically oscillating by 60° with switch-off function Integrated carrying handle Secure footing Low-noise operation: max. 58 dB(A) TVE 30 T Power of 45 watts Modern, space-saving pillar design Low operating costs 3 Speed levels Automatically oscillating by 60° with switch-off function Timer function Integrated carrying handle Secure footing Low-noise operation: max. 60 dB(A) TVE 31 T Power of 45 watts Modern, space-saving pillar design Low operating costs 3 Speed levels Natural wind mode, night mode and normal operation Automatically oscillating by 60° with switch-off function Timer function LED display Current room temperature indication IR remote control Integrated carrying handle Secure footing Low-noise operation: max. 58.5 dB(A) 128 VENTILATION TVE SERIES TVE 32 T Power of 45 watts Modern, space-saving pillar design Low operating costs 3 Speed levels Natural wind mode, night mode and normal operation Automatically oscillating by 60° with switch-off function Timer function LED display Current room temperature indication IR remote control Integrated carrying handle Secure footing Low-noise operation: max. 58.5 dB(A) Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Tower fans of the TVE series TVE 36 T Power of 45 watts Modern, space-saving pillar design Low operating costs 3 Speed levels Natural wind mode, night mode and normal operation Automatically oscillating by 60° with switch-off function Timer function LED display IR remote control Integrated carrying handle Secure footing Low-noise operation: max. 62 dB(A) TVE 39 T Power of 45 watts Modern, space-saving pillar design Low operating costs 6 Speed levels Natural wind mode, night mode and normal operation Automatically oscillating by 60° with switch-off function Timer function LED display IR remote control Integrated carrying handle Secure footing Low-noise operation: max. 58 dB(A) SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation Cleaning TVE 40 T Power of 45 watts Modern, space-saving pillar design Low operating costs 6 Speed levels Natural wind mode, night mode and normal operation Automatically oscillating by 60° with switch-off function Timer function LED display IR remote control Integrated carrying handle Secure footing Low-noise operation: max. 57 dB(A) VENTILATION TVE SERIES 129 Accessories VENTILATION Tower fans of the TVE series Overview: Tower fans of the TVE series Technical data Article number Fan stages Number of fan blades Fan blade diameter Oscillation Input voltage Power input Sound pressure level Cable length Length Width Height Weight Equipment and functions Operating modes Natural wind mode Night mode LED display Timer function IR remote control Adjustable inclination angle Adjustable in height Carry handles White Black W H H H L LW LW TVE 29 T 1.510.005.061 3 / 60° 220 - 240 V / 50 Hz 45 W 58 dB(A) 1.5 m 240 mm 240 mm 765 mm 2 kg TVE 29 T TVE 30 T 1.510.005.062 3 / 60° 220 - 240 V / 50 Hz 45 W 60 dB(A) 1.9 m 240 mm 240 mm 760 mm 3 kg TVE 30 T TVE 31 T 1.510.005.063 3 / 60° 220 - 240 V / 50 - 60 Hz 45 W 58.5 dB(A) 1.5 m 250 mm 250 mm 920 mm 2.5 kg TVE 31 T 3 TVE 32 T 1.510.005.064 3 / 60° 220 - 240 V / 50 - 60 Hz 45 W 58.5 dB(A) 1.5 m 300 mm 300 mm 1,119 mm 3 kg TVE 32 T 3 130 VENTILATION TVE SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Tower fans of the TVE series Overview: Tower fans of the TVE series Technical data Article number Fan stages Number of fan blades Fan blade diameter Oscillation Input voltage Power input Sound pressure level Cable length Length Width Height Weight Equipment and functions Operating modes Natural wind mode Night mode LED display Timer function IR remote control Adjustable inclination angle Adjustable in height Carry handles White Black W H H H L LW LW TVE 36 T 1.510.005.068 3 / 60° 220 - 240 V / 50 Hz 45 W 62 dB(A) 1.8 m 330 mm 330 mm 920 mm 3.5 kg TVE 36 T 3 TVE 39 T 1.510.005.069 6 / 60° 220 - 240 V / 50 Hz 45 W 58 dB(A) 1.6 m 300 mm 300 mm 1,080 mm 5.5 kg TVE 39 T 3 TVE 40 T 1.510.005.070 6 / 60° 220 - 240 V / 50 Hz 45 W 57 dB(A) 1.5 m 325 mm 325 mm 1,111 mm 5.5 kg TVE 40 T 3 SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation Cleaning Accessories VENTILATION TVE SERIES 131 VENTILATION Fans of the TVM series TVM 11 / TVM 12 Power of 37 watts 3 Speed levels Inclination angle of the fan head adjustable by up to 100° Metal grid with modern chrome/copper look for protection at the front and rear 'BO CMBEF EJBNFUFS {DN Stable and non-slip base for secure footing to prevent tipping over Long lifetime thanks to motor with copper coil Low-noise operation Integrated cable winder Convenient carrying handle TVM 13 / TVM 14 Power of 44 watts 3 Speed levels Inclination angle of the fan head adjustable by up to 100° Metal grid with modern chrome/copper look for protection at the front and rear 'BO CMBEF EJBNFUFS {DN Stable and non-slip base for secure footing to prevent tipping over Long lifetime thanks to motor with copper coil Low-noise operation Integrated cable winder Convenient carrying handle TVM 17 / TVM 18 Power of 100 watts 3 Speed levels Inclination angle of the fan head adjustable by up to 110° Metal grid with modern chrome/copper look for protection at the front and rear 'BO CMBEF EJBNFUFS {DN Stable and non-slip base for secure footing to prevent tipping over Long lifetime thanks to motor with copper coil Low-noise operation Integrated cable winder Convenient carrying handle 132 VENTILATION TVM SERIES TVM 18 S Power of 100 watts 3 Speed levels Inclination angle of the fan head adjustable by up to 110° Steplessly adjustable in height between BOE {DN Metal grid with modern chrome look for protection at the front and rear 'BO CMBEF EJBNFUFS {DN Stable and non-slip base for secure footing to prevent tipping over Long lifetime thanks to motor with copper coil Low-noise operation Integrated cable winder Convenient carrying handle Constantly updated: www.trotec.com/catalogs Fans of the TVM series Trotec Humidification Dehumidification SecoSan Air cleaning Heating Air cooling Air conditioning TVM 20 D Power of 120 watts 3 Speed levels Inclination angle of the fan head adjustable by up to 360° Metal grid for protection at the front and rear 'BO CMBEF EJBNFUFS {DN Stable and non-slip base for secure footing to prevent tipping over Long lifetime thanks to motor with copper coil Low-noise operation Convenient carrying handle TVM 24 D Power of 124 watts 3 Speed levels Inclination angle of the fan head adjustable by up to 135° Metal grid for protection at the front and rear 'BO CMBEF EJBNFUFS {DN Stable and non-slip base for secure footing to prevent tipping over Long lifetime thanks to motor with copper coil Low-noise operation Integrated cable winder Convenient carrying handle Overview: Fans of the TVM series Technical data Article number Fan stages Number of fan blades Fan blade diameter Input voltage Power input Sound pressure level Cable length Length Width Height Weight Equipment and functions Adjustable inclination angle Adjustable in height Carry handles Cable winder Accessories Wall and ceiling holder Chrome Copper Black W H L H L W TVM 11 / 12 TVM 13 / 14 TVM 17 / 18 TVM 18 S TVM 20 D TVM 24 D 1.510.006.011 1.510.006.021 1.510.006.031 1.510.006.061 1.510.006.010 1.510.006.020 1.510.006.030 1.510.006.041 1.510.006.051 3 3 3 3 3 3 3 3 3 3 3 3 12 " / 30 cm 14 " / 35 cm 18 " / 45 cm 18 " / 45 cm 20 " / 50 cm 24 " / 60 cm 220 - 240 V / 50 Hz 220 - 240 V / 50 Hz 220 - 240 V / 50 Hz 220 - 240 V / 50 Hz 220 - 240 V / 50 Hz 220 - 240 V / 50 Hz 37 W 44 W 100 W 100 W 120 W 124 W 58 dB(A) 59 dB(A) 65 dB(A) 65 dB(A) 65 dB(A) 72.4 dB(A) 1.5 m 1.5 m 1.5 m 1.5 m 1.5 m 1.5 m 185 mm 175 mm 180 mm 450 mm 205 mm 200 mm 395 mm 440 mm 540 mm 540 mm 585 mm 720 mm 375 mm 435 mm 535 mm 1,350 mm 575 mm 685 mm 2.8 kg 3 kg 4.5 kg 8 kg 5 kg 9.3 kg TVM 11 / 12 TVM 13 / 14 TVM 17 / 18 TVM 18 S TVM 20 D TVM 24 D TVM 11 / 12 TVM 13 / 14 TVM 17 / 18 TVM 18 S TVM 20 D TVM 24 D 6.100.007.022 6.100.007.022 6.100.007.022 6.100.007.022 6.100.007.022 6.100.007.022 VENTILATION TVM SERIES 133 Ventilation Cleaning Accessories CLEANING Cordless vacuum cleaners 1111244072 VC 10 E Development, design, production: 100 % Trotec 7.4 V lithium-ion battery (1.3 Ah) without memory effect and without self-discharge 2-stage battery charging status indication Can be cleaned quickly and easily due to easily removable container and washable permanent dust filter system Large container with a capacity of up to 400 ml of dry dirt and 150 ml of liquid Operating time of 12 minutes with undiminished suction power Crevice nozzle for poorly accessible locations Squeegee nozzle for quick absorption of liquids Extension hose (1 m) for cleaning poorly accessible locations Convenient wall holder with charger Original Trotec design protected design patent VC 10-20V 20 V lithium-ion battery (2 Ah) without memory effect and without self-discharge Three-stage battery level indication integrated in the battery Strong suction power on all surfaces Can be cleaned easily and quickly thanks to the bin that can be removed without any effort Compact design with ergonomic handle and slip-resistant soft grip equipment Large container with a capacity of up to 400 ml of dry dirt and 150 ml of liquid Operating time of 18 minutes with undiminished suction power Crevice nozzle for poorly accessible locations VC 150 E / VC 155 E Multifunctional use as a cordless upright vacuum cleaner or cordless hand-held vacuum cleaner 25.2 V lithium-ion battery (2 Ah) without memory effect, without self-discharge Strong suction power on all dry surfaces in two suction levels Efficient filter system with cyclone technology High-performance filter (HEPA) catches 99 % of all fine particles Large dust container with a capacity of 650 ml dry dirt Quick and easy emptying of the dust container Washable dust collection container High dust retention capacity Electrical floor nozzle with LED front light for illumination of dark areas Up to 40 minutes of constantly high suction power Flexible and agile handling Operating control lamp, battery level indication and suction power indication Compact design for space-saving storage 134 CLEANING VC SERIES VC 15-20V 20 V lithium-ion battery (2 Ah) without memory effect and without self-discharge Three-stage battery level indication integrated in the battery Strong suction power on all surfaces Can be cleaned easily and quickly thanks to the bin that can be removed without any effort High-performance filter (HEPA) catches 89.66 % of all fine particles Large container with a capacity of 10 litres of dry dirt and 2.7 litres of liquid Integrated discharge function Operating time of 15 minutes with undiminished suction power Crevice nozzle for poorly accessible locations Upholstery and mattress nozzle for thorough cleaning Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Wet and dry vacuum cleaner VC 1200W Highly efficient and powerful thanks to highperformance 1,200 W motor 2-in-1 spray extraction cleaner with combined suction and spray hose Strong suction power on all surfaces Spray surface and extract dirt in just one workstep Can be cleaned easily and quickly thanks to the suction unit that can be removed without any effort High-performance filter (HEPA) catches 90.00 % of all fine particles Washable foam filter for wet vacuuming The dust bag supplied can be used for dry vacuuming Large container with a capacity of 8 litres of dry dirt and 6 litres of liquid Large tank for 3.5 litres of detergent Integrated spraying function Integrated discharge function Integrated filter cleaning function Water tank filling level indication Crevice nozzle for poorly accessible locations Floor nozzle for all hard floors Large and small spray nozzle for all surfaces SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation RCelieniagniunngg Accessories CLEANING VC SERIES 135 CLEANING Vacuum cleaners Overview: Vacuum cleaners Technical data Article number Power input Battery voltage Battery capacity Battery charging time Input voltage charger Housing design Capacity of the dust container Dry dirt Liquids Reinigungsmittelbehälter-Kapazität Length Width Height Weight Equipment and functions Wet vacuum cleaning function Dry vacuum cleaning function Blow-out function Suction washing function Can be used as external dust extraction for compatible power tools ON/OFF switch Battery level indication Washable dust filter Washable HEPA filter Wall holder Rolls Three-stage battery level indication integrated in the battery Accessories Spare battery Flexpower 20V 2.0 Ah Spare battery Flexpower 20V 4.0 Ah HEPA filter (99%) HEPA filter (89,66%) (4 pieces) HEPA filter (90,00%) Vacuum cleaner pipe Brush roller Upholstery and mattress nozzle Flat nozzle Paper dust bag VC 10 E 4.655.000.010 40 W 7.4 V 1.3 Ah 6 h 100 - 240 V / 50 - 60 Hz Plastic 400 ml 150 ml 90 mm 370 mm 135 mm 0.7 kg VC 10 E VC 10 E VC 10-20V 4.655.000.015 65 W 20 V 2.0 Ah 1 h 230 - 240 V / 50 Hz Plastic 400 ml 100 ml 80 mm 440 mm 145 mm 1.3 kg VC 10-20V VC 10-20V 6.200.000.303 6.200.000.320 7.399.000.006 VC 150 E 4.655.000.020 150 W 25.2 V 2.0 Ah 6 h 100 - 240 V / 50 - 60 Hz Plastic 650 ml 230 mm 250 mm 1,112 mm 1.5 kg VC 150 E VC 150 E 7.710.000.020 7.399.000.003 VC 155 E 4.655.000.021 150 W 25.2 V 2.0 Ah 6 h 100 - 240 V / 50 - 60 Hz Plastic 650 ml 230 mm 250 mm 1,112 mm 1.5 kg VC 155 E VC 155 E 7.710.000.020 7.399.000.003 VC 15-20V 4.655.000.100 130 W 20 V 2.0 Ah 1 h 230 - 240 V / 50 Hz Plastic 10,000 ml 2,700 ml 270 mm 280 mm 410 mm 3.5 kg VC 15-20V VC 15-20V 6.200.000.303 6.200.000.320 7.710.000.033 7.399.000.006 7.399.000.004 7.399.000.005 VC 1200W 4.655.000.200 1,200 W 230 V / 50 Hz Stainless steel 8,000 ml 6,000 ml 3,500 ml 360 mm 330 mm 525 mm 7.5 kg VC 1200W VC 1200W 7.710.000.035 7.710.000.036 136 CLEANING VC SERIES Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification High pressure cleaner PPWS 10-20V Powerful 20 V lithium-ion battery without memory effect and without selfdischarge Flexpower multi-device battery 20 V 2.0 Ah can be flexibly combined also with other 20 V cordless tools Ideally suited for areas without a power and water connection Self-priming function for using alternative water sources such as buckets, rain barrels, cisterns or wells Dual operation irrigation and power cleaning For effortless cleaning work around the house and garden or for watering plants Efficient medium pressure of 22 bar for gentle cleaning Spray lance with practical multi-function nozzle for adjusting 6 spray modes Also suitable for use with cleaning agent a nozzle with cleaning agent reservoir is included Quick coupling compatible with commercially available garden hose / water tap connections Technical data Article number Battery voltage Battery capacity Battery charging time Pressure max. Flow rate Suction height ideal max. Spraying range Number of spray functions Spraying angles Detergent tank capacity Input voltage charger Length Width Height Weight Equipment and functions Water jet Gentle jet Self-priming function Switch-on lock Rotatable nozzle attachment Quick coupling Spray function indicator For use with detergent Three-stage battery level indication integrated in the battery Hose Filter Spray attachment / Spray lance / Multi-function nozzle Carrying net Removable battery Quick charger Accessories Spare battery Flexpower 20V 2.0 Ah Spare battery Flexpower 20V 4.0 Ah PPWS 10-20V 4.450.000.101 20 V 2.0 Ah 1 h 22 bar / 320 psi 120 l/h 1.5 m 4 m 7 m 6 0° / 15°/ 25°/ 40° 400 ml 230 - 240 V/50 Hz 65 mm 930 mm 210 mm 1 kg PPWS 10-20V 6 m / / PPWS 10-20V 6.200.000.303 6.200.000.320 SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation RCelieniagniunngg Accessories CLEANING PPWS SERIES 137 POWER CONSUMPTION Power strips PVH3 3-way protective contact socket strip with 2 USB charging ports (type A). Increased touch protection (protection class IP20) for more safety 2.4 A for fast charging of USB devices such as smartphones or tablets, or for powering devices with USB ports Compact design: fits on any desk, in a notebook bag and in carry-on luggage Long 1.5 m cable Illuminated power-saving switch to turn off all devices with one push of a button Robust workmanship (heat resistant and shockproof) PVH5 5-way protective contact socket strip with 2 USB charging ports (type A). Increased touch protection (protection class IP20) for more safety 2.4 A for fast charging of USB devices such as smartphones or tablets, or for powering devices with USB ports Compact design: fits on any desk, in a notebook bag and in carry-on luggage Long 1.5 m cable Illuminated power-saving switch to turn off all devices with one push of a button Robust workmanship (heat resistant and shockproof) Overview: Power strips Technical data Article number Cable length Cross-section Number of cores Type Connector plug Supply voltage Frequency Rated current consumption Number of sockets Number of USB ports USB charging current (max.) Child lock Power-saving switch Length Width Height Weight PVH3 7.333.000.201 1.5 m 1.5 mm² 3 H05VV-F 3G CEE 7/7 230 V 50 Hz 16 A 3 2 2.4 A 237 mm 49 mm 40 mm 0.79 kg PVH5 7.333.000.205 1.5 m 1.5 mm² 3 H05VV-F 3G CEE 7/7 230 V 50 Hz 16 A 5 2 2.4 A 318 mm 49 mm 40 mm 0.9 kg 138 POWER CONSUMPTION Constantly updated: www.trotec.com/catalogs READY TO GO. TOOLS BY TROTEC. Strong in price and performance. You have the ideas, we have the tools. Regardless if you are screwing, drilling, sawing, cutting or sanding - the Trotec PowerTools are convincing in practice. You can rely on reliable brand quality, strong performance and an unmatched price-performance ratio in your work. Cordless Screwdriver Cordless Drills Cordless Hammer Drills Cordless Impact Driver Cordless Rotary Hammers Rotary Hammers Drills Multifunctional Tools Jigsaws Circular Saws Reciprocating Saws Planer Multifunction Grinder Belt Grinders Angle Grinder Hot Air Blowers Compressors Electric Stapler Hot Glue Guns Battery Work Lights Accessories and much more... www.trotec.com TRT-ANZ-IMG-HP-WRKZ-HS-007-EN ACCESSORIES Handy aids and accessories for practical applications BC06 Thermohygrometer n Measurement of relative humidity, air temperature, dewpoint and wetbulb temperature n Dual display for parallel presentation of measured values n Maximum or minimum value and hold function Article number 3.510.205.005 BP21 Pyrometer n Non-contact surface temperature measurement from -35 °C to +800 °C n Measuring spot diameter display due to dual laser technology n Measuring optic 12:1 Article number 3.510.003.031 BM22 Moisture measuring device n Wood and material moisture measurement with one device n Double scale for wood moisture and material moisture n Calibration curve for standard types of wood n With LED moisture indicator Article number 3.510.205.025 BD8M 3-in-1 Laser distance meter n Laser meter for measuring distances and quickly calculating area and room dimensions indoors n Including Pythagoras function, cross line laser and integrated measuring tape n Laser: 0.05 up to 40 m, measuring tape: 0 up to 5 m, cross line laser: approx. 10 m Article number 3.510.205.157 BY10 Tyre pressure meter n Digital measuring device for quick and precise tyre pressure control n +PVGITCVGFCUJNKIJV n Suitable for all valves Article number 3.510.205.910 BW10 pH measuring device n Two-line display for the simultaneous indication of pH value and water temperature n Three-point calibration ex factory n Automatic calibration for pH 4.01/7.00/10.01 n +PENR*DWGTUQNWVKQPUGV and protective cape Article number 3.510.205.810 BH30 Socket hygrostat n %QPUVCPVJWOKFKV[TGIWNCVKQPQHJWOKFKGTU CPFFGJWOKFKGTUVQCUGVXCNWG n Regulation of the humidity level between 20 % and 90 % RH n $WGTDCVVGT[HQTUVQTCIGQHUGNGEVGFUGVVKPIU BN30 Socket thermostat n Suited for heating and cooling control n Operating range from -10 °C to +70 °C n Quick adjustment of the programme temperature possible n Adjustment from 5 °C to 30 °C Article number 6.100.004.205 140 ACCESSORIES Article number 6.100.007.009 BN35 Radio controlled socket thermostat n Suited for heating and cooling control n Operating range from 0 °C to +70 °C n Comprehensive programming options n Automatic frost protection system (5 °C) n Suitable for switching up to 100 radio- controlled sockets Article number 6.100.007.008 Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification Handy aids and accessories for practical applications BZ01 Digital alarm clock n Simultaneous display of time, date, room temperature, humidity and symbolic weather trend forecast n Compact table and wall unit in an attractive design n &KURNC[QHOKPKOWOCPFOCZKOWOXCNWGU n Alarm function with snooze button Article number 3.510.205.000 BZ06 Designer weather station n Simultaneous indication of room temperature, humidity level, date, time, weekday and symbolic weather forecast n Supplies helpful information for preventing mould growth n &KURNC[QHOKPKOWOCPFOCZKOWOXCNWGU n Alarm function with snooze button Article number 3.510.205.016 BZ07 Weather station and indoor climate monitoring unit n Simultaneous indication of room temperature, humidity level, time or date, weather forecast, feel-good indication and temperature WEVWCVKQPU n Symbolic weather forecast indication n 5KORNKGFHGGNIQQFKPFKECVKQP n Alarm function with snooze button Article number 3.510.205.017 SecoSan Air cleaning Heating Air cooling Air conditioning Ventilation BZ29OS Radio weather station with outdoor sensor n KPEQODKPCVKQPFGXKEGYKVJKPFQQTCPF outdoor temperature and humidity display n Display of time time, weekday, date, weather forecast, feel-good indicator and air pressure n #KTRTGUUWTGEJCPIGUQXGTVJGRCUVJQWTU n Adjustable outdoor temperature alarm n (TQUVCNCTOHTQO% Article number 3.510.205.058 PBCS series battery chargers n 8DCVVGT[EJCTIGTU #VQ##JVQ#J n +FGCNHQTXGJKENGUYKVJ8DCVVGT[ n Automatically adjusts to the battery voltage Article numbers: PBCS 2A: 4.675.000.001 / PBCS 4A: 4.675.000.005 PBCS 6A: 4.675.000.010 / PBCS 10A: 4.675.000.015 PVC extension cable n +PRWVXQNVCIG8 n 0QOKPCNEWTTGPV# n %CDNGETQUUUGEVKQPOO n Plug / coupling: CEE 7/7 n %CDNGNGPIVJO Article number 7.333.000.373 BQ30 Particle measuring device n Indication of CO2 pollution, current room temperature and humidity level n /GCUWTGOGPVQHPGRCTVKEWNCVGUYKVJCOCZ FKCOGVGTQH2/CPF2/ n Additional colour indicator display with automatic acoustic alarm for the quick detection of critical particle concentrations Article number 3.510.205.805 BZ26 CO2 air quality monitor n Simultaneous display of CO2 concentration, room temperature, air humidity, time, date and well-being indicator n /KPKOWOCPFOCZKOWOXCNWGHWPEVKQPHQT%12 , air temperature and humidity n Compact table-top or wall-mounted unit n Alarm function with snooze button Article number 3.510.205.055 MultiMeasure Mobile ready BQ21 Particle measuring device n Compact environmental measuring unit for the FGVGEVKQPQHPGFWUVRQNNWVKQPCPFENKOCVGFCVC n Additional colour indicator display with automatic acoustic alarm for the quick detection of critical particle concentrations n Bluetooth® interface for recording the data in the MultiMeasure Mobile app Article number 3.510.205.095 ACCESSORIES Cleaning AcZcuebseshoröires INDEX A F P Accessories............................................. 140 Fan heaters................................................ 70 PAC 2010 E ............................................... 100 Air cleaning ............................................... 42 Fans........................................................... 122 PAC 2010 SH ............................................ 100 Air conditioning......................................... 98 PAC 2100 X ............................................... 100 Air coolers ............................................... 112 PAC 2600 X ............................................... 100 Air cooling................................................ 112 H #KTJWOKFKGTU........................................... 30 Heating ....................................................... 48 PAC 2610 E ............................................... 101 PAC 2610 S ............................................... 101 Air washers ............................................... 38 *'2#NVGT ......................................... 10, 118 PAC 3000 X A+ ......................................... 104 Aircooler .................................................. 112 High pressure cleaner ........................... 137 PAC 3500 E ............................................... 104 AirgoClean® 10 E....................................... 43 *WOKFKECVKQP ........................................... 30 PAC 3500 S ............................................... 105 AirgoClean® 100 E..................................... 43 PAC 3500 SH ............................................ 104 AirgoClean® 11 E....................................... 43 PAC 3500................................................... 104 AirgoClean® 110 E..................................... 44 I AirgoClean® 140 E / 145 E ........................ 44 Infrared heating panels ........................... 94 PAC 3800 S ............................................... 105 PAC 3810 S ............................................... 105 AirgoClean® 15 E....................................... 43 Infrared heating panels ........................... 94 PAC 3900 X ............................................... 105 AirgoClean® 150 E..................................... 44 Infrared radiant heaters .......................... 48 PAC 4600................................................... 106 AirgoClean® 170 E / 171 E ........................ 44 Infrared....................................................... 48 PAC-W 2200 S.......................................... 110 AirgoClean® 200 E..................................... 45 IR 1200 S..................................................... 49 PAC-W 2650 SH....................................... 110 AirgoClean® 250 E..................................... 45 IR 1500 SC .................................................. 60 PAE 11....................................................... 114 AirgoClean® 350 E..................................... 45 IR 1510 SC .................................................. 60 PAE 12....................................................... 114 AirgoClean® One....................................... 45 IR 1550 SC .................................................. 60 PAE 19 H ................................................... 114 Airlock ...................................................... 107 IR 2000 C..................................................... 61 PAE 21....................................................... 114 AW 10 S ...................................................... 38 IR 2000 S..................................................... 49 PAE 22....................................................... 115 AW 20 S ...................................................... 38 IR 2000 SC .................................................. 60 PAE 25....................................................... 115 IR 2001 ........................................................ 52 PAE 30....................................................... 115 IR 2005 SC .................................................. 61 PAE 31....................................................... 115 B B 2 E ............................................................ 32 IR 2005 ........................................................ 52 IR 2010 S..................................................... 49 PAE 35 HEPA............................................ 118 PAE 40....................................................... 118 B 24 E / B 25 E............................................ 36 IR 2010 SC .................................................. 61 PAE 45....................................................... 118 B 3 E / B 4 E................................................ 32 IR 2050 ........................................................ 52 PAE 49 / PAE 50 ....................................... 118 B 400 ........................................................... 36 IR 2200 ........................................................ 52 PAE 51....................................................... 119 B 5 E ............................................................ 32 IR 2400 ........................................................ 53 PAE 60 / PAE 61 ....................................... 119 B 7 E ............................................................ 32 IR 2570 S..................................................... 49 PAE 80 / PAE 81 ....................................... 119 IR 3050 ........................................................ 53 Pedestal fans........................................... 125 IRD 1200...................................................... 58 Pedestal radiant heaters......................... 64 C Ceramic fan heaters................................. 74 IRD 1800...................................................... 58 IRD 2400...................................................... 58 2GNVKGTFGJWOKFKGTU.................................. 6 Power consumption ............................... 138 Cleaning ................................................... 134 IRD 3200...................................................... 58 Power strips ............................................ 138 Comfort air conditioners.......................... 98 IRS 1200 E................................................... 64 PPWS 10-20V........................................... 137 %QOHQTVFGJWOKFKGTU ............................... 4 IRS 1500 E................................................... 64 PVH3 ......................................................... 138 %QPFGPUCVKQPFGJWOKFKGT..................... 12 IRS 2000 E................................................... 64 PVH5 ......................................................... 138 Convectors................................................. 80 IRS 2005...................................................... 66 Cordless high-pressure cleaner .......... 137 IRS 2010 E................................................... 64 Cordless vacuum cleaners ................... 134 IRS 2010...................................................... 66 R IRS 2020...................................................... 66 Radiant ceiling heaters............................ 60 IRS 2050 E................................................... 65 Radiant heaters......................................... 48 D Dark radiant heater .................................. 56 IRS 2110...................................................... 66 IRS 2520...................................................... 67 &GJWOKFKECVKQP......................................... 4 &GJWOKFKGTU .............................................. 4 IRS 3020...................................................... 67 S SecoSan sticks ......................................... 40 &GUKEECPVFGJWOKFKGTU ........................... 8 SecoSan..................................................... 40 O 1KNNNGFTCFKCVQTU..................................... 88 142 INDEX Constantly updated: www.trotec.com/catalogs Trotec Humidification Dehumidification SecoSan Air cleaning T Table fans................................................. 122 TCH 1 E ....................................................... 81 TCH 1510 E ................................................. 83 TCH 18 E ..................................................... 81 TCH 19 E ..................................................... 81 TCH 20 E ..................................................... 81 TCH 2010 E / TCH 2011 E .......................... 83 TCH 2025 E ................................................. 83 TCH 21 E ..................................................... 82 TCH 22 E ..................................................... 82 TCH 23 E ..................................................... 82 TCH 2310 E / TCH 2311 E .......................... 83 TCH 25 E / TCH 26 E .................................. 82 TCH 2510 E ................................................. 84 TFC 1 E / TFC 2 E........................................ 75 TFC 13 E / TFC 14 E.................................... 75 TFC 16 E ...................................................... 75 TFC 17 E ...................................................... 76 TFC 19 E ...................................................... 76 TFC 20 E ...................................................... 76 TFC 21 E ...................................................... 76 TFC 220 E .................................................... 77 TFC 25 E ...................................................... 77 TFH 19 E...................................................... 72 TFH 20 E...................................................... 72 TFH 2000 E.................................................. 72 TFH 22 E...................................................... 72 TIH 1100 S .................................................. 96 TIH 300 S .................................................... 95 TIH 400 S .................................................... 95 TIH 500 S .................................................... 95 TIH 700 S .................................................... 95 TIH 900 S .................................................... 96 Tower fans ............................................... 128 TRH 20 E ..................................................... 89 TRH 21 E ..................................................... 89 TRH 22 E ..................................................... 89 TRH 23 E ..................................................... 89 TRH 24 E ..................................................... 90 TRH 25 E / TRH 26 E .................................. 90 TRH 27 E ..................................................... 90 TRH 28 E ..................................................... 90 TTK 100 E.................................................... 24 TTK 120 E.................................................... 25 TTK 120 S.................................................... 25 TTK 122 E.................................................... 25 TTK 127 E.................................................... 25 TTK 26 E...................................................... 12 TTK 27 HEPA .............................................. 10 TTK 30 E...................................................... 12 TTK 32 E...................................................... 12 TTK 33 E...................................................... 14 TTK 52 E...................................................... 16 TTK 53 E...................................................... 16 TTK 54 E...................................................... 16 TTK 60 E...................................................... 16 TTK 64 HEPA .............................................. 10 TTK 66 E...................................................... 20 TTK 67 E...................................................... 20 TTK 68 E...................................................... 20 TTK 70 HEPA (Plus)................................... 10 TTK 71 E...................................................... 20 TTK 72 E...................................................... 21 TTK 73 E...................................................... 21 TTK 75 E...................................................... 21 TTK 90 E...................................................... 24 TTK 95 E...................................................... 24 TTK 96 E...................................................... 24 TTK 99 HEPA .............................................. 10 TTP 1 E.......................................................... 6 TTP 10 E........................................................ 6 TTP 2 E.......................................................... 6 TTP 5 E.......................................................... 6 TTR 50 E........................................................ 8 TTR 57 E........................................................ 8 TVE 10 / TVE 11........................................ 123 TVE 100 ..................................................... 124 TVE 14 / TVE 18........................................ 123 TVE 15 / TVE 17........................................ 123 TVE 15 S / TVE 17 S................................. 125 TVE 16 / TVE 18 S .................................... 125 TVE 23 S.................................................... 125 TVE 24 S.................................................... 125 TVE 25 S.................................................... 126 TVE 26 S.................................................... 126 TVE 29 T.................................................... 128 TVE 30 T.................................................... 128 TVE 31 T.................................................... 128 TVE 32 T.................................................... 128 TVE 36 T.................................................... 129 TVE 39 T.................................................... 129 TVE 40 T.................................................... 129 TVE 8 / TVE 9............................................ 123 TVM 11 / TVM 12..................................... 132 TVM 13 / TVM 14..................................... 132 TVM 17 / TVM 18..................................... 132 TVM 18 S .................................................. 132 TVM 20 D.................................................. 133 TVM 24 D.................................................. 133 V Vacuum cleaner...................................... 134 VC 10 E...................................................... 134 VC 10-20V ................................................. 134 VC 1200W ................................................. 135 VC 150 E / VC 155 E ................................. 134 VC 15-20V ................................................. 134 Ventilation ................................................ 122 W Water hygiene........................................... 40 Wet and dry vacuum cleaner ............... 135 Heating Air cooling Air conditioning Ventilation Cleaning Accessories INDEX 143 Trotec GmbH Grebbener Straße 7 52525 Heinsberg Germany Phone +49 2452 962-450 online-en@trotec.com en.trotec.com/shop Home is Trotec. Comfortable climate by using Home Comfort products. Trotec is one of the world`s leading brands when it comes to good climate. Professionals test our products. Promoting everyday performance. Under the toughest conditions. These tested Trotec quality products can also be used in your home. For more healthy air. For an optimized home climate. This TROTEC. AT HOME catalog provides information and the Home Comfort products that can sustainably improve your individual feel-good atmosphere. TROTEC. AT HOME. The best climate for home and office. TRT-HCKAT-HS-014-ENAcrobat Distiller 23.0 (Windows)