User Manual for BLAUPUNKT models including: BlueBot Xtreme

INTERACTIVE USER MANUAL BLUEBOT XTREME

Charging base X1 Adapter X1 HEPA ilter sponge ilter X1 Duster cloth X1 Left side brush X2 Right side brush X2 2 in 1 electrically-controlled water tank x1 Remote control X1 Cleaning brush with

BLUEBOT XTREME

BLUEBOT XTREME - Bol.com

INTERACTIVE USER MANUAL. BLUEBOT XTREME ... PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS ...

Not Your Device? Search For Manuals / Datasheets:

File Info : application/pdf, 12 Pages, 3.14MB

Documentoriginal
INTERACTIVE USER MANUAL
BLUEBOT XTREME
Find all the information you need to get your Bluebot up and running.
Please make sure you have Adobe Acrobat Reader installed to display this PDF correctly Use the menu below to navigate to the desired topic and use the + symbols on pages to get more information.
PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

Robot, sensors & structure

Parts & accessories

PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

Back

Top view Robot

Bottom view Robot

PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

Dustbin

+ Back

Maintenance (dustbin and filter screen)

Maintenance (Filter screen)

+1. PreFsislttehresbcuretteonncaonvderpull the dustbin out backwards.
Sensors

+3. AfWtear lilt'sebneseonrused for a long time, remove the filter gauze, sponge,

+

and HEPA.

4. Clean the removed filter gauze, sponge, and HEPA under water.

Maintenance
Clean the sensors with a soft mop, including: 1. Clean the sensors along the wall on the right. 2. Three anti-dropping sensors at the bottom of the host.

5. Shake off the water drops and dry the piec+es natuLrDalSlyl,aosnelyr ruasneging sensor them after they have completely dried.
6. After the piec+es are Adnryt,i-incsotlalilsl itohnemseinnstohreffoorllroawdianrg sequence: filter gauze - sponge -HEPA.

3. Infrared avoidance sensor in the front of the host.

4. Radar avoidance sensor on the top of the host.

Filter gauze

5. Electric shock protector and charging base shrapnel at the

bottom of the host (please cut the power off during cleaning). 62.. SOipgennalatnrdancslemainsstihoendaursetaboinf.charging base.

+ Dustbin button

Button + Infrared recharging sensor
Filter cover

Clean it regularly Clean it regularly

Sponge HEPA

+ Anti-collision sensor

PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

Back

+
Side brush

+ Anti-drop sensor

+

RAonltlii-ndgrobprussehnsor Installation
Make the left side-brush (L) and the right-side brush (R) correspond

Maintenance
1. Turn the machine over and pull the side brush out and upwards.

MtoaLinantednRaonncethe bottom casing, keep pressing L and R and the side 2. Remove hair and dirAt natnid-drreoapssseemnsbolre the side brush. BuckCleharging contact

1Cbr.leuasThnuertnsh.ethTseheemnysaaocrrhesinibneysotsavolelfetrdmanwodhpep, inrnecysolsuudthheee: abruack"lceraocnktinhge"rosolliunngd.

3. Make the left-side brush (L) and the right-side brush (R)

1. bCrleuashn cthoevesretnosotarskeaolountgththeerowllainllgobnrtuhseh.right.

correspond to L and R on the bottom casing, press L and R.

2. RThemreoevaendtiu-dsrtoopuptisnigdeseannsdoirnssaidtethoef bthoettroomllinogf tbhreushhosuts.ing a
Battery c3o.vetIrninfyrabrerudsahvaoniddacnlceReansethnesorrolilnintghebrfurosnht. of thLe host. 34. RReaadsasr eamvobildeatnhceersoellninsgorborunsthhaentdopproefstshethheorsotl.ling brush L

Main brush R
(right side brush)

L (left side brus+h)

Side brush

5. cEolevcetrriacnsdhcolcekanprtohteecrotollrinagndbrcuhsahrgtiignhgtlbyatsoefisxhtrhaepnbeulcaktlet.he bottom of the host (please cut the power off during cleaning).

Universal wheel

6. Signal transmission area of charging base.

Driving wheel

Rolling brush +

+ Rolling brush cover buckle

Clean it regularly
· Clean it regularly · Replace the side brush every 3-6 months to ensure the best cleaning effect

PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

+

HEPA filter + sponge filter X1

+

+

1L.eFfiltte/r rscirgeehntc+lesanidinge(cblearnuitsrehgularly) +

+ Clean filter (clean it regularly)

2. After using it for a long time usage, remove the filter gauze,

+

A12. dsTipunaornnp1gthteeeamnrldaecXHhcEi1nPteAr.oivceraalnldyp-ulcl tohensitdreobrlulsehdoutwanad tupewrartdsa. nk x1

+

Charging base X1 32.. CRelemanovtehehareirmaonvdeddirfitltaenrdgraeuazses,esmpobnlegeth, eansdidHeEbPrAusuhn.der water.
4131... SCMRheoamankkneoeevtcohetfetfthhlteehfemtp-swooiwdpaet,eeprbrolridunrresohtpahs(neLdaw)nfaednteedddrrtytohhuteehtreoigfphiteth-ceseiwdsea2ntb.aertrPuutslraaahncll(keyR.,t)ohcneolycrrhueassrepgoinngdbtoa2s.LeaCaDnlgeudaasiRntnsbothtinnethtmheeowbpao,ldtltroymthc3ea.wsPianltegea,rspteraendskosanLnoadtnmmdooRpvte.othreeincshtaarlgl itnhgemba. se

Charg5Pin.ogwtAebhexfaertcesmeirensddasXrif1cwyte,airirtneotshritnelaityglolahittrtheiencstoAhlmoedtpaflopelttleoerlwyXidn1rgiesde.quence,HfEilPteAarnfgfdiiallttcueeozrren+Xn-1sepcot nthgeepower Duster cloth X1

arbLiteraftrislyidaendbrkuesehpXit2out of direct sunlight Right side brush X2

Sigsnpaol nemgeis-HsiEoPnAa.reaR R

L

HEPA

L

+

Sponge

Filter gauze

>1 m

Charging base pin

>1.5m

Fil>t1emr gauzeWire slot

Cover plate

Power adapter port

· Ensure a space of above 1 m on both sides of the charging base and a space of above 1.5m in the front 2 in 1 Beuletctotrni·caIlflyt-he power lRineemisotveecrtoicnatrlotol Xth1e groundC, liet amnainygbebrdursahggweidthby the hoCsWlteaaatnnedirntcgaonbnkrsuesqhueXn1tly, the charging base may be powered off controlledCawtacthei·rngtTaghnrekocxoh1vaerging indicator is normally on when pokwneirfedXo1n and off when charged

Filter c·ovIfetrhe charging base is relocated, the host may fail in its positioning and lose the map. When restarted, the host will rebuild and

memorise the map and the rebuilt map may lose the cleaning information for forbidden areas and other areas

· Direct sunlight will interfere with recharging signal and consequently, the host may be unable to return to the charging base

SpongSReeenpslaocres tnheeedsidmeobnrtuhslyhcelveearn3in-g6 months to ensure the best cleaning effect.

Wrapping post

HEPA

PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

IRnosbtaoltlaintisotnalolaftmioonpping cloth | 2 in 1 electric-controlled water tank

+ Back +

1

2

Please do not move the charging base arbitrarily and keep it out

Rof odirbecot stunilnighst.tallation

3

Make the left-side brush (L) and the right-side brush (R)

+

correspond to L and R on the bottom casing, press L and R and

the side brushes are installed till you hear a "cracking" sound.

CSotanrnteicntgthueppaonwderclhinaeragnindgfeed the excess wire into the slot.

PSltaacret tchleeachnainrgging base against the wall and connect the power.

Paste the mopping cloth flat onto the bottom of Fill the water tank: uncap the cover and fill

Press and hold the button in the middle of the

Long press to switch on the robot. Charge the robot on the

the water tank.

with water.

charging base when the power indicator light is normally on.

After the robot is or uRse the mobile

pAoRPwPteatrnoekdsatoannrd,t scphlueosarhtnipintrgehso(sprirzkeoesnyLstoaanlnlyythabeluortnotogbnothttoeLrear

of the robot. The module is installed in place

pause during use).

correctly if you hear the sound of a "click".

4

· The sweeping robot cannot be used to remove liquids.
Instructions for mopping module

1. Please do not use the mopping m· oIdfut>hle1eambfatettreirtyhlaesvebleisenlelsesftthuannus2e0d%., the machine will not

work. Please charge it.

2.

For the sake of charged or left

safety, please unused.

be·suTrheetomraecmhionvee>w1thi.l5lemrmetouprnpitnogthmeocdhua>lre1gwimnhgebnaisteis

being

automatically if the battery level is less than 20% when

3. Please do not mop the carpet. Set a forbidden area in the APP to prevent the machine from

Remove the mopping Rmoodbuloe t

going onto the carpet.

Mopping module in use and will be powered off and then start cleaning
automatically after the battery level reaches 80%.

4. To achieve a better mopping effect, the mopping module should be installed after sweeping

Wtteohmherpeebntmuy····ttoththvoDImctoeTEIIfheenhffninhaerrtalttwtehoiseyphhhnrmcebuageeewcattorteamhhneeopcmst,caedrhouapaihkorsaniwclmgtinpesnrhhlnfiegappineiegitondrnihsaighnrwnirdleeecmsitegignliehnecbclwwaebldemauholoiasaldiinlafycsloflttsntraeamwidewtgvnomrrhtueeottoothietselarrararebettkrephwruniieficsebeentktmaatlosahrgnohthelatmcaae,oceaotnknyrwpoararsdbwmtrttlt1iteteoaaetiachachodstsndmrletalnesedk,ltedylhatgslortuthyeyhnohr,n.eeoenelrTbeutehchowcvoncoheletdheashal,aematrliinrsnosgmtag5iiwimdpncina.neo2hggyabgs0wiTootyanibfh%nsaooeurteabefitir.ftgtsoeelaecuftnearriddalhrndymaonnndaeroldopantnwacrogthdrnihseatgaeohdaiatennterhrsiddcegororsoeeinbosonengiyfttrgmnsafiomtcgerbbwhvldqaeeleeheiusasnnrehe,e.ntgdnohnoatflsettchoolnhtyhesmrde,aabetrdnoraihwdgtudpehsdeispsecpdehtieoann.omc,ncgs·liaasoettrmetodptcemPohhqr.uoaofealuatWewsudgameycaluhhggadnhsobleeeeneteareflnndderayaacg,uirtnbotcllitehnehdnythciseaahnageottdbrenhmairbaclrtvdere1smahaatai.ehnsatcrrp5aoidoeegrhoomgg,)asirustenitetsfonshii.erttnogoeuiswofimtrstbhnhnioeraowieepbtntsshosjsofgeeterr,(tc8owkmihgltnnoiaisernalctsoln.gyolceurud,hrebndipab9wtedilsrn.ueigpbrgiPamleioednlstsewafgheaoapweenbrpsrehadpaeaeenosduumdndewssooeeewe"fmnffrtiio.rtooloe,ritngrsaaimeenvsaotdeoor"iefvdttthaehekee

the mopping cloth (do not move or turn the

forbidden areas that are programmed.

robot over during cleaning).

6. The mopping function of the machine is intended for wiping and is conducive to deep

cleaning. It cannot remove stubborn stains effectively and replace the labour force. PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

Start

+

App installation

+

Create an account

+

Connect your Bluebot

+

App connection | SCAtorpaenprantitnecsatanylolaauctrciooBnulunetbot
Step 123456789

OWHECARSPYoenfrhlpehltelutgoereserinrwoccnsrrtyastotyotheorhbt`oheAuhernueoeuarePantBrtcvr`"PsohSwdelmaenWBuaermwgirneielfoiIvulw`sefabFGciandetcroIohrpceotBaeatpLonwa'ycotiatyinosfioctPnpeoscse"onopsunctwxetu,hlwnoxtaimwcontecnxnoutrayed'ndurdnscikrdpefwetpefcopyoatgirtwystopeonrih'oussurodtybaartuhstreoutadkhrpeiturgpwrtderhlftheAroheb,ro.eaoAptcsynstm`psaAlioefti.tphdntcaitn.oedhoasotnenheDtefleyirsrevmtaitcd.e' bimsaerFtonexoucyboadilntcrpseotnbotmrotcdieiutnlmtnieotsenpugtrsdtopryeo.eniuohnfamsisuotngdysoe.nofodr"o"tve.AuhAyecPraenlodglibrsoucrBefeocmrwklsouerBseb`em"WtNleub"itenhfrRoihtx.ibtyseolteoagrdaStpuieUo.pstpmcaestp.ekipg,anir'rcni".gelhg.teAoIsfwoptrayspeitoe"giho.uinsth.teer a pcnT"Auheoprowlnipocyasio.nceucserotrmuoncabtoi.li,toyononsu"bwfyrpoilrlmersetschienigvmethayeion`Oumrnenu below. vbeurttifoinc'a. tAioftnerctohdaet ibsydoenmea, silimanudltaifnyeously rperegsisstbeor twhithea`Hmoombeilbeuptthoonn' aenndu`mOnber, ybouuttowni'llforercmeoivre tyhoaunr 3vesreicfiocnadtisounnctiol de othnetrhoabtomt moebnilteiopnhsotnhaetnitulmosbteitrs. WIFI conneOcntiloyn2. .4 GHz WIFI networks are supported.
Please see your router manual for help.

MDRPeolaamwkcenoelvsoteuharetdehrtteohhbreeorabtopoibnptotftfhroioesrmdoyontc,hubkeryisndhpgooecslcdktiaifnitcgiorinsnotbtahoteito.`nOn bT((ccuhhtetaoBrngl'uefero)br.toaotfcaehpwaprsgceeacnoanbdesmfooanuknteodpsiunorfeththiete'sArfopubplloySt.tore WacnhadaitrGgueondotiglbtlehfeoPrloeabyu.osteh.as fully started.

Previous Step

Next Step

Previous Step

Next Step

PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

+ More options

Timer

Auto Boost

Do not disturb switch

Set a timer to program the robot to clean at Auto Boost will increase suction power

Here you can schedule an do not disturb

a certain time or day.

when the robot gets more friction. This is

time period.

designed to increase suction on carpets.

+

MDarnauwal your own area within the map to clean

Consumables and maintenance

Control the robot manually and use your

Record

Here you will find an overview of

+

pSCWhheohleenntoeacawohsnosaoaisenrleinlmggaotthsesistctooaapnrttrirototn/l.i,pnyoaguucapsnoedrianwtyofuor orwVnyieaowreuaalltroyocculerlapenreawviinothuiisnnvtghaecumpuamrpo.clceaeninsg

consumables and indicates when

UWYoshueecnthacinshcofuroensacintteigotnthhetfiossrecfteraheareateutafeirsresn,btoYyt-oigcmuohecozasuonisnniepgnslga"swcteheittehawiRnpaooltblhi"noerotee.ancrTrotemhhraedeatsRrlh.keoaeYfbttrooysiuntoitcuweyaoiaolnulrferssycemcoaeluaenrhpatomnhawieanpgdmro..uaoYsnmoeyutimthcai2stnhimndarsaarnwkdevrciartesuaatelcswoatanmrlsltsuianmptgh.aapTbtohlbeinsslotmncfoekarespdtthchteaeoCnRrhbotoehboerosentepslaacsetdarotirng point

Ffnbreionxmutdsccerlrodeoabisnositinnhgge.pfruotcueres. It will speed up the Robots bperoecnecslseaanseidt kannodwtsheextiamcetlyitwtohoekre. Hiteirse.

maintenance is requfiorer dy.our cleaning proces

+

Tap this button when you lost your robot and your robot will tell you where it is.

you can also load previously saved maps. Ideal when cleaning different area's (upper

More info

Draw your own area in the map to clean

+

+ Set Wall
Reset map
+ Start / PaUussee this function to erase your current map.

floor for instance).
Language and volume
Setup your language and change the

Here you will find network and robot

information

Adjustment of suction power

The robot will drive back to it's
charging Wstaattieornregulation

volume.

More options +

Control the water regulation and choose

"Low", "Medium" or "High".

PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

SAuptooclteacnilneg satanrti/pnagusestart/pause
Go forward When the robot cannot be controlled by the mobile APP, please move
ARtThueedrrnocjlbuehofttsatotrmtgheiepnlnagctesyootfuawswratuna/tctptoteacilroeuafnnsl.eoLpownogwpreessrthe button

+ Recharging start/pause +

1.8 m

+
Turn right

for 3 seconds, and the robot will clean twice within the scope of

Find robot

+ YAMc1YAsooo.ua8udnuutnmcojtuccurtmxoisaaao1ltannlnm.otm8aaipfcemddoomnmjjdwuutcoeossoeeb:ttdnrfiIlttenehhr:iaeenATghsswPuuePoasc.ntrpteoiierobtnsfnoledotplewwfod.iwtlsloetrraaettleouo,rwsnsihltleeoonvrttehllpe,rsvecetshals,ansrdtgthaaiinrsndgdklabeeryavdestloele, avasenutaldt,orathmnrigedahcthihclieagavrhlgleyillneabgvfyetoelm.rrowwbhoielrekn.ltehveelr.echarging host is charged uAnddjeurstthmeent of water flow

+

Light on/off

Spot cleaning start/pause +

1.8 m

OITfhntilhsyecforaornbeoaleltsccotarbnicenaodlltoyf-nicneodnwtihrtoehllctehhdeawrAgapintpeg.r btanskes, it will automatically return to the starting position. Please manually put the robot back to the charging base for charging.
This can also be done with the App

PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

+

Rolling

RSDFMBrieouulodstnlshpeltsiprnobigscrniclnug|bersRMaremhuneosoingnhdugctulhlaleleryayn|+cc2ilneleiganann1inineggleScidteribcruashlly-controlled

water +

tank

LDS laser ranging sensor

Dust bin1212C1.....leacutCTPRCTRAhnoupheerllfeeeetvrwmrmteanaesehfarnoiesnorelorutvvtdtatveseoeshhhnesreieeet.nrtdhtnghiagausb-trsaedkheeisuourteemmntthrozatssooemeopoonouu,wpnvprdarsttoie,siancsptdtdbphnighaoidoordifelnanseittoulgepetrrnfasaeooneugntoanrlhsrldlfalndtigoetanhntdraihmgewedsnlupoeasoawbzaH+runsditpeertdalgEesuuls,,telrePsstlihtssnhimAohttopemcbtheu.n.ohDblieetunsneluto,eodirhgsodtbroefeteetueulo:ht,lmbtrcihmebainibgkeonrngslahuovedwictbsedf.aokhretutwhneobsFeartuhrihruhtldeatuosasenshrn.rkiot.nd..lsglicnargetbienrnyuFsiclhtleeragn2ai.nu(g2zrOie.gpheltensainadnetdhberculmseAhaRon)npti,t-+hdceroyldAltuihsnseittoibw-nidansrt.oeeprnstsaoenrnkfsoaornrdramdaorp.

BFSiyarstmtteewrmayrreeuspegt rade Filter cl3334e...anbcHRIMSniorhaeEnfaurdaarPgkrsaaskeAehresreteuaapdohmnnvofeaoddfnbviledtdelocherfaliteedtwont-ahswcaLneietdaceatretserhoen.eeblrdslniredrnsuRonrogsolsorlhpbionnosrr(gnuLtiahsn)btneha+rtdeuhnbaseddonthortdftty.prhoopHteomnhrEfetrePisctoghApsafheisettih-hcnseeoegidssrh,eotpo.lrbslM2eitrnsi.unogss1pbhLper(ulaiRensnc)hgdtr.iRcmatloloyd-cuonletrolledMwaaitnerbtraunskh

+

5· . TrnUEeaalhpeiktnegcuesrthrartatoiadhclsllelyst,tfdhihtsrohuemecsfmuktnwr.b.pnauirisnsoeehtdueetohscdwietnowmngriatatahnhnfdetheipmcgrrhtoeha-sbpersigeyleir`nhfRAogaerPvsbmePea.atsInekfcenseyhe'lrw.iatMhpfinarumekmlewa-istaourtnerhebeisatbhtdotaettrtoyieeomcsut.epdl,aucpegtrhaederoibtoatcbcaocrdkinogn tiotstdheocpkrionmg pst.ation.
Sensors· Tcothoofhemetmhbbcpeoaualtiehrnttrotteeasmlnrtyiyntodlmbefriavatehetpdtele.asrhnhyodopsuetlirdmfobinremgaw5ni0lcl%eb,depSulpeoroiasnnstg,geWfeikrIemFeIwpaantSrhdeeepnuhesporgosrrotasncdahela,isrgeoBedutdhtsteiontnmtdinagiclsyhiwunseilelsbheoureldsebrevepdlaacfetedrornestehte. charging base.
Regulary c4·le.anIA(fpinflttgeheaersdmeryacicunhtgit,nhienesipstoalwlelfetthrueonmfufsidneudtr+hinfeogrscaelnqeyauneleinnncgge)t,.hfilotef rtMimonet,hplylecalesaenisnhgut down and keep it prope+rly.

6· . gCSaihguanzragele-trisatpnaostnmlgeiaess-tHioeEnvPeaAry.eathorfeechmarognintFhgisltbetaorsgaeva.ouizdedamaging battFeirliteesr dcouveetro excessive discharge

L Buckle
(left side brush)
+ Charging contact

Battery

+

Firmware upgrade

+

System reset

Water tank +

Sponge

HEPA

Clean it remevogenurytlahtrliylmy e Replace the side brush every 3-6 months for the best cleaning effect

Anti-collision sensor

Infrared recharging sensor

PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION APP INSTRUCTIONS INSTRUCTIONS DAILY MAINTENANCE OTHERS

BTSSraaaoffseueicttbyylPeIInasnfrhfaooomrrommteiaatnettgiiroosnn||GUesnaegrealLimitations Before using this product, please read the following safety instructions and follow all routine safety precautions. SSSWaaaafffreeertttayyynIIItnnnyfffPoooorrrmmmlicaaaytttiiiooo| nnnPe||| rUBLioaasdsattegereryLaimnditaCthioanrgsing BTraosuicblPe·········································PAN·····Lr····asaalnohrEEEEEEEEECIORRMIMOPLRRPEEEedsattytoirrrrrrrrrrrraaaaairIIIuIIPPPPPPPPPTDDDPDTDDBsDPTPTDPIPPiPCPPPOUsITaPPIwUspfDEpeevvhe-oamsPIPPPPPCIPttttttttrrrrrrrrrrrroaaoobstttthteeeoossvffurmmhhhheellllllllllllllllllllssh:oooooooooooooooooooonroatdreeeeiiiiiiiieeeeeeeeeeeeeeeeeeeordlllllllhmcepasearreelssssssssieeiifoeeeeeeeeetttiirrrrrrrrrrrrledoaplreddddssaaoaaaaaaaaaaaaaaaaaaassclnnnnnnnnnuyaohhtntehitedaaaaaaaprgpottuinl1567894321111111112fffffffftlr.tpotllsssssssssssssssssssstnuooooooooowcrreeerst,spphallipovpooooooooeeeerssssssshllitgeacfsiI0:::::::::1234567890eeeeeeeeeeeeeeeeeeeernge.yncttttttttttehfoatorrddteuvamrneeeeeeeoorrrrrrrrouermpkeTt,apPPPPPPPMOoo:::::::::::ltnbbbbbbbbaydpbtusupuuwufeteekdddpdcdudbccrhckddpsiltyyiiwitdww.cgooopohatnsmmrepekdddcdTddhIPPPPWOELDpilllllllioiiiiiiiipssssleushteeanllalmsareooooooooraoa'ceutreeeeeedddddddduateeeftnwiuo)henemceemoneoooooooouuoer,eeeeinrlllllueeuthcethnfhrbaeegisdcaaaaaaanrhddddddddocleeeeraaadscennnnnnnnhpeeewevrreasoonwhrccgrwedppthseitpgoteionnnsttcttannnetuasssssssgeaaaaaaeeeeeeeeintnnrumheednfooooooooptaturnttsritmhrzehhhteihramserbhyvunlcssieeeeeeeooootcibnnnnnnnnahwttssssirnnasofaceittttttttobrdodeptcisttriitnotiurwlh'peceernetr.iiloisuetesusstttteeeeh,sicahithehropntraeadltuuumwupuooadatiahacccccpcptffftttftdssrrneconash!ycicaornttpeihctiihooooipwaudooooteetehytnrgacsssssulntglllhlhppmgnnretpieltsrpcccdsioe)mciosnohoehIatt!eeeencodnialku,tmeehmrstrbsprrrriysneeeeeihcnieerrsocerehhhiclepuuuppuetsrouohtneterccmofPaaaalpolctg,v.pcaspsaoosoheieiaerdaepphpdtieyiahducccaaheeehinlsssrslsesrrmactttttireaedaenepncnhnnnnre,e,urgiceraddedonbondhiuurrryhhhhhhkkahimrcbsccceeeeeotehoaaitounalosmpxunlegllooooncanetegfdcc,dtuunueodadoadtCdsmieeeeeeyttantttameakkkloddoodnscarttsgootcbliinhaeerdddesfppppdhetkehhhhbaccnocttnobauosueeaffaaosliutmmgobruyeeuseluipppmptcnrustajrero,curiiicsruuuerrrlefeeeettuttmitanwtnatcbcjcoeintsafffvweaecsttsescoooigcrdtnrcoscmhkenhsrrrrbinanllctpcccahneshhiitsiwuthtescemafotreoeeoooomprhf,rtloaiifrrfmtttsnnnthedddn?elacrsaehtae.ctuutttheraanyefoyaufgteeaehhicrae,statdnaehaxa,peahrddddisuisssoiico,tntuuugthtigroerecthoshassoaarlvtWotahpslnamydaahceellsprrnsnsalheefnrphproeuuuutaprlombrrhebitccchyblhutonetirgeeeecenoettttsnygryihdlndclrnaaanrtdaineheii.cucccrwooowbglepaertttoaohuesmsa(cbeoettedrrhlld,desfcptnottrrnaeeeetfursssdsnr,yhsi++tpiter-sdlttttoshaheeslrsneitaemmrftshrfocowfotoniaolehehgoaoodrreaaeaisa.apccdedhaapnoohrohubfieicpnatto,pseceueoiiondnercwihpdcrordbtSmttcrananeoaervwubbbtcsotlonnaovspeierer,sercolrfhhtamahehtdenohofnceirsnttialnoylrltogeteogeneetneerhedoucsssitgdroaawfmuptyeehooavoteuenelbetutiaeeaiwtscmobebpridocwlnrrrpwlddyrooosentnnt,trnucphasiwiwhdsalobgreaorgstrreulwosirnpeesxnwrlyrevoshrererybelphhu!rvdppeneodougetrrrgsclssrcaopeeg,ainirrnusciihtptmsprietealvtalafenbbbermtneamltaedihuahtsernnrtorlgucacttrtyairrhtrhaolrhsreckoreihdiaspeaiheatootnaaaycohs,samroieaietigrsterettdnroaerggteuncstcooohs,ennaaaeeracmeuadtnahdentartistneagsnogesrrnwohdrdofmmpearsgpctvutnfecofhneieoouivrelngnnnidonlpteccdacgveskeathelpsobsniiii.donurdrgdauyhttepsldtesmroobreendnnrcedeyyyhmt,eeoehmrneaeahmetbbus.mmooehtmdaUenmiftyndpihrceosrwbiilierto0shnglegtcgnannpuurliooddaabotomrptidieuruPalibeainarstaiattylmcsaenkaehasaacbarianaecegeombe,rtgvomgeaadcaehlanesfuo,rentse(irttlsnirueslobvrekeuoeemtebststahlgievnnakdcgfihniotnsre-lrtnlsnnertprdginoctwautcnerattutyleh,rtaielstasarenss.bnpeibmevlpvarieatdunaaoehbidonlretnndfhbcrelwnodebpanrnnnaoernr4basa(o,,owipssteuDasMogenneel,roarr.rtcdespdeimleaginenriteleaeaaermratvlyrgucnoggrii0slhterneitrpeal(traieyrbbnhioIhrewo(ptrh,athocngmttwn.thasftbnsmirargrsnihtahstoidsSGSLSLSWSBWPriasmeaecgspegnhsrhnheoeblosojssesnovateyyodssdwosscsoyeene.tehuneyokhuaiahnabumiitaerudnarehbnree.edmaaaaafmehopieuarmtstgtnbsehhtkmama.rdsadrIstocececucdagoetfarsatenorbpaoomnttecoathsdaomniioabtraarhlotifffffeudgegjwrocoroeotrtnsbUhieicoehontrntaeocsfesslrfgmtrrbevlreretntttnrtvoeeeeeeapeibaatvirtfseerrtooracodaaloiroeoragfruelolrihiaprdssg.mvlrhmdesiepacaenrtiuechwsfnseeaieatoaapaemyltro.atttttcycsasehnentnrucrpdhot.sllfee.ecna(uaaeeahtstti.sggosuyyyyyiieltopepavsdtbftcnsThnnn4ulbtrtaioneohnno4agdknsnasneetuDrhrrml.neesrtdonrtraecieIboasonmseurienhlitu?ed0etuhtyynvvneeitoubtnags0pduniiiiiticdibao)sptirdcoryslsoph(eofrmshn.sni(trnnnnnniesnlceiddce°bwooindeydrbjoCnrbii.stduletctd,itereaadalttoeer°nsfonfdaeCdcorm(.hcukuhtgshfffffsnoattafauiudmssaloCarehec.CuirumostincosodhcPguymaoooooetardfdUafahrcnsgdteneootntfdthntauccriaulvhoneheossoicrotur)outdtptsssoma)seauinaisi.tierrrrrsosantoemosoesdhokacnai(berhnsernenvftent.rcmnltemobemmmmmedinrat(cemrddsucoweuaslirprbthuvmrudcdedelaeeerrbgogoedspbfy(medgapennorlecciwtipasuuscrir.nocewesesspkrroeraonsswcisf.teainaaaaarsesaeusnldtethtdel.nordticluncatgoiaceoia.ufmiaaewanehcooooassahhshodygiddltonssvttttttsoasoxgdhhmdsaoao.aitbtscraltyopykmborfrtcoeiiiiiweeaedtiatgroh,ioamthreansstreisaeneoooooirscngnbwjthohiepyfcrypulaauhnotsblseruelbepninuccdredefhopentw.rdlia.lgeihcecknnnnnnsdarlatsecwtsbkygleupnrcauqhcagrorsdeaatawitr0omdothlriIinhaeatwagehedhtsdtwacetinosnathfreocpsbbue.xrnetesaas°eacstauooasgnrcp,eteioibehnsregsliaenairiraddolCtqysalyatoaolcetpaswsrdietiooiaaodep.parreowel)isocrswylgntgut1tunsnchaynloasdritet.toprnaprcldthreooawsoapylptnnaosghtecshetnidkirdfseeaefdnrbhneanrecpelude,lsterglrwoergrr,uaedd.taceaiaytnorrmhtoieocoteonlotdsorrpmcctp.feeshwbail.ghoa.ouytssesnpi.deicefdelsdih,mthltreoeapstilpi.jgdtnegmtrcdmetrhbhdaosatercsuimwuiomaedbtwd.dpnhoopsaeibeoetroweepcvrtc.tcmsc(prtrimeperahoetpndao)rrishadithrtabifnohbreup)tteapotteensoscrpnaowser.us.lietafeeyauyrerelerop,noobnwtt,tcgt)rondticnd.roecndltserilnhbtotp.deplcenentyhslsheoreeuioohahdo,ehmrtdelbnmatlr3ettuooteeusaw,e-hnatn1uaorcwoiBscoudwehereogte5cnhtwdskca.anseecetesi6.pcelnfdohftvtaeede,0s)mbot0enucPdeateoeerhmf.0etodiehaianir.d.rrxsxe5udooehsntcn.rd,TTTTTTrAcThCT(PgSTTAdTaWo(TbTtrhaaenexaa°Ssaf)orso++++++3etctuatb0innomhsdotC.ueneraoocthrhhhhhhhhhhhhna1otiicltgfbnhfnnoh1dohb3sighhupenoco5ceyahaoo0ttu225dinotnsesweeeeeeeeeeeednl)4lesnueteifm4otaelolyghte.reeesstkgolao0uumnr.trth0ri044uceitt2rhyauop3i.forqseto.oinpserIcahnenasdirdwftrrrrsmt..dbaomrnxtlaeeaasml4aXWWWeptEtnekcsoaoooooueaoxer.iouadrhru,ediitniderui1haindapycoanrmtctVvogdCefsweiTnan8otdnnplbbbbiartgpwarsiagargAc,euirnhgste0lrvnutdedelonteaawedpiregdle0nraw6ttoooorasrtrrilmuh(dohareteieneosh0rdeloessioprhosetogltsnrrreormle0ttttradcescrasbrlhdihestbirommrerrtueenaobfieiulnogbstrmofoaa8kaaerdoi,riirsynntoaretdoneeohbmstossndogr9aagcfegiirorutingtnnvlme2pahlco.gnrdfetspswnaxlebulcholhrdihertnmictipsoertdcldyisstor5sruaNnipussotmceogvashlseeitsbiotporhsdiihvpesoeiottgratavlgiiatocahirisro.issodhbaerauthasudrdaeoesban)erosarbloargssitrecdeiiisttrilnaryloranscsbeleprudlfnnsxdsslttnwsiaoiihniegcridwkdrloecsusewnsaiddrseikdsalmpcctoa.ytals-tyicsdsroreoodtetibaerkcislnchtuuoa)isthelntlrceiotrowtlkcidsved.ovaawrtycprhocurlehegiwiceenfdamdraibpeoh1fonsoanleeerioscmlillolmevhecetid,srscnentysudearoiensrjw0prntlciahiweeathoscuhucosotua,eoehrstnsas.c'tpetypiehamtwusistyroeeteylteruarshdltinbhdennheegeCeenreedsnilasthbccwrodbnnrsaepeuhodiseaenheldda.itdrsdglpterpoeekolsnertes.ottsehictedynieigaononoopphtenteraritanff.rgboroaotocnsdouumhotiiehtfaiocrrobraarscintgglntypornraobrtncasrerdtdhmiviahrpewnwlbocskicosgalnge.louvnytistemtasasauetuaeurlathseprt.cecheoearIdew1newdor(utl,nhgicasttcpdgasuroceaisedurerybrra0sdhsedcsotteeenieebikeriista)pg.uscau.aacdmscote%tnrctkugidrgdn,ddiaodhcubdvieartntkanstokonrumngaence.uc)fieyttaree.ucldiibktedrgrgisboteu)e.soerrdwycdnetgdsektie.n.oysgttb.ofrr.ss.hsnsttaae,eyneridbyoorehaisetPier-ioccnnlwndmideeagnwroevnohcondirhoudefo.gcsssnorehoooiriffepdnatrttodosrtre,gswehpothvueaceprto6erutpp.op.bohenegirulbedo.hrlnnu×bndaeenlaeerrpritouesvn6tniedocemntcethbpetgidomgahudtdtere(teeraogio.kashssdueo2urrevh-uredsebns)lnedgaoactaeeodittshsin.htnateger

· Please make sure that this product is not powered on when removing the battery.

· Please recycle the discarded batteries safely. PRODUCT INTRODUCTION INSTALLATION APP INSTALLATION

APP INSTRUCTIONS

INSTRUCTIONS

DAILY MAINTENANCE

++++ + ++
OTHERS


GPL Ghostscript 9.26 Adobe InDesign 16.0 (Macintosh)