described in this Owner’s Manual. v %H VXUH \RXU DSSOLDQFH LV SURSHUO\ LQVWDOOHG DQG grounded by a qualified installer in accordance with the provided installation instructions. v 'R QRW DWWHPSW WR UHSDLU RU UHSODFH DQ\ SDUW RI \RXU oven unless it is specifically recommended in this manual. All other servicing should be performed by a
4 49-2000375 rev. 1 safety information read and save these instructions important safety information read all instructions before using the appliance warning in the event of a fire, take the following steps to prevent injury and fire spreading
Direct Air Convection Built-In Electric WALL OVEN SAFETY INFORMATION. . . . . . . . . .3 USING THE OVEN Oven Controls . . . . . . . . . . . . . . . . . . . . . . . . .6 Double Oven . . . . . . . . . . . . . . . . . . . . . . . . . .7 Settings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .7 Sabbath . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9 Oven Racks . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Aluminum Foil and Oven Liners. . . . . . . . . 12 Cookware. . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Cooking Modes . . . . . . . . . . . . . . . . . . . . . . . 13 Probe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Cooking Guide . . . . . . . . . . . . . . . . . . . . . . . 16 CARE AND CLEANING Cleaning The Oven - Exterior . . . . . . . . . . . 17 Cleaning The Oven - Interior . . . . . . . . . . . 18 Probe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 Oven Light . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 Oven Door . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 TROUBLESHOOTING TIPS. . . . . 20 LIMITED WARRANTY . . . . . . . . . . .22 ACCESSORIES . . . . . . . . . . . . . . . . . . .23 CONSUMER SUPPORT . . . . . . . . . 24 OWNER'S MANUAL 30" Single Wall Oven PTS7000 PTS700L PTS700R 30" Double Wall Oven PTD7000 PTD700L PTD700R Write the model and serial numbers here: Model # _________________ Serial # _________________ You can find them on a label on the side trim or on the front of the (lower) oven behind the oven door. ESPAÑOL Para consultar una version en español de este manual de instrucciones, visite nuestro sitio de internet GEAppliances.com. GE is a trademark of the General Electric Company. Manufactured under trademark license. 49-2000375 Rev. 1 08-19 GEA THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME. Whether you grew up with GE Appliances, or this is your first, we're happy to have you in the family. We take pride in the craftsmanship, innovation and design that goes into every GE Appliances product, and we think you will too. Among other things, registration of your appliance ensures that we can deliver important product information and warranty details when you need them. Register your GE appliance now online. Helpful websites and phone numbers are available in the Consumer Support section of this Owner's Manual. You may also mail in the pre-printed registration card included in the packing material. SAFETY INFORMATION IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE WARNING Read all safety instructions before using the product. Failure to follow these instructions may result in fire, electrical shock, serious injury or death. WARNING GENERAL SAFETY INSTRUCTIONS 8VHWKLVDSSOLDQFHRQO\IRULWVLQWHQGHGSXUSRVHDV described in this Owner's Manual. %HVXUH\RXUDSSOLDQFHLVSURSHUO\LQVWDOOHGDQG grounded by a qualified installer in accordance with the provided installation instructions. 'RQRWDWWHPSWWRUHSDLURUUHSODFHDQ\SDUWRI\RXU oven unless it is specifically recommended in this manual. All other servicing should be performed by a qualified technician. %HIRUHSHUIRUPLQJDQ\VHUYLFHGLVFRQQHFWWKH power supply at the household distribution panel by removing the fuse or switching off the circuit breaker. 'RQRWOHDYHFKLOGUHQDORQH²FKLOGUHQVKRXOGQRW be left alone or unattended in an area where an appliance is in use. They should never be allowed to climb, sit or stand on any part of the appliance. CAUTION 'RQRWVWRUHLWHPVRILQWHUHVW to children in cabinets above an oven - children climbing on the oven to reach items could be seriously injured. 8VHRQO\GU\SRWKROGHUV²PRLVWRUGDPSSRWKROGHUV RQKRWVXUIDFHVPD\UHVXOWLQEXUQVIURPVWHDP'R QRWOHWSRWKROGHUVWRXFKKRWKHDWLQJHOHPHQWV'R not use a towel or other bulky cloth in place of pot holders. 1HYHUXVH\RXUDSSOLDQFHIRUZDUPLQJRUKHDWLQJ the room. 'RQRWWRXFKWKHKHDWLQJHOHPHQWVRUWKHLQWHULRU surface of the oven. These surfaces may be hot enough to burn even though they are dark in color. 'XULQJDQGDIWHUXVHGRQRWWRXFKRUOHWFORWKLQJ or other flammable materials contact any interior area of the oven; allow sufficient time for cooling first. Other surfaces of the appliance may become hot enough to cause burns. Potentially hot surfaces include the oven vent opening, surfaces near the opening and crevices around the oven door. 'RQRWKHDWXQRSHQHGIRRGFRQWDLQHUV3UHVVXUH could build up and the container could burst, causing an injury. 'RQRWXVHDQ\W\SHRIIRLORUOLQHUWRFRYHUWKH oven bottom or anywhere in the oven, except as described in this manual. Oven liners can trap heat or melt, resulting in damage to the product and risk of shock, smoke or fire. $YRLGVFUDWFKLQJRULPSDFWLQJJODVVGRRUVRUFRQWURO SDQHOV'RLQJVRPD\OHDGWRJODVVEUHDNDJH'R not cook on a product with broken glass. Shock, fire or cuts may occur. &RRNPHDWDQGSRXOWU\WKRURXJKO\²PHDWWRDWOHDVW an internal temperature of 160°F and poultry to at least an internal temperature of 180°F. Cooking to these temperatures usually protects against foodborne illness. WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE OVEN Failure to do so may result in fire or personal injury. 'RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVLQRUQHDU an oven, including paper, plastic, pot holders, linens, wall coverings, curtains, drapes and gasoline or other flammable vapors and liquids. 1HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOH using the appliance. These garments may ignite if they contact hot surfaces, causing severe burns. 'RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH materials accumulate in or near the oven. Grease in the oven or near the oven may ignite. Remote Operation - This appliance is configurable WRDOORZUHPRWHRSHUDWLRQDWDQ\WLPH'RQRWVWRUH any flammable materials or temperature sensitive items inside of the appliance. READ AND SAVE THESE INSTRUCTIONS 49-2000375 Rev. 1 3 SAFETY INFORMATION IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING STEPS TO PREVENT INJURY AND FIRE SPREADING ' RQRWXVHZDWHURQJUHDVHILUHV1HYHUSLFNXSD flaming pan. ,IWKHUHLVDILUHLQWKHRYHQGXULQJEDNLQJVPRWKHU the fire by closing the oven door and turning the oven off or by using a multi-purpose dry chemical or foam-type fire extinguisher. ,IWKHUHLVDILUHLQWKHRYHQGXULQJVHOIFOHDQWXUQ the oven off and wait for the fire to go out. 'RQRW force the door open,QWURGXFWLRQRIIUHVKDLUDWVHOI clean temperatures may lead to a burst of flame from the oven. Failure to follow this instruction may result in severe burns. WARNING OVEN SAFETY INSTRUCTIONS 6 WDQGDZD\IURPWKHRYHQZKHQRSHQLQJWKHRYHQ door. Hot air or steam which escapes can cause burns to hands, face and/or eyes. . HHSWKHRYHQYHQWXQREVWUXFWHG . HHSWKHRYHQIUHHIURPJUHDVHEXLOGXS*UHDVHLQ the oven may ignite. 3ODFHRYHQUDFNVLQGHVLUHGORFDWLRQZKLOHRYHQLV FRRO,IUDFNPXVWEHPRYHGZKLOHRYHQLVKRWGRQRW let pot holder contact hot heating element in oven. : KHQXVLQJFRRNLQJRUURDVWLQJEDJVLQWKHRYHQ follow the manufacturer's directions. 3XOOLQJRXWWKHVWDQGDUGUDFNVWRWKHLUVWRSORFNV or the extension rack to its fully open position is DFRQYHQLHQFHLQOLIWLQJKHDY\IRRGV,WLVDOVRD precaution against burns from touching hot surfaces of the door or oven walls. 'RQRWOHDYHLWHPVVXFKDVSDSHUFRRNLQJXWHQVLOV RUIRRGLQWKHRYHQZKHQQRWLQXVH,WHPVVWRUHGLQ an oven can ignite. 1HYHUSODFHFRRNLQJXWHQVLOVSL]]DRUEDNLQJVWRQHV or any type of foil or liner on the oven floor. These items can trap heat or melt, resulting in damage to the product and risk of shock, smoke or fire. WARNING SELF-CLEANING OVEN SAFETY INSTRUCTIONS The self-cleaning feature operates the oven at temperatures high enough to burn away food soils in the oven. Follow these instructions for safe operation. ' RQRWWRXFKRYHQVXUIDFHVGXULQJVHOIFOHDQ RSHUDWLRQ.HHSFKLOGUHQDZD\IURPWKHRYHQGXULQJ self-cleaning. Failure to follow these instructions may cause burns. %HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHZLSHJUHDVH and food soils from the oven. Excessive amount of grease may ignite, leading to smoke damage to your home. % HIRUHVHOIFOHDQLQJWKHRYHQUHPRYHVKLQ\VLOYHU colored oven racks (on some models), the probe, any aluminum foil, and any broiler pan, grid, and other cookware. Only porcelain coated oven racks may be left in the oven. READ AND SAVE THESE INSTRUCTIONS 4 49-2000375 Rev. 1 SAFETY INFORMATION IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE WARNING SELF-CLEANING OVEN SAFETY INSTRUCTIONS (Cont.) ,IWKHVHOIFOHDQLQJPRGHPDOIXQFWLRQVWXUQWKH oven off and disconnect the power supply. Have it serviced by a qualified technician. 'RQRWXVHRYHQFOHDQHUV1RFRPPHUFLDORYHQ cleaner or oven liner protective coating of any kind should be used in or around any part of the oven. 'RQRWFOHDQWKHGRRUJDVNHW7KHGRRUJDVNHWLV essential for a good seal. Care should be taken not to rub, damage or move the gasket. The remote enable equipment installed on this oven has been tested and found to comply with the limits for D&ODVV%GLJLWDOGHYLFHSXUVXDQWWRSDUWRIWKH)&& Rules. These limits are designed to: (a) provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that LQWHUIHUHQFHZLOOQRWRFFXULQDSDUWLFXODULQVWDOODWLRQ,I this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: 5HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQD ,QFUHDVHWKHVHSDUDWLRQEHWZHHQWKHHTXLSPHQWDQG receiver. &RQQHFWWKHHTXLSPHQWLQWRDQRXWOHWRQDFLUFXLW different from that to which the receiver is connected. &RQVXOWWKHGHDOHURUDQH[SHULHQFHGUDGLR79 technician for help. (b) accept any interference received, including interference that may cause undesired operation of the device. Note that any changes or modifications to the wireless communication device installed on this oven that are not expressly approved by the manufacturer could void the user's authority to operate the equipment. How to Remove Protective Shipping Film and Packaging Tape Carefully grasp a corner of the protective shipping film with your fingers and slowly peel it from the appliance VXUIDFH'RQRWXVHDQ\VKDUSLWHPVWRUHPRYHWKHILOP Remove all of the film before using the appliance for the first time. To assure no damage is done to the finish of the product, the safest way to remove the adhesive from packaging tape on new appliances is an application of a household liquid dishwashing detergent. Apply with a soft cloth and allow to soak. NOTE:7KHDGKHVLYHPXVWEHUHPRYHGIURPDOOSDUWV,W cannot be removed if it is baked on. READ AND SAVE THESE INSTRUCTIONS 49-2000375 Rev. 1 5 USING THE OVEN: Oven Controls Oven Controls Control graphics are representative; your oven may have alternate graphic appearances. 12:30 PM UPPER OVEN LOWER OVEN 12:30 PM GET CONNECTED 12:30 PM UPPER OVEN LOWER OVEN Bake Broil Convect More Precision Cooking Recipes Bake Broil Convect More Precision Cooking Recipes 12:30 PM GET CONNECTED Bake Broil Convect More Precision Cooking Recipes Single Wall Oven Main Menu 'RXEOH:DOO2YHQ0DLQ0HQXV Upper Oven and Lower Oven When using a double oven you can set separate modes in each oven. The selected oven will appear above the cooking modes. NOTE:,IXVLQJDVLQJOHRYHQWKHUHZLOO not be an oven selection. Bake This option allows the user to access traditional the traditional bake mode. Broil %URLO FDQEHVHOHFWHGWRDFFHVV%URLO/RZDQG%URLO+LJK See the Cooking Modes section for more information. Convect 7KLVRSWLRQDOORZV\RXWRXWLOL]HWKHFRQYHFWLRQV\VWHP to cook in a variety of modes. See the Cooking Modes section for more information. More Select this option to access the Proof, Probe, Warm, Self Clean, and Steam Clean options. Precision Cooking (upper only on double oven models) 3UHFLVLRQ&RRNLQJLVDVXLWHRIFXVWRPL]HGFRRNLQJ cycles that have been designed for specific foods. The display will guide you through setting the oven and food appropriately for the cycle selected. Precision cooking cycles vary based on food type; see the Cooking Modes section for more detailed information. Recipes (upper only on double oven models) This option allows you to access pre-loaded recipes for FHUWDLQIRRGV1HZUHFLSHVFDQEHORDGHGDQGIROORZHG WKURXJKWKH*($SSOLDQFHV.LWFKHQ$SSRQFH\RXU phone is connected. See the Wi-Fi Connect section for instructions on connecting your phone. Oven Light To turn on or off the oven cavity lights, press the %RWK cavity lights will be illuminated if using a double oven. Settings Press the to access the Settings. See the Settings section for more information. Favorite This option allows the user to save their favorite cycles for easy access in the future. After selecting a cooking mode and setting the temperature and any timers, press the to save it as a favorite for future use. After saving a cycle, press the on the main menu to quickly access the saved mode. Kitchen Timer This feature works as a countdown timer. Press the , select the amount of time for the timer to operate, and press Start. The oven will continue to operate once the timer countdown is complete. To turn off the timer, select the and press Clear. Cook Time This function counts down cooking time and turns off the oven when the cooking time is complete. Press the during a cycle, select the amount of cooking time, and press Start. Delay Time 7KLVIHDWXUHGHOD\VWKH VWDUWWLPHIRUDQRYHQF\FOH8VH this feature to set a time when you want the oven to start. Select a cycle, then press the . Select the time of day for the oven to turn on and press Start. A cook time can also be programmed if desired. Wi-Fi & Remote Enable Press GET CONNECTED to connect your oven to Wi-Fi. This option allows you to download content to your oven and control it remotely. The oven must be connected to Wi-Fi before Remote Enable can be activated. For instructions on how to connect your oven, see the Wi-Fi Connect/Remote Enable section under Settings in this manual. 6 49-2000375 Rev. 1 USING THE OVEN:'RXEOH2YHQ6HWWLQJV Double Oven When using both cavities to cook, the control will allow you to switch back and forth between the upper and lower oven to review the cycle selection for each. When viewing the cooking mode screen you can access the alternate cavity by pressing on the banner at the top or bottom of the screen. 12:30 PM TO UPPER OVEN 12:30 PM BAKE 350°F BAKE PREHEATED 350°F BAKE PREHEATED 400°F TO LOWER OVEN CANCEL Settings 8SSHU2YHQ%DNH&\FOH BAKE 400°F CANCEL /RZHU2YHQ%DNH&\FOH There are numerous settings that are accessed by pressing 12:30 PM SETTINGS Wi-Fi & REMOTE ENABLE SET CLOCK LOCK CONTROL SABBATH SOUND in the top right corner of the main screen. 12:30 PM SETTINGS SABBATH SOUND DISPLAY COOKING SYSTEM Slide up and down to access all the settings Wi-Fi & Remote Enable This appliance is configurable to allow remote operation DWDQ\WLPH'RQRWVWRUHDQ\IODPPDEOHPDWHULDOVRU WHPSHUDWXUHVHQVLWLYHLWHPVLQVLGH%\XVLQJWKH:L)L Connect feature, you will be able to control essential oven operations such as temperature settings, timers and cooking modes using your smartphone or tablet.* Select the then Wi-Fi & Remote Enable - follow the LQVWUXFWLRQVRQ\RXURYHQGLVSOD\DQGSKRQHDSS,WLV necessary to turn on Wi-Fi before using Remote Enable on your oven. Connecting your Wi-Fi Connect Enabled oven 1. Have your smart phone or tablet ready with the ability to access the internet and download apps. 2. You will need to know the password of your home Wi-Fi router. Have this password ready while you are setting up your GE Appliances oven. 3. On your smart phone or tablet, visit GEAppliances.com/connect to learn more about connected appliance features and to download the app to connect to your oven. 4. Follow the onscreen instructions in the app to connect your GE Appliances oven. When connected, your oven should show that it is connected to your home Wi-Fi network. 5. ,IWKHUHDUHLVVXHVFRQQHFWLQJZLUHOHVVO\WR\RXURYHQ please call 800.220.6899 and ask for assistance regarding oven wireless connectivity. To connect additional smart devices, repeat steps 3 and 4. Remote Starting your Oven To be able to start the oven remotely once connected to Wi-Fi, press Remote Enable on the main menu or access Wi-Fi & Remote Enable in the settings menu and turn Remote Enable on. The oven can now be started remotely using a connected device. The icon must be active to start the oven remotely. To disconnect your phone from Remote Enable, access the Wi-Fi & Remote Enable settings and turn Remote Enable off. NOTE: )RRGVWKDWVSRLOHDVLO\²VXFKDVPLONHJJVILVK VWXIILQJVSRXOWU\DQGSRUN²VKRXOGQRWEHDOORZHGWR sit for more than 1 hour before or after cooking. Room WHPSHUDWXUHSURPRWHVWKHJURZWKRIKDUPIXOEDFWHULD%H sure that the oven light is off because heat from the bulb will speed harmful bacteria growth. * Compatible Apple or Android devices and home Wi-Fi network required. 49-2000375 Rev. 1 7 USING THE OVEN: Settings Settings (Cont.) There are numerous settings that are accessed by pressing in the top right corner of the main screen. 12:30 PM SETTINGS Wi-Fi & REMOTE ENABLE SET CLOCK LOCK CONTROL SABBATH SOUND 12:30 PM SETTINGS SABBATH SOUND DISPLAY COOKING SYSTEM Slide up and down to access all the settings Set Clock This feature allows you to set the clock and specifies how the time of day will be displayed. Options are for a standard 12-hour clock with AM and PM selections or 24-hour military time display. Lock Control 6HOHFWWKLVRSWLRQLQRUGHUWRORFNWKH/&'IURPDQ\ undesired screen selections. To unlock the screen, press and press Unlock on the next screen. Sabbath Sabbath mode disables the oven lights (the oven light will not turn on when the door is opened), all sounds (the control will not beep when the screen is pressed), &RQYHFWLRQPRGHV%URLOPRGHV:DUP3URRIDQGDOO time functions. Sabbath mode can only be used with WUDGLWLRQDO%DNH7KLVIHDWXUHFRQIRUPVWRWKH6WDU. Jewish Sabbath requirements. Please reference the Sabbath Mode section for more information. Sound This setting screen allows you to change the volume, the end of cycle tone, and turn on or off the touch sound. Display This screen shows the options for brightness, clock off, energy saver, and screen time out. Clock off will remove the clock from the display when the screen is inactive, but it will be shown after pressing the screen. The screen can be set to never time out or it can be set to shut off after 1, 5, or 10 minutes. Cooking The oven is set to Fahrenheit, however, in this setting the cooking unit can be changed to Celsius. Auto Recipe Conversion can be turned on in order to automatically reduce the programmed cooking WHPSHUDWXUHIRU&RQYHFWLRQ%DNHRU&RQYHFWLRQ%DNH 0XOWL1RWHWKDWWKLVZLOORQO\UHGXFHWKHFRRNLQJ temperature, not the baking time. When the 12 Hour Shut Off option is turned on, it will automatically shut off the oven after 12 hours of continuous use. Adjust Temperature allows the oven temperature to be adjusted up to 35°F hotter or down to 35°F FRROHU8VHWKLVIHDWXUHLI\RXEHOLHYH\RXURYHQ temperature is too hot or cold and wish to change it. For double ovens, the upper and lower oven WHPSHUDWXUHVDUHDGMXVWHGVHSDUDWHO\'RQRWXVH thermometers, such as those found in grocery stores, to check the temperature setting of your oven. These thermometers may vary 2040 degrees. System This screen allows you to clear your saved user data and shows the current software version. 8 49-2000375 Rev. 1 USING THE OVEN: Settings / Sabbath Sabbath Sabbath mode disables the oven lights (the oven light will not turn on when the door is opened), all sounds (the control ZLOOQRWEHHSZKHQWKHVFUHHQLVSUHVVHG&RQYHFWLRQPRGHV%URLOPRGHV:DUP3URRIDQGDOOWLPHIXQFWLRQV6DEEDWK PRGHFDQRQO\EHXVHGZLWKWUDGLWLRQDO%DNH7KLVIHDWXUHFRQIRUPVWRWKH6WDU.-HZLVK6DEEDWKUHTXLUHPHQWV NOTE:,IDSRZHURXWDJHRFFXUVGXULQJZKHQWKHRYHQLVLQ6DEEDWK0RGHWKHXQLWZLOOUHWXUQWR6DEEDWK0RGH when power is restored. Entering Sabbath Mode Press the on the main screen to access the Settings menu and scroll down to Sabbath. Start a Sabbath Bake 8VHWKHNH\SDGRQWKHVFUHHQWRHQWHUWKHWHPSHUDWXUH WKDW\RXZRXOGOLNHWRXVHIRU6DEEDWK%DNH2QFHWKH temperature is set, press the to set the cook time for WKHF\FOHLQKRXUVDQGPLQXWHV,IXVLQJDGRXEOHRYHQ you can then set the temperature and time desired for the other cavity by selecting it to the left of the temperature GLVSOD\,IDWLPHULVQRWVHWWKHRYHQZLOOVWDUWDEDNH cycle during Sabbath mode and continue until Sabbath mode is turned off. You can also set whether the oven light will be on or off by pressing the on this screen. Once you have programmed the temperature and time, press Start. The next screen will display the settings that \RXSURJUDPPHGIRU\RXU6DEEDWK%DNH 12:30 PM SABBATH i BAKE TEMP 1 --- °F 4 7 2 3 5 6 8 9 0 START UPPER OVEN LOWER OVEN 12:30 PM SABBATH i BAKE TEMP 1 --- °F 4 7 2 3 5 6 8 9 0 START Programming Screens Adjusting the Temperature During a Sabbath Bake SABBATH 12:30 PM EXIT SABBATH ,IWKHWHPSHUDWXUHQHHGVWREHDGMXVWHGDIWHU SURJUDPPLQJWKHRYHQIRUD6DEEDWK%DNHSUHVVRQH of the temperature icons displayed on the Sabbath cycle screen and press Enter. This will allow you to adjust the WHPSHUDWXUHIRUWKHF\FOH1RWHWKDWWKHGLVSOD\ZLOOQRW show that the oven temperature has been changed. Exit the Sabbath Mode To exit Sabbath mode, either press the X in the upper right corner if in the programming screen, or press Exit Sabbath if in the cycle screen. There is also an option to turn off the cycle when on the cycle screen by pressing Turn Off, but your oven will still remain in Sabbath mode until you exit the mode. NOTE:,IDSRZHURXWDJHRFFXUV while the oven is in Sabbath Mode, the unit will return to Sabbath Mode when power is restored, however the oven will return to the off state even if it was in the middle of a bake cycle when the power outage occurred. ENTER 200°F 250°F Oven On 300°F 350°F TURN OFF 400°F Select temperature, then press ENTER to edit. SABBATH ENTER 200°F 12:30 PM EXIT SABBATH Upper Oven On 5:30 250°F 300°F 350°F TURN OFF 400°F ENTER 200°F Lower Oven On 5:30 250°F 300°F 350°F TURN OFF 400°F Select temperature, then press ENTER to edit. 6LQJOHDQG'RXEOH2YHQ Sabbath Cycle Screens 49-2000375 Rev. 1 9 USING THE OVEN: Oven Racks Oven Racks Your oven has six rack positions. Recommended rack positions for various types of foods are provided in the Cooking Guide. Adjusting rack position is one way to impact cooking results. For example, if you would prefer darker tops on cakes, muffins, or cookies, try moving IRRGRQHUDFNSRVLWLRQKLJKHU,I\RXILQGIRRGVDUHWRR brown on top try moving them down next time. When baking with multiple pans and on multiple racks, ensure there is sufficient space between pans to allow air to flow. Your Oven may have extension racks and/or traditional flat racks. To avoid possible burns, place the racks in the desired position before you turn the oven on. Flat Racks When placing and removing cookware, pull the rack out to the bump (stop position) on the rack support. To remove a rack, pull it toward you, tilt the front end up and pull it out. To replace, place the curved end of the rack (stop-locks) onto the oven supports, tilt up the front of the rack and push the rack in. Racks may become difficult to slide, especially after a self-clean. Put some vegetable oil on a soft cloth or paper towel and rub onto the left and right edges. NOTE: 8VLQJRWKHUFRRNLQJRLOVZLOOFDXVHDGLVFRORULQJ or a rust like color residue on the racks and cavity sides. To clean this residue, use a soap and water or a vinegar and water solution. Rinse with clean water and dry with a soft cloth. 10 49-2000375 Rev. 1 USING THE OVEN: Oven Racks Oven Racks (Cont.) Extension Racks Always pull the rack out by its upper front rail to its fully open position, when placing or removing cookware. Extension racks cannot be used in the top rack position. ,IH[WHQVLRQUDFNVDUHGLIILFXOWWRH[WHQGOXEULFDWHWKH racks with the graphite lubricant provided with your oven. Remove the rack from the oven, remove debris in the side tracks with a paper towel, shake the graphite lubricant and place 4 small drops on the two bottom tracks of the left and right sides. Open and close the rack several times to distribute the lubricant. To order additional graphite lubricant, read the Accessories section of the manual. To Remove An Extension Rack: 1. Make sure the rack is pushed all the way into the oven so that side paddles on the rack disengage from the oven support. 2. Slide the rack toward you to the bump (stop position) on the rack support. 3. Firmly grasp both sides of the rack frame and the sliding rack, tilt the front end up and pull it out. To Replace An Extension Rack: 1. Firmly grasp both sides of the rack frame and the sliding rack. 2. Place the curved end of the rack (stop-locks) onto the oven supports, tilt up the front of the rack and push it in as far as it will go. ,IH[WHQVLRQUDFNVDUHGLIILFXOWWRUHSODFHRUUHPRYHZLSH WKHRYHQUDFNVXSSRUWVZLWKYHJHWDEOHRLO'RQRWZLSHRLO on the rack slides. NOTE: 8VLQJRWKHUFRRNLQJRLOVZLOOFDXVHDGLVFRORULQJ or a rust like color residue on the racks and cavity sides. To clean this residue, use a soap and water or a vinegar and water solution. Rinse with clean water and dry with a soft cloth. To Lubricate the Paddle: Shake lubricant and apply to the moving parts of the paddle mechanisms as shown. 8SSHU)URQW Rail Fully Open Position Grasp here 49-2000375 Rev. 1 11 USING THE OVEN: $OXPLQXP )RLO DQG 2YHQ /LQHUV &RRNZDUH *XLGHOLQHV $LU )U\ &RRNZDUH Aluminum Foil and Oven Liners CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of these items is not covered by the product warranty. )RLOPD\EHXVHGWRFDWFKVSLOOVE\SODFLQJDVKHHWRQDORZHUUDFNVHYHUDOLQFKHVEHORZWKHIRRG'RQRWXVHPRUH IRLOWKDQQHFHVVDU\DQGQHYHUHQWLUHO\FRYHUDQRYHQUDFNZLWKDOXPLQXPIRLO.HHSIRLODWOHDVW´IURPRYHQZDOOV to prevent poor heat circulation. Cookware Guidelines 7KHPDWHULDOILQLVKDQGVL]HRIFRRNZDUHDIIHFWEDNLQJ performance. 'DUNFRDWHGDQGGXOOSDQVDEVRUEKHDWPRUHUHDGLO\ than light, shiny pans. Pans that absorb heat more readily can result in a browner, crisper, and thicker crust. ,IXVLQJGDUNDQGFRDWHGFRRNZDUHFKHFNIRRGHDUOLHU WKDQPLQLPXPFRRNWLPH,IXQGHVLUDEOHUHVXOWVDUH obtained with this type of cookware consider reducing oven temperature by 25º F next time. Shiny pans can produce more evenly cooked baked goods such as cakes and cookies. Glass and ceramic pans heat slowly but retain heat well. These types of pans work well for dishes such as pies and custards. Air insulated pans heat slowly and can reduce bottom browning. .HHSFRRNZDUHFOHDQWRSURPRWHHYHQKHDWLQJ Air Fry Cookware Any cookware used on Air Fry mode should be broil safe. A dark surface, solid baking pan with low rimmed sides, such as a sheet pan, is recommended for use with Air Fry. The darker pan surface promotes better browning and crisping. Oven baking baskets and baking grids can also be used, but a sheet pan should be placed on the rack below the foods to catch any drippings when using a baking basket. Primary recommended cookware Alternate cookware options 12 49-2000375 Rev. 1 USING THE OVEN: Cooking Modes Cooking Modes Your new oven has a variety of cooking modes to help you get the best results. These modes are described below. Refer to the Cooking Guide section for recommendations for specific foods. Remember, your new oven may perform differently than the oven it is replacing. Temperature Setting Convection Modes When selecting a temperature, the traditional preset temperatures are shown and can be selected by VFUROOLQJKRUL]RQWDOO\DQGVHOHFWLQJWKHGHVLUHG WHPSHUDWXUH,I\RXZLVKWRFRRNDWDQDOWHUQDWH temperature, press the temperature in the middle of the screen and a number pad will appear so the desired temperature can be input. Bake The traditional bake mode is intended for single rack cooking. This mode uses heat primarily from the lower element but also from the upper element to cook food. To use this mode press the Bake option on the main menu and scroll to the desired temperature and press Start. Preheating is generally recommended when using this mode. Broiling Modes Always broil with the door closed. The broil element in this oven is very powerful. Monitor food closely while EURLOLQJ8VHFDXWLRQZKHQEURLOLQJRQXSSHUUDFN positions as placing food closer to the broil element increases smoking, spattering, and the possibility of fats igniting. Broiling on rack position 6 is not recommended. %URLOLQJFDQEHXVHGIRUIRRGVWKDWZRXOGW\SLFDOO\EH grilled. Adjust the rack position in order to vary the intensity of the heat to the food. Place foods closer to the broil element when a seared surface and rare interior are desired. For best performance, center the food below the broil heating element. Broil 7KHVHPRGHVXWLOL]HKHDWIURPWKHWUDGLWLRQDOXSSHUDQG lower elements combined with the convection element and consistent airflow to enhance evenness. Your oven is equipped with Auto Recipe Conversion so that it automatically adjusts the amount of heat to maintain the proper temperature when using the modes with specified temperatures. Preheating is recommended for these modes. Convection Bake This mode is intended for single rack baking when additional airflow is desired to enhance evenness. Select Convect, then Bake, scroll to the desired temperature, and press Start. Preheating is generally recommended when using this mode. Convection Bake Multi Rack This mode has been designed to allow for more even FRRNLQJZKHQPXOWLSOHUDFNVDUHXWLOL]HG%DNLQJWLPH may be slightly longer than what would be expected for a single rack. To use this mode, select Convect, then Bake Multi-Rack, scroll to the desired temperature, and press Start. Preheating is generally recommended when using this mode. Convection Roast This mode is intended for roasting whole cuts of meat RQDVLQJOHUDFN7KHXWLOL]DWLRQRIDOOWKUHHHOHPHQWVDQG direct airflow down from the top of the oven improves browning and reduces cooking time. Check food earlier than the recipe suggests or use the probe when using this mode. To use this mode, select Convect, then press Roast, scroll to the desired temperature, and press Start. Select Broil on the main menu, then select High or Low depending on the amount of searing and the internal temperature that is preferred. The High setting is best for thinner cuts of meat and/or foods you prefer less done on WKHLQWHULRU7KH/RZVHWWLQJLVSUHIHUUHGIRUWKLFNHUFXWVRI meat and foods you like to be cooked all the way through. ,WLVQRWQHFHVVDU\WRSUHKHDWWKHRYHQIRUWKHVHPRGHV Convection Broil (upper only on double oven models) &RQYHFWLRQ%URLOKDVWZRRSWLRQV/RZDQG+LJK/RZ and High are similar to the traditional broil modes with the addition of direct airflow to aid in searing and EURZQLQJ)RUEHVWUHVXOWVZLWKWKH/RZDQG+LJK settings, it is recommended to preheat the oven for 5 minutes. To use these modes, select Convect, then Broil, then your desired mode. 49-2000375 Rev. 1 13 USING THE OVEN: Cooking Modes Cooking Modes (Cont.) Air Fry (upper only on double oven models) This mode is a special convection mode that is designed to produce foods with a crispier exterior than traditional oven cooking. The Air Fry mode uses hot, fast-moving air directed from above the food and is intended for single rack baking only. Select More, then Air Fry, then input the desired set temperature and press Start. The temperature can be set between 300°F and 500°F. Preheating is not necessary for this mode. Follow recipe or package guidelines for set temperatures and cook times; adjust cook time to achieve your desired crispness. Additional guidelines for using this mode can be found in the Cooking Guide. Proof Proof mode is designed for rising (fermenting and proofing) bread doughs. Press the More option on the main menu, then Proof, then Start. Cover dough well to SUHYHQWGU\LQJRXW%UHDGZLOOULVHPRUHUDSLGO\WKDQDW room temperature. NOTE:'RQRWXVHWKH3URRIPRGH for warming food or keeping food hot. The proofing oven temperature is not hot enough to hold foods at safe temperatures. Warm Warm mode is designed to keep hot foods at a higher temperature for up to 3 hours. To use this mode, select More from the main menu, then Warm, then press Start. 3UHKHDWLQJLVQRWUHTXLUHG'RQRWXVHZDUPWRKHDWFROG food other than crisping crackers, chips, or dry cereal. ,WLVDOVRUHFRPPHQGHGWKDWIRRGQRWEHNHSWZDUPIRU more than 2 hours. Precision Cooking (upper only on double oven models) These modes provide guidance and pre-set cooking algorithms to assist the user in cooking various types of food. The selection you make in the Precision Cooking menu will guide you to input the information required to help cook your food. Some cycles use a preselected oven temperature; in these cases, the temperature is not displayed. Some cycles automatically set a timer based on your selections. At the end of estimated cooking WLPHFKHFNWKHIRRGWRVHHLILWLVGRQHWR\RXUOLNLQJ,I it is not, add time by selecting +1min or just continue FRRNLQJ1RWHWKDWGLIIHUHQFHVLQIRRGVKDSHSUHSDUDWLRQ and preferences for doneness can impact the time required to cook the food. Some cycles are designed to cook the food without preheating the oven first. For WKHVHF\FOHVWKHVFUHHQZLOOVKRZ³,QVHUW\RXUIRRGDQG SUHVVQH[WWRVWDUWWKHRYHQ´'RQRWZDLWIRUWKHRYHQWR preheat when using these cycles. Some cycles require the food temperature probe supplied with your oven. The target temperature for the probe is automatically set based on selections made. Always check foods using a secondary food thermometer as probe placement can impact the measured temperature. See Probe section for more details on using and positioning the probe properly. On some pages i will show up. Press i to access additional information that pertains to the cooking cycles within that category. Additional cycles will be available through software updates. Connect your oven to have access to these updates. See the Wi-Fi Connect section for details on how to connect your oven. 14 49-2000375 Rev. 1 USING THE OVEN: Probe Probe WARNING Consuming undercooked food can result in foodborne illness. Use probe according to the following instructions to ensure all portions of the food reach minimum safe cooking temperatures. Recommendations for minimum safe food temperatures can be found at foodsafety.gov or IsItDoneYet.gov. Internal food temperature is frequently used as an indicator of doneness, especially for roasts and poultry. The Probe mode monitors the internal food temperature and turns the oven off when the internal food temperature reaches the programmed temperature. Always check the temperature at multiple locations in the food with a food thermometer after cooking to ensure that all portions of the food have reached the minimum safe internal temperature for that food. Proper Probe Placement After preparing the meat and placing it on the cooking pan follow these instructions for proper probe placement. ,QVHUWWKHSUREHLQWRWKHIRRGVRWKDWWKHWLSRIWKH probe will rest in the center of the thickest part of the food. For best performance the probe should EHIXOO\LQVHUWHGLQWRWKHIRRG,IWKHSUREHLVQRW located properly, it may not accurately measure the temperature of the coolest portion of the food. Some foods, particularly small items, are not well suited for FRRNLQJZLWKWKHSUREHGXHWRWKHLUVKDSHRUVL]H 7KHSUREHVKRXOGQRWWRXFKERQHIDWRUJULVWOH )RUZKROHSRXOWU\LQVHUWWKHSUREHLQWRWKHWKLFNHVW part of the breast. )RUERQHOHVVURDVWVLQVHUWWKHSUREHLQWRWKHFHQWHU of the roast. )RUERQHLQKDPRUODPELQVHUWWKHSUREHLQWRWKH center of the lowest large muscle or joint. )RUFDVVHUROHVRUGLVKHVVXFKDVPHDWORDILQVHUWWKH probe into the center of the dish. )RUILVKLQVHUWWKHSUREHIURPMXVWDERYHWKHJLOOLQWR the meatiest area, parallel to the backbone. Probe Usage To use the probe without preheating: ,QVHUWWKHSUREHLQWRWKHIRRGVHH3URSHU3UREH Placement). 2. Place the food in the oven and connect the probe into the probe outlet in the oven. 3. Program the desired probe and cooking mode settings by selecting More, then Probe, then choosing the GHVLUHGFRRNLQJPRGH1H[WFKRRVHWKHGHVLUHG cooking temperature and select Next. Finally, select the desired internal food temperature and press Start. To use the probe with preheating: 1. Press the desired cook mode (Traditional Bake, Convection Bake, or Convection Roast) and select the desired cooking temperature. ,QVHUWWKHSUREHLQWRWKHIRRGVHH3URSHU3UREH Placement). 3. Once the oven is preheated, place the food in the oven and connect the probe to the probe outlet, PDNLQJVXUHLWLVIXOO\LQVHUWHG8VHFDXWLRQWKHRYHQ walls and probe outlet are hot. 4. Program the probe temperature by selecting More, then Probe, then entering the desired internal food temperature. The maximum internal food temperature that you can set is 200° F. Probe Care Guidelines 8VHRISUREHVRWKHUWKDQWKHRQHSURYLGHGZLWKWKLV product may result in damage to the probe input jack. 8VHWKHKDQGOHVRIWKHSUREHDQGSOXJZKHQLQVHUWLQJ and removing them from the meat and outlet 7RDYRLGGDPDJLQJ\RXUSUREHGRQRWXVHWRQJVWR pull on the cable when removing it. 7RDYRLGEUHDNLQJWKHSUREHPDNHVXUHIRRGLV completely defrosted before inserting the probe. 7RSUHYHQWSRVVLEOHEXUQVGRQRWXQSOXJWKHSUREH from the outlet until the oven has cooled. 1HYHUOHDYHWKHSUREHLQVLGHWKHRYHQGXULQJDVHOIRU steam clean cycle. 'RQRWVWRUHWKHSUREHLQWKHRYHQ 49-2000375 Rev. 1 15 USING THE OVEN: Cooking Guide Cooking Guide 7KHWDEOHEHORZSURYLGHVVRPHJXLGHOLQHVIRUW\SLFDOFRRNLQJPRGHV,I\RXZRXOGOLNHWRXVH3UHFLVLRQ&RRNLQJ modes they can be substituted for the modes shown below for applicable foods. FOOD TYPE Baked Goods /D\HUFDNHVVKHHWFDNHVEXQGW cakes, muffins, quick breads on a Single Rack /D\HUFDNHV RQ0XOWLSOH5DFNV Chiffon cakes (angel food) Cookies, biscuits, scones on a Single Rack Cookies, biscuits, scones on Multiple Racks Beef & Pork Hamburgers RECOMMENDED RECOMMENDED MODE(S) RACK POSITION(S) &RQYHFWLRQ%DNH 7UDGLWLRQDO%DNH &RQYHFWLRQ%DNH0XOWL &RQYHFWLRQ%DNH 7UDGLWLRQDO%DNH &RQYHFWLRQ%DNH 7UDGLWLRQDO%DNH &RQYHFWLRQ%DNH0XOWL 3 1 ext. and 4 flat 1 3 1 ext. and 4 flat %URLO+L 5 ext. ADDITIONAL SUGGESTIONS 8VHVKLQ\FRRNZDUH Ensure adequate airflow (see illustration below). 8VHVKLQ\FRRNZDUH 8VHVKLQ\FRRNZDUH Ensure adequate airflow. 8VHDEURLOSDQPRYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ Watch food closely when broiling. For best performance, center food below the broil heating element. Steaks & Chops %URLO+L 5 ext. 8VHDEURLOSDQPRYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ Watch food closely when broiling. For best performance, center food below the broil heating element. Roasts Poultry Whole chicken %RQHLQFKLFNHQEUHDVWVOHJV thighs %RQHOHVVFKLFNHQEUHDVWV Whole turkey 7XUNH\%UHDVW Fish Casseroles Frozen Convenience Foods 3L]]DRQDVLQJOHUDFN 3L]]DRQPXOWLSOHUDFNV Potato products, chicken nuggets, DSSHWL]HUVRQVLQJOHUDFNV Potato products, chicken nuggets, DSSHWL]HUVRQPXOWLSOHUDFNV 7UDGLWLRQDO%DNH Convection Roast 7UDGLWLRQDO%DNH Convection Roast %URLO/R 7UDGLWLRQDO%DNH Convection Roast %URLO/R 7UDGLWLRQDO%DNH Convection Roast 7UDGLWLRQDO%DNH Convection Roast 7UDGLWLRQDO%DNH Convection Roast %URLO/R &RQYHFWLRQ%DNH 7UDGLWLRQDO%DNH &RQYHFWLRQ%DNH 7UDGLWLRQDO%DNH &RQYHFWLRQ%DNH0XOWL &RQYHFWLRQ%DNH 7UDGLWLRQDO%DNH Air Fry (on single and upper ovens only) &RQYHFWLRQ%DNH0XOWL 1 or 2 2 2 or 3 2 or 3 1 or 2 1 or 2 5 (1/2 thick or less) 4 (>1/2 inch) 3 3 1 ext. and 4 flat 3 1 ext. and 4 flat /HDYHXQFRYHUHGXVHDORZVLGHGSDQVXFKDVDEURLOSDQ Preheating is not necessary. 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ Preheating is not necessary. %URLOVNLQVLGHGRZQILUVW:DWFKIRRGFORVHO\ZKHQEURLOLQJ)RU best performance when broiling, center food below the broil heating element. Move food down for more doneness/less searing and up for greater searing/browning when broiling. For best performance when broiling, center food below the broil heating element. 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ Preheating is not necessary. 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ Preheating is not necessary. Watch food closely when broiling. For best performance, center food below the broil heating element. 8VHVKLQ\FRRNZDUH 8VHVKLQ\FRRNZDUH 8VHVKLQ\FRRNZDUHZKHQXVLQJWUDGLWLRQDOEDNH and convection bake. 8VHGDUNFRRNZDUHRUFRRNLHVKHHWZKHQXVLQJ$LU)U\ 8VHVKLQ\FRRNZDUH6ZLWFKIRRGORFDWLRQSDUWLDOO\WKURXJK cooking for more even cooking results. *When baking four cake layers at a time, use racks on 2 and 4 for a lower oven; use 1 extension and 4 flat for an upper or single oven. Place the pans as shown so that one pan is not directly above another. Cook food thoroughly to help protect against food borne illness. Minimum safe food temperature recommendations for food safety can be found at IsItDoneYet.gov. Make sure to use a food thermometer to take food temperatures. 16 Single/upper oven /RZHURYHQ 49-2000375 Rev. 1 CARE AND CLEANING: Cleaning The Oven - Exterior Cleaning The Oven - Exterior %HVXUHDOOFRQWUROVDUHRIIDQGDOOVXUIDFHVDUHFRROEHIRUHFOHDQLQJDQ\SDUWRIWKHUDQJH Control Panel To lock the controls, press in the bottom left corner DQGIROORZLQVWUXFWLRQVRQWKHGLVSOD\,QVWUXFWLRQVIRU XQORFNLQJDUHYLVLEOHZKHQWKHGLVSOD\LVORFNHG,W¶V a good idea to wipe the control panel after each use. Clean with mild soap and water or vinegar and water, rinse with clean water and polish dry with a soft cloth. 'RQRWXVHDEUDVLYHFOHDQVHUVVWURQJOLTXLGFOHDQVHUV plastic scouring pads or oven cleaners on the control SDQHO²WKH\ZLOOGDPDJHWKHILQLVK Oven Exterior 'RQRWXVHRYHQFOHDQHUVDEUDVLYHFOHDQVHUVVWURQJ liquid cleansers, steel wool, plastic scouring pads, or cleaning powders on the interior or exterior of the oven. Clean with a mild soap and water or vinegar and water solution. Rinse with clean water and dry with a soft cloth. When cleaning surfaces, make sure that they are at room temperature and not in direct sunlight. ,IVWDLQRQWKHGRRUYHQWWULPLVSHUVLVWHQWXVHDPLOG abrasive cleaner and a sponge-scrubber for best results. Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration DQGVKRXOGEHZLSHGXSLPPHGLDWHO\/HWKRWVXUIDFHV cool, then clean and rinse. Painted Surfaces and Black Stainless Steel (on some models) Painted surfaces may include the door and trim around the control panel. Clean these with soap and water or a vinegar and water solution. 'RQRWXVHFRPPHUFLDORYHQFOHDQHUVFOHDQLQJ powders, steel wool or harsh abrasives on any painted VXUIDFHLQFOXGLQJ%ODFN6WDLQOHVV6WHHO Stainless Steel - Excluding Black Stainless Steel (on some models) 'RQRWXVHDVWHHOZRROSDGLWZLOOVFUDWFKWKHVXUIDFH To clean the stainless steel surface, use warm sudsy water or a stainless steel cleaner or polish. Always wipe the surface in the direction of the grain. Follow the cleaner instructions for cleaning the stainless steel surface. &OHDQHUVZLWKR[DOLFDFLGVXFKDV%DU.HHSHUV)ULHQG6RIW CleanserTM will remove surface rust, tarnish and small EOHPLVKHV8VHRQO\DOLTXLGFOHDQVHUIUHHRIJULWDQGUXELQ the direction of the brush lines with a damp, soft sponge. To inquire about purchasing cleaning products including stainless steel appliance cleaner or polish, see the Accessories and Consumer Support sections at the end of this manual. 49-2000375 Rev. 1 17 CARE AND CLEANING: &OHDQLQJ7KH2YHQ,QWHULRU3UREH Cleaning The Oven - Interior The interior of your new oven can be cleaned manually or by using Steam Clean or Self Clean modes. Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration and VKRXOGEHZLSHGXSLPPHGLDWHO\/HWKRWVXUIDFHVFRROWKHQFOHDQDQGULQVH Manual Cleaning 'RQRWXVHRYHQFOHDQHUVVWURQJOLTXLGFOHDQVHUV steel wool, or scouring pads on the interior of the oven. Clean with a mild soap and water, or vinegar and water solution. Rinse with clean water and dry with a soft cloth. When cleaning surfaces, make sure that they are at room temperature. Steam Clean Mode Steam clean is intended to clean small spills using water and a lower cleaning temperature than Self-Clean. To use the Steam Clean feature, wipe grease and soils from the oven. Pour one cup of water into the bottom of the oven. Close the door. Press the More option, then select Steam Clean, and press Start to the right of the screen. The oven door will lock. You cannot open the door during the 30 minute steam clean as this will decrease the steam clean performance. At the end of the steam clean cycle the door will unlock. Wipe out any excess water and any remaining soil. NOTE: Water in the bottom of the oven may be hot right after finishing the cycle. Self Clean Mode 5HDG6HOI&OHDQLQJ2YHQ6DIHW\,QVWUXFWLRQVDWWKH beginning of this manual before using Self Clean Mode. Self clean uses very high temperatures to clean the oven interior. The oven door will lock when using this feature. %HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHZLSHXSJUHDVHDQG soils from the oven. Remove all items from the oven other than enameled (dark color) racks. Shiny or silver racks, the meat probe, and any cookware or other items should all be removed from the oven before initiating a self clean F\FOH&ORVHWKHGRRU,IXVLQJDGRXEOHRYHQVHOHFWZKLFK oven you would like to clean. Select the More option, then Self Clean. Choose a 3, 4, or 5 hour cycle, and select the illuminated Start pad to the right of the screen. For heavily soiled ovens, the maximum 5 hour clean time is UHFRPPHQGHG,I\RXZLVKWRXVHWKHGHIDXOWWLPHSUHVV Start immediately after selecting Self Clean. The oven will show that the door has locked and display the amount of time remaining in the cycle. Press the illuminated Cancel pad to the right of the screen if you wish to stop the cycle. The oven will turn off automatically when the self clean cycle is complete. The door will stay locked until the oven has cooled down. After the oven has cooled down wipe any ash out of the oven. Probe We recommend venting your kitchen with an open window or using a ventilation fan or hood during the first self-clean cycle. Soil on the front frame of the oven and outside the gasket on the door will need to be cleaned by hand. Clean these areas with hot water, soap-filled steel wool pads or cleaners such as Soft Scrub®. Rinse well with clean water and dry. 'RQRWFOHDQWKHJDVNHW7KHILEHUJODVVPDWHULDORI WKHRYHQGRRUJDVNHWFDQQRWZLWKVWDQGDEUDVLRQ,WLV HVVHQWLDOIRUWKHJDVNHWWRUHPDLQLQWDFW,I\RXQRWLFHLW becoming worn or frayed, replace it. Make sure the oven light bulb cover is in place and the oven light is off. When using the Self Clean Mode in a GRXEOHRYHQRQO\WKHXSSHURUORZHURYHQFDQXWLOL]H the cycle at one time. Additionally, no other mode may be started in the alternate oven cavity while self clean is in progress. IMPORTANT: The health of some birds is extremely sensitive to the fumes given off during the self-cleaning cycle of any range. Move birds to another well-ventilated room. The temperature probe may be cleaned with soap and water or a soap-filled scouring pad. Cool the temperature probe before cleaning. Scour stubborn spots with a soapfilled scouring pad, rinse and dry. To order additional temperature probes see the Accessories and Consumer Support sections at the end of this manual. 'RQRWLPPHUVHWKHWHPSHUDWXUHSUREHLQZDWHU 'RQRWVWRUHWKHWHPSHUDWXUHSUREHLQWKHRYHQ 'RQRWOHDYHWKHWHPSHUDWXUHSUREHLQVLGHWKHRYHQ during a self or steam clean cycle. 18 49-2000375 Rev. 1 CARE AND CLEANING: 2YHQ/LJKW2YHQ'RRU Oven Light WARNING SHOCK OR BURN HAZARD:%HIRUHUHSODFLQJRYHQOLJKWEXOEGLVFRQQHFWWKHHOHFWULFDOSRZHUWRWKH oven at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn. CAUTION BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with bare hands or a damp cloth can cause burns. 'LVFRQQHFWSRZHUDWWKHPDLQIXVHRUFLUFXLWEUHDNHU 6. Remove the glass light cover. panel. 7. Remove the bulb by firmly grasping and sliding the 2. Remove oven racks. bulb straight out until the two prongs have cleared 3. Slide a flat blade screwdriver or butter knife between the ceramic holder. the metal housing and the glass light cover. 'RQRWWRXFKWKHJODVVRIWKHQHZUHSODFHPHQWEXOE NOTE: on some models there is a metal clip visibly ZLWK\RXUILQJHUV,WZLOOFDXVHWKHEXOEWRIDLOZKHQLW holding the glass. The tool needs inserted between lights. Grasp the replacement bulb with a clean towel the metal housing and the clip holding the glass. or facial tissue with the prongs facing down. Align 4. Support the glass light cover with two fingers to prevent the two prongs in the ceramic holder, pressing gently the cover from falling to the bottom of the oven. until the bulb is securely in the ceramic socket. 5. Gently twist the screwdriver blade or butter knife to 9. Slide the protective lens into the holder and push ORRVHQWKHJODVVOLJKWFRYHU%HFDUHIXOQRWWRFKLS until the clips snap into the housing. the oven coating. 10. Reconnect power. Oven Door Oven Door Removal NOTE:'RRUUHPRYDOLVQRWDUHTXLUHPHQWIRULQVWDOODWLRQ of the product but is an added convenience. To remove the door: 1. Open the oven door as far as it will go. 2. Remove hinge bracket (if present) from front frame and set aside. The hinge bracket must be replaced for proper door functionality when door is reinstalled. 3. Push both hinge locks down toward the door frame to the unlocked position. This may require a flat-blade screwdriver. DO NOT LIFT THE DOOR BY THE HANDLE! 4. Place hands on both sides of the door and close the oven door to the removal position (approximately ´±´>FP±FP@IURPWKHFORVHGSRVLWLRQ /LIWWKHGRRUXSDQGRXWXQWLOWKHKLQJHDUPVFOHDUWKH slots. NOTE:7KHRYHQGRRULVYHU\KHDY\%HVXUH you have a firm grip before lifting the oven door off WKHKLQJHV8VHFDXWLRQRQFHWKHGRRULVUHPRYHG 'RQRWOD\WKHGRRURQLWVKDQGOH7KLVFRXOGFDXVH dents or scratches. +LQJH%UDFNHW +LQJH8QORFNHG Position Hinge Slot Replacing the Oven Door NOTE: The oven door is heavy. You may need help lifting the door high enough to slide it into the hinge slots. 'RQRWOLIWWKHGRRUE\WKHKDQGOH /LIWWKHRYHQGRRUE\JUDVSLQJHDFKVLGH 2. With the door at the same angle as the removal SRVLWLRQDSSUR[LPDWHO\´±´>FP±FP@IURP the closed position), seat the notch of the hinge arm into the bottom edge of the hinge slot. The notch of the hinge arm must be fully seated into the bottom of the slot. )XOO\RSHQWKHGRRU,IWKHGRRUZLOOQRWIXOO\RSHQWKH indentation is not seated correctly in the bottom edge of the slot. 4. Push the hinge locks up against the front frame of the oven cavity, to the locked position. 5. Replace hinge bracket (if present). The hinge bracket must be replaced for proper door functionality. 6. Close the oven door. Hinge in /RFNHG Position 1RWFKRI+LQJH Securely Fitted ,QWR%RWWRPRI Hinge Slot Hinge Arm %RWWRP Edge of Slot Hinge Arm +LQJH%UDFNHW 49-2000375 Rev. 1 Hinge Clears Slot +LQJH1RWFK 19 TROUBLESHOOTING TIPS Troubleshooting tips ... %HIRUH\RXFDOOIRUVHUYLFH Save time and money! Review the charts on the following pages or visit GEAppliances.com/ge/service-andsupport/cookingproducts.htm for helpful articles and support videos before you call for service. Problem Possible Cause What To Do My new oven doesn't cook like my old one. Is something wrong with the temperature settings? Your new oven has a different cooking system from your old oven and therefore may cook differently than your old oven. For the first few uses, follow your recipe times DQGWHPSHUDWXUHVFDUHIXOO\,I\RXVWLOOWKLQN\RXU new oven is too hot or too cold, you can adjust the temperature yourself to meet your specific cooking preference. See the Special Features Section to adjust the oven temperature. NOTE: This adjustment DIIHFWV7UDGLWLRQDO%DNH&RQYHFWLRQ%DNHDQG &RQYHFWLRQ%DNH0XOWLWHPSHUDWXUHVLWZLOOQRWDIIHFW &RQYHFWLRQ5RDVW7UDGLWLRQDO%URLO&RQYHFWLRQ%URLO or Clean. Food does not bake properly Oven controls improperly set. Rack position is incorrect or rack is not level. See the Cooking Modes section. See the Cooking Modes section and Cooking Guide. ,QFRUUHFWFRRNZDUHRUFRRNZDUHRILPSURSHUVL]H See the Cookware section. being used. Oven temperature needs adjustment. See the Cooking option under the Settings section. ,QJUHGLHQWVXEVWLWXWLRQ Substituting ingredients can change the recipe outcome. Food does not broil properly Oven controls improperly set. ,PSURSHUUDFNSRVLWLRQEHLQJXVHG Make sure you select the appropriate broil mode. See the Cooking Guide for rack location suggestions. Food being cooked in a hot pan. Make sure cookware is cool Cookware not suited for broiling. 8VHDSDQVSHFLILFDOO\GHVLJQHGIRUEURLOLQJ Aluminum foil used on the broiling pan and grid has not been fitted properly and slit as recommended. ,IXVLQJDOXPLQXPIRLOFRQIRUPWRSDQVOLWV ,QVRPHDUHDVWKHSRZHUYROWDJHPD\EHORZ Preheat the broil element for 10 minutes. Oven temperature too hot or too cold Oven temperature needs adjustment. See the Cooking option under the Settings section. Oven does not work or A fuse in your home may be blown or the circuit appears not to work breaker tripped. Replace the fuse or reset the circuit breaker. Oven controls improperly set. 6HHWKH8VLQJWKH2YHQVHFWLRQ Oven is in Sabbath Mode 9HULI\WKDWWKHRYHQLVQRWLQ6DEEDWK0RGH6HHWKH Sabbath option under the Settings section. "Crackling" or "popping" sound This is the sound of the metal heating and cooling This is normal. during both the cooking and cleaning functions. Why is my range making a "clicking" noise when using my oven? Your range has been designed to maintain a tighter control over your oven's temperature. You may hear your oven's heating elements "click" on and off more frequently than in older ovens to achieve better results during baking, broiling, convection, and self-clean cycles. This is normal. Clock and timer do not A fuse in your home may be blown or the circuit work breaker tripped. Replace the fuse or reset the circuit breaker. Oven light does not work /LJKWEXOELVORRVHRUGHIHFWLYH Tighten or replace bulb. Oven will not self-clean The temperature is too high to set a self-clean operation. Allow the oven to cool and reset the controls. Oven controls improperly set. See the Cleaning the Oven section. 20 49-2000375 Rev. 1 TROUBLESHOOTING TIPS Troubleshooting tips ... %HIRUH\RXFDOOIRUVHUYLFH Problem Excessive smoking during clean cycle Possible Cause Excessive soil or grease. Excessive smoking during broiling Oven door will not open after a clean cycle Oven not clean after a clean cycle Food too close to burner element. Oven too hot. Oven controls improperly set. Oven was heavily soiled. "F-- and a number or letter" are displayed on LCD screen You have a function error code. ,IWKHIXQFWLRQFRGHUHSHDWV LCD is not functioning properly A fuse in your home may be blown or the circuit breaker tripped. Oven controls improperly set. /&'VFUHHQLVORFNHG /&'LVIDXOW\ Power outage, clock resets Power outage or surge "Burning" or "oily" odor This is normal in a new oven and will disappear in emitting from the vent time. Strong odor Fan noise An odor from the insulation around the inside of the oven is normal for the first few times the oven is used. A cooling fan may automatically turn on. My oven door glass appears to be "tinted" or have a "rainbow" color. Is this defective? 1R7KHLQQHURYHQJODVVLVFRDWHGZLWKDKHDW barrier to reflect the heat back into the oven to prevent heat loss and keep the outer door cool while baking. Sometimes the oven Cookware or food in oven takes longer to preheat to the same temperature 1XPEHURIUDFNVLQRYHQ 'LIIHUHQWFRRNLQJPRGHV Oven will not work remotely Router issues, no wireless signal, etc. Oven is not connected. What To Do Press Cancel on the pad to the right of the screen to stop the cycle. Open the windows to rid the room of smoke. Wait until the door unlocks. Wipe up the excess soil and reset the clean cycle. /RZHUWKHUDFNSRVLWLRQRIWKHIRRG Allow the oven to cool below locking temperature. See the Cleaning the Oven section. Clean up heavy spillovers before starting the clean cycle. Heavily soiled ovens may need to self-clean again or for a longer period of time. Press DismissRQWKH/&'VFUHHQ$OORZWKHRYHQWR cool for one hour. Put the oven back into operation. 'LVFRQQHFWDOOSRZHUWRWKHRYHQIRUDWOHDVW VHFRQGVDQGWKHQUHFRQQHFWSRZHU,IWKHIXQFWLRQ error code repeats, call for service. Replace the fuse or reset the circuit breaker. See the Cooking Modes or Settings section to ensure proper use. Ensure unit is updated to the most recent software update. 8QORFNWKHVFUHHQE\SUHVVLQJWKHUnlockLFRQ,I this does not correct the issue, cycle power at the circuit breaker and ensure unit is updated to the most recent software update. Cycle power at the circuit breaker and ensure unit is XSGDWHGWRWKHPRVWUHFHQWVRIWZDUHXSGDWH,ILVVXH persists, call service to assess the issue. 5HVHWWKHFORFN,IWKHRYHQZDVLQXVH\RXPXVW reset it by pressing Cancel, setting the clock and resetting any cooking function. To speed the process, set a self-clean cycle for a minimum of 3 hours. See the Cleaning the Oven section. This is temporary and will go away after several uses or a self-clean cycle. This is normal. The cooling fan will turn on to cool LQWHUQDOSDUWV,WPD\UXQIRUXSWRKRXUVDIWHU the oven is turned off. 7KLVLVQRUPDO8QGHUFHUWDLQOLJKWRUDQJOHV\RX may see this tint or rainbow color. The cookware or food in the oven will cause the oven to take longer to preheat. Remove items to reduce preheat time. Adding more racks to the oven will cause the oven to take longer to preheat. Remove some racks. The different cooking modes use different preheat methods to heat the oven for the specific cooking mode. Some modes will take longer than others (i.e. convection bake multi). For assistance with oven wireless network connectivity, please call 1-800-220-6899. 49-2000375 Rev. 1 21 LIMITED WARRANTY GE Appliances Electric Oven Limited Warranty GEAppliances.com $OOZDUUDQW\VHUYLFHLVSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUVRUDQDXWKRUL]HG&XVWRPHU&DUH® technician. To schedule service online, visit us at GEAppliances.com/service_and_support/, or call GE Appliances at 800.GE.CARES (800.432.2737). Please have your serial number and your model number available when calling for service. Servicing your appliance may require the use of the onboard data port for diagnostics. This gives a GE Appliances factory service technician the ability to quickly diagnose any issues with your appliance and helps GE Appliances improve its SURGXFWVE\SURYLGLQJ*($SSOLDQFHVZLWKLQIRUPDWLRQRQ\RXUDSSOLDQFH,I\RXGRQRWZDQW\RXUDSSOLDQFHGDWDWREH sent to GE Appliances, please advise your technician not to submit the data to GE Appliances at the time of service. For the period of One year From the date of the original purchase GE Appliances will replace Any partRIWKHRYHQZKLFKIDLOVGXHWRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS'XULQJWKLV limited one-year warranty, GE Appliances will provide, free of charge, all labor and in-home service to replace the defective part. What GE Appliances will not cover: Service trips to your home to teach you how to use the product. ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH )DLOXUHRIWKHSURGXFWLILWLVDEXVHGPLVXVHG modified or used for other than the intended purpose or used commercially. 5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW breakers. 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUH floods or acts of God. 'DPDJHWRILQLVKVXFKDVVXUIDFHUXVWWDUQLVKRUVPDOO blemishes not reported within 48 hours of delivery. ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\ possible defects with this appliance. 'DPDJHFDXVHGDIWHUGHOLYHU\ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH 6HUYLFHWRUHSDLURUUHSODFHOLJKWEXOEVH[FHSWIRU /('ODPSV EXCLUSION OF IMPLIED WARRANTIES <RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQWKLV/LPLWHG:DUUDQW\$Q\LPSOLHGZDUUDQWLHV including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or the shortest period allowed by law. This limited warranty is extended to the original purchaser and any succeeding owner for products purchased for KRPHXVHZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($SSOLDQFHV$XWKRUL]HG6HUYLFHU LVQRWDYDLODEOH\RXPD\EHUHVSRQVLEOHIRUDWULSFKDUJHRU\RXPD\EHUHTXLUHGWREULQJWKHSURGXFWWRDQ$XWKRUL]HG *($SSOLDQFHV6HUYLFHORFDWLRQIRUVHUYLFH,Q$ODVNDWKHOLPLWHGZDUUDQW\H[FOXGHVWKHFRVWRIVKLSSLQJRUVHUYLFH calls to your home. Some states do not allow the exclusion or limitation of incidental or consequential damages. This limited warranty gives you specific legal rights, and you may also have other rights which vary from state to state. To know what your legal rights are, consult your local or state consumer affairs office or your state's Attorney General. Warrantor: GE Appliances, a Haier company /RXLVYLOOH.< Extended Warranties: Purchase a GE Appliances extended warranty and learn about special discounts that are available while your warranty is still in effect. You can purchase it online anytime at GEAppliances.com/extended-warranty or call 800.626.2224 during normal business hours. GE Appliances Service will still be there after your warranty expires. Staple your receipt here. Proof of the original purchase date is needed to obtain service under the warranty. 22 49-2000375 Rev. 1 ACCESSORIES Accessories Looking For Something More? GE Appliances offers a variety of accessories to improve your cooking and maintenance experiences! Refer to the Consumer Support page for phone numbers and website information. The following products and more are available: Accessories 6PDOO%URLOHU3DQô´[ó´[ò³ /DUJH %URLOHU3DQô´[ó´[ò³ ;/ %URLOHU3DQ´[ó´[³ Parts Oven racks Oven elements /LJKWEXOEV Probe Cleaning Supplies CitruShineTM Stainless Steel Wipes &HUDPD%U\WH6WDLQOHVV6WHHO$SSOLDQFH&OHDQHU *UDSKLWH/XEULFDQW 7KHODUJHEURLOHUSDQGRHVQRWILWLQ´´UDQJHV 7KH;/EURLOHUSDQGRHVQRWILWLQ´ZDOORYHQV´GURSLQV RU´´UDQJHV 49-2000375 Rev. 1 23 CONSUMER SUPPORT Consumer Support GE Appliances Website Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day, any day of the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support VHUYLFHVGHVLJQHGIRU\RXUFRQYHQLHQFH,QWKH86GEAppliances.com Register Your Appliance Register your new appliance on-line at your convenience! Timely product registration will allow for enhanced communication and prompt service under the terms of your warranty, should the need arise. You may also mail in the SUHSULQWHGUHJLVWUDWLRQFDUGLQFOXGHGLQWKHSDFNLQJPDWHULDO,QWKH86GEAppliances.com/register Schedule Service Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at \RXUFRQYHQLHQFHDQ\GD\RIWKH\HDU,QWKH86GEAppliances.com/service or call 800.432.2737 during normal business hours. Extended Warranties Purchase a GE Appliances extended warranty and learn about special discounts that are available while your warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your ZDUUDQW\H[SLUHV,QWKH86GEAppliances.com/extended-warranty or call 800.626.2224 during normal business hours. Remote Connectivity For assistance with wireless network connectivity (for models with remote enable), visit our website at GEAppliances.com/connect RUFDOOLQWKH86 Parts and Accessories ,QGLYLGXDOVTXDOLILHGWRVHUYLFHWKHLURZQDSSOLDQFHVFDQKDYHSDUWVRUDFFHVVRULHVVHQWGLUHFWO\WRWKHLUKRPHV 9,6$0DVWHU&DUGDQG'LVFRYHUFDUGVDUHDFFHSWHG2UGHURQOLQHWRGD\KRXUVHYHU\GD\ ,QWKH86GEApplianceparts.com or by phone at 877.959.8688 during normal business hours. Instructions contained in this manual cover procedures to be performed by any user. Other servicing generally should be referred to qualified service personnel. Caution must be exercised, since improper servicing may cause unsafe operation. Contact Us ,I\RXDUHQRWVDWLVILHGZLWKWKHVHUYLFH\RXUHFHLYHIURP*($SSOLDQFHVFRQWDFWXVRQRXU:HEVLWHZLWKDOOWKH details including your phone number, or write to: ,QWKH86*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.< GEAppliances.com/contact 3ULQWHGLQWKH8QLWHG6WDWHV 24 49-2000375 Rev. 1 HORNO DE PARED Eléctrico con Convección Directa de Aire Incorporada INFORMACIÓN DE SEGURIDAD . . . 3 USO DEL HORNO Controles del Horno. . . . . . . . . . . . . . . . . . . . . . . . 6 Horno Doble . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 Settings (Configuraciones) . . . . . . . . . . . . . . . . . . 7 Modo Sabático . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Estantes del Horno. . . . . . . . . . . . . . . . . . . . . . . . .10 Papel de Aluminio y Cobertores del Horno . . . . 12 Utensilios . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Modos de Cocción . . . . . . . . . . . . . . . . . . . . . . . . . 13 Probe (Sonda). . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Guía de Cocción . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 CUIDADO Y LIMPIEZA Cuidado y limpieza - Exterior. . . . . . . . . . . . . . . . 17 Cuidado y limpieza - Interior . . . . . . . . . . . . . . . . 18 Probe (Sonda). . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 Luz del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 Puerta del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . 19 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS . . . 20 GARANTÍA LIMITADA. . . . . . . . . . . . 22 ACCESORIOS . . . . . . . . . . . . . . . . . . . . . . 23 SOPORTE PARA EL CONSUMIDOR . . . . . . . . . . . . . . . . . 24 MANUAL DEL PROPIETARIO Horno de Pared Simple de 30" PTS7000 PTS700L PTS700R Horno de Pared Doble de 30" PTD7000 PTD700L PTD700R Escriba los números de modelo y de serie aquí: Nº de Modelo ____________ Nº de Serie ______________ Los podrá encontrar en una etiqueta en el borde lateral o en el frente del horno (inferior) detrás de la puerta del horno. GE es una marca registrada de General Electric Company. Fabricado bajo licencia de marca. 49-2000375 Rev. 1 08-19 GEA GRACIAS POR HACER QUE GE APPLIANCES SEA PARTE DE SU HOGAR. Ya sea que haya crecido usando GE Appliances, o que ésta es su primera vez, nos complace tenerlo en la familia. Sentimos orgullo por el nivel de arte, innovación y diseño de cada uno de los electrodomésticos de GE Appliances, y creemos que usted también. Entre otras cosas, el registro de su electrodoméstico asegura que podamos entregarle información importante del producto y detalles de la garantía cuando los necesite. Registre su electrodoméstico GE ahora a través de Internet. Sitios Web y números telefónicos útiles están disponibles en la sección de Soporte para el Consumidor de este Manual del Propietario. También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con el material embalado. 2 49-2000375 Rev. 1 INFORMACIÓN DE SEGURIDAD INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO ADVERTENCIA /HDWRGDVODVLQVWUXFFLRQHVGHVHJXULGDGDQWHVGHXWLOL]DUHVWHSURGXFWR1RVHJXLUHVWDVLQVWUXFFLRQHV puede generar un incendio, una descarga eléctrica, lesiones corporales o la muerte. ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD 8VHHVWHHOHFWURGRPpVWLFRVyORSDUDVXSURSyVLWRRULJLQDO como se describe en el Manual del Propietario. 6ROLFLWHTXHXQLQVWDODGRUFDOLILFDGRLQVWDOHVXHOHFWURGRPpVWLFR y que esté adecuadamente conectado a tierra, de acuerdo con las instrucciones de instalación provistas. 1RLQWHQWHUHSDUDURUHHPSOD]DUQLQJXQDSDUWHGHOKRUQR a menos que se recomiende específicamente en este manual. Cualquier otra reparación deberá ser realizada por un técnico calificado. $ QWHVGHUHDOL]DUFXDOTXLHUVHUYLFLRWpFQLFRGHVFRQHFWHHO suministro de corriente desde el panel de distribución del hogar, retirando el fusible o desconectando el disyuntor. 1RGHMHDORVQLxRVVRORV±QRVHGHEHUiGHMDUDORVQLxRV solos o fuera de su radio de atención en el área donde HOHOHFWURGRPpVWLFRVHHQFXHQWUHHQXVR1XQFDVHOHV deberá permitir trepar, sentarse o pararse sobre ninguna parte del electrodoméstico. PRECAUCIÓN 1RFRORTXHDUWtFXORVGHLQWHUpV para los niños sobre los gabinetes que están sobre un KRUQR±VLORVQLxRVVHWUHSDQVREUHHOKRUQRSDUDOOHJDUD estos artículos podrían sufrir lesiones graves. 8VHVyORPDQJRVGHROODVVHFDV±ORVPDQJRVK~PHGRV sobre superficies calientes pueden producir quemaduras GHELGRDOYDSRU1RGHMHTXHORVPDQJRVGHODVROODVWRTXHQ ORVHOHPHQWRVTXHHVWiQFDOLHQWHV1RXVHXQDWRDOODXRWUD tela voluminosa para reemplazar el mango de las cacerolas. 1XQFDXVHHOHOHFWURGRPpVWLFRSDUDFDOHQWDUR calefaccionar la habitación. 1RWRTXHHOHOHPHQWRFDOHQWDGRUQLODVXSHUILFLHLQWHULRUGHO horno. Es posible que estas superficies estén demasiado calientes como para quemar, aunque su color sea oscuro. Durante y después del uso, no toque ni permita que telas u otros materiales inflamables toquen cualquier área interior del horno; espere a que haya pasado un tiempo suficiente para que se enfríen. Otras superficies del electrodoméstico se podrán calentar lo suficiente como para ocasionar lesiones. Las superficies potencialmente calientes incluyen la abertura de la ventilación del horno, superficies cercanas a la abertura y grietas alrededor de la puerta del horno. 1RFDOLHQWHHQYDVHVGHFRPLGDTXHQRKD\DQVLGR abiertos. Se podría acumular presión y el envase podría explotar, ocasionando una lesión. 1RXVHQLQJ~QWLSRGHDOXPLQLRRFREHUWRUSDUDFXEULU el fondo del horno o cualquier parte del horno, excepto como se describe en este manual. Los cobertores de horno pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. (YLWHODVUDOODGXUDVRLPSDFWRVVREUHODVSXHUWDVGHYLGULRR los paneles de control. Hacer esto podrá producir la rotura GHYLGULRV1RFRFLQHXQSURGXFWRFRQXQYLGULRURWR(V posible que se produzcan descargas, incendios o cortes. &RFLQHFDUQHV\FDUQHVGHDYHHQIRUPDFRPSOHWD±OD carne por lo menos a una temperatura interna de 160º F y la carne de ave por lo menos a una temperatura interna GH)1RUPDOPHQWHODFRFFLyQDHVWDVWHPSHUDWXUDV es una protección contra las enfermedades transmitidas por la comida. ADVERTENCIA MANTENGA LOS MATERIALES INFLAMABLES ALEJADOS DE LA COCINA Si esto no se cumple, se podrán sufrir lesiones personales graves o incendios. 1RJXDUGHQLXVHPDWHULDOHVLQIODPDEOHVHQRFHUFDGH un horno, incluyendo papel, plástico, mangos de ollas, trapos, cobertores de pared, cortinas, paños y gasolina u otros vapores y líquidos inflamables. 1XQFDXVHSUHQGDVKROJDGDVRTXHFXHOJXHQPLHQWUDV usa el electrodoméstico. Estas prendas se podrán incendiar si entran en contacto con superficies calientes, ocasionando quemaduras graves. 1RSHUPLWDTXHODJUDVDGHODFRFFLyQXRWURVPDWHULDOHV inflamables se acumulen en o cerca del horno. La grasa que está en o cerca del horno se podrá incendiar. Funcionamiento Remoto - Este electrodoméstico permite su configuración para un funcionamiento remoto HQFXDOTXLHUPRPHQWR1RJXDUGHPDWHULDOHVLQIODPDEOHV ni ítems sensibles a la temperatura dentro de este electrodoméstico. LEA Y GUARDE ESTAS INSTRUCCIONES 49-2000375 Rev. 1 3 INFORMACIÓN DE SEGURIDAD INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO ADVERTENCIA EN CASO DE INCENDIO, SIGA LOS SIGUIENTES PASOS PARA EVITAR LESIONES O LA PROPAGACIÓN DEL FUEGO 1RXVHDJXDVREUHHOIXHJRGHODJUDVD1XQFDWRPHXQD olla que se esté incendiando. 6LKD\XQLQFHQGLRHQHOKRUQRGXUDQWHHOKRUQHDGR ahogue el fuego cerrando la puerta del horno y apagando el mismo o usando un químico seco multipropósito o un extintor de incendio con espuma. (QFDVRGHTXHKD\DIXHJRHQHOKRUQRGXUDQWHHOFLFOR de limpieza automática, apague el horno y espere a que el fuego se extinga. 1RIXHUFHODSXHUWDSDUDDEULUOD La entrada de aire fresco sobre las temperaturas de la limpieza automática podrá conducir a la producción de llamas en el horno. Si no se siguen estas instrucciones, se podrán producir quemaduras graves. ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DEL HORNO 0DQWpQJDVHDOHMDGRGHOKRUQRDODEULUODSXHUWDGHO mismo. El aire caliente o el vapor que sale puede causar quemaduras en las manos, rostro y/u ojos. 0DQWHQJDGHVREVWUXLGDODYHQWLODFLyQGHOKRUQR 0DQWHQJDHOKRUQROLEUHGHDFXPXODFLyQGHJUDVD/D grasa del horno se puede incendiar. &RORTXHORVHVWDQWHVGHOKRUQRHQODXELFDFLyQGHVHDGD mientras éste se encuentra frío. Si es necesario mover el estante mientras el horno está caliente, evite que el mango de la olla tenga contacto con el elemento calentador en el horno. $OXVDUODVEROVDVSDUDFRFLQDURGRUDUHQHOKRUQRVLJD las instrucciones del fabricante. ( VFRQYHQLHQWHHPSXMDUKDFLDDIXHUDORVHVWDQWHV estándares hasta el tope o empujar el estante extensible hasta la posición completamente abierta para levantar comidas pesadas. Esto también es una precaución contra quemaduras por tocar superficies calientes de la puerta o las paredes del horno. 1RGHMHSURGXFWRVWDOHVFRPRSDSHOXWHQVLOLRVGHFRFLQDQL comida en el horno cuando éste no se encuentre en uso. Los artículos guardados en el horno se pueden incendiar. 1XQFDFRORTXHORVXWHQVLOLRVGHFRFLQDSLHGUDVSDUD pizza u horneado o cualquier otro tipo de aluminio o cobertor en la base del horno. Estos ítems pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DEL HORNO CON LIMPIEZA AUTOMÁTICA La función de limpieza automática usa el horno en temperaturas lo suficientemente altas como para consumir la suciedad de comida que haya dentro del horno. Para un funcionamiento seguro, siga estas instrucciones. 1RWRTXHODVVXSHUILFLHVGHOKRUQRGXUDQWHHOFLFORGH limpieza automática. Mantenga a los niños alejados del horno durante la limpieza automática. Si no se siguen estas instrucciones, se podrán producir quemaduras. $ QWHVGHXWLOL]DUHOFLFORGHOLPSLH]DDXWRPiWLFDOLPSLH ODJUDVD\UHVWRVGHFRPLGDTXHKD\DHQHOKRUQR8QD cantidad excesiva de grasa se puede incendiar, lo cual puede producir daños con humo en su hogar. $QWHVGHXVDUHOFLFORGHOLPSLH]DDXWRPiWLFDGHOKRUQR retire los estantes de color gris brillante (en algunos modelos), la sonda, cualquier papel de aluminio, y cualquier bandeja para asar, rejilla, u otros utensilios. Sólo se pueden dejar dentro del horno los estantes para horno cubiertos de porcelana. LEA Y GUARDE ESTAS INSTRUCCIONES 4 49-2000375 Rev. 1 INFORMACIÓN DE SEGURIDAD INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DEL HORNO CON LIMPIEZA AUTOMÁTICA (Cont.) 6LHOPRGRGHOLPSLH]DDXWRPiWLFDIXQFLRQDGHIRUPD incorrecta, apague el horno y desconecte el suministro de corriente. Solicite el servicio de un técnico calificado. 1ROLPSLHODMXQWDGHODSXHUWD/DMXQWDGHODSXHUWDHV esencial para un buen sellado. Se debe tener cuidado de no frotar, dañar ni mover la junta. 1 RXVHOLPSLDGRUHVSDUDKRUQR1RVHGHEHUiXVDU limpiadores comerciales para horno ni revestimientos de protección para hornos de ningún tipo en o alrededor de cualquier parte del horno. El equipo de acceso remoto instalado en este horno fue probado y cumple con los límites establecidos para un GLVSRVLWLYRGLJLWDOGHFODVH%VHJ~QODSDUWHGHOD1RUPDWLYD de la FCC. Estos límites fueron diseñados para: (a) brindar una protección razonable contra interferencias nocivas en una instalación residencial. Este equipo genera, usa y puede emitir energía de radiofrecuencia y, si no se instala y utiliza de acuerdo con las instrucciones, puede ocasionar interferencias perjudiciales en las comunicaciones de radio. Sin embargo, no se garantiza que no se presenten interferencias en una instalación en particular. Si el equipo provoca interferencias perjudiciales para la recepción de radio o televisión, lo cual puede comprobar encendiendo y apagando el equipo, se aconseja al usuario que intente corregir la interferencia con una de las siguientes medidas: 5HRULHQWHRUHXELTXHODDQWHQDUHFHSWRUD $ XPHQWHODVHSDUDFLyQHQWUHHOHTXLSR\HOUHFHSWRU &RQHFWHHOHTXLSRDXQWRPDFRUULHQWHGHXQFLUFXLWRGLIHUHQWH del tomacorriente al que se encuentra conectado el receptor. 3DUDVROLFLWDUD\XGDFRQVXOWHFRQHOSURYHHGRUPLQRULVWDRD un técnico experimentado de radio/ TV. (b) tolerar cualquier interferencia recibida, incluyendo las interferencias que puedan provocar un funcionamiento no deseado del dispositivo. Observe que todos los cambios o modificaciones sobre el dispositivo de comunicación inalámbrico instalado en este horno que no estén expresamente aprobados por el fabricante podrían anular la autoridad del usuario para operar el equipamiento. Cómo Retirar la Película Protectora de Envío y la Cinta de Embalaje Con cuidado tome un extremo de la película protectora de envío con los dedos y lentamente retire la misma de la VXSHUILFLHGHOHOHFWURGRPpVWLFR1RXWLOLFHQLQJ~QSURGXFWR filoso para retirar la película. Retire toda la película antes de usar el electrodoméstico por primera vez. Para asegurar que no haya daños sobre el acabado del producto, la forma más segura de retirar el adhesivo de la cinta de embalaje en electrodomésticos nuevos es aplicando un detergente líquido hogareño para lavar platos. Aplique con una tela suave y deje que se seque. NOTA: El adhesivo deberá ser eliminado de todas las partes. 1RVHSXHGHUHWLUDUVLVHKRUQHDFRQpVWHGHQWUR LEA Y GUARDE ESTAS INSTRUCCIONES 49-2000375 Rev. 1 5 USO DEL HORNO: Controles del Horno Controles del Horno Los gráficos del control son representativos; es posible que su horno presente un aspecto gráfico alternativo. 12:30 PM UPPER OVEN LOWER OVEN 12:30 PM GET CONNECTED 12:30 PM UPPER OVEN LOWER OVEN Bake Broil Convect More Precision Cooking Recipes Bake Broil Convect More Precision Cooking Recipes 12:30 PM GET CONNECTED Bake Broil Convect More Precision Cooking Recipes Menú Principal del Horno de Pared Simple Menús principales del Horno de Pared Doble Upper Oven and Lower Oven (Horno Superior y Horno Inferior) Al usar un horno doble, usted puede configurar modos separados en cada horno. El horno seleccionado aparecerá en los modos de cocción. NOTA: Si usará un horno simple, no habrá selección de hornos. Bake (Hornear) Esta opción le permite al usuario acceder al modo de horneado tradicional. Broil (Asar) La función Broil (Asar) puede ser seleccionada para acceder a Broil Low (Asado Bajo) y Broil High (Asado Alto). Para más información, consulte la sección de Modos de Cocción. Convect (Convección) Esta opción le permite utilizar el sistema de convección para cocinar en una variedad de modos. Para más información, consulte la sección de Modos de Cocción. More (Más) Seleccione esta opción para acceder a las opciones de Proof (Leudar), Probe (Sonda), Warm (Calentar), Self Clean (Limpieza Automática), y Steam Clean (Limpieza con Vapor). Precision Cooking (Cocción de Precisión) (superior sólo en modelos de horno doble) Precision Cooking (Cocción de Precisión) consta de una serie de ciclos de cocción que fueron diseñados para comidas específicas. La pantalla lo guiará a través de la configuración del horno y de la comida de forma apropiada para el ciclo seleccionado. Los ciclos de cocción de precisión varían de acuerdo al tipo de comida; para acceder a información más detallada, consulte la sección de Modos de Cocción. Recipes (Recetas) (superior sólo en modelos de horno doble) Esta opción le permite acceder a recetas configuradas previamente para ciertas comidas. Las recetas nuevas pueden ser ingresadas y seguidas a través de la Aplicación GE Appliances Kitchen, una vez que su teléfono esté conectado. Para acceder a instrucciones sobre cómo conectar su teléfono, consulte la sección Wi-Fi Connect (Conexión Wi-Fi). Oven Light (Luz del Horno) Para encender o apagar las luces de la cavidad del horno presione . Ambas cavidades del horno serán iluminadas si usará un horno doble. Settings (Configuraciones) Presione para acceder a la función Settings (Configuraciones). Para más información, consulte la sección de Configuraciones. Favorite (Favoritos) Esta opción le permite al usuario guardar sus ciclos favoritos para un fácil acceso en el futuro. Luego de seleccionar un modo de cocción y de configurar una temperatura y un temporizador, presione para guardar dicha configuración como favorita para uso futuro. Luego de guardar un ciclo, presione en el menú principal para acceder rápidamente al modo guardado. Kitchen Timer (Temporizador de la Cocina) Esta función trabaja como un temporizador con cuenta regresiva. Presione , seleccione la cantidad de tiempo que desea que el temporizador funcione, y presione Start (Iniciar). El horno continuará funcionando cuando la cuenta regresiva del temporizador se haya completado. Para apagar el temporizador, seleccione y presione Clear (Borrar). Cook Time (Tiempo de Cocción) Esta función realiza una cuenta regresiva del tiempo de cocción y apaga el horno cuando el tiempo de cocción está completo. Presione durante un ciclo, seleccione la cantidad de tiempo de cocción, y presione Start (Iniciar). Delay Time (Tiempo de Retraso) Esta función retrasa el tiempo de inicio de un ciclo del horno. 8VHHVWDIXQFLyQSDUDFRQILJXUDUHOWLHPSRHQTXHGHVHDTXH el horno se inicie. Seleccione un ciclo, y luego presione . Seleccione la hora del día en que desea que el horno se encienda y presione Start (Iniciar). Si lo desea, también puede ser programado un tiempo de cocción. Wi-Fi & Remote Enable (Wi-Fi y Acceso Remoto) Presione GET CONNECTED (Conéctese) para conectar el horno al Wi-Fi. Esta opción le permite descargar contenido a su horno y controlar el mismo de forma remota. El horno deberá ser conectado al Wi-Fi antes de que Remote Enable (Acceso Remoto) sea activado. Para acceder a instrucciones sobre cómo conectar su horno, consulte la sección de Conexión a Wi-Fi/ Acceso Remoto, bajo Configuraciones en este manual. 6 49-2000375 Rev. 1 USO DEL HORNO: Horno Doble / Settings (Configuraciones) Horno Doble Al usar ambas cavidades para cocinar, el control le permitirá oscilar entre el horno superior e inferior, a fin de revisar la sección del ciclo de cada uno. Al revisar la pantalla del modo de cocción, usted puede acceder a la cavidad alterna presionando el titular de la pantalla. 12:30 PM TO UPPER OVEN 12:30 PM BAKE 350°F BAKE PREHEATED 350°F BAKE PREHEATED 400°F TO LOWER OVEN CANCEL BAKE 400°F Ciclo de Horneado del Horno Superior Settings (Configuraciones) CANCEL Ciclo de Horneado del Horno Inferior Existen numerosas configuraciones que son accedidas presionando la esquina superior derecha de la pantalla principal. 12:30 PM 12:30 PM SETTINGS SETTINGS Wi-Fi & REMOTE ENABLE SET CLOCK LOCK CONTROL SABBATH SOUND SABBATH SOUND DISPLAY COOKING SYSTEM Realice el deslizamiento hacia arriba y hacia abajo para acceder a todas las configuraciones Wi-Fi & Remote Enable (Wi-Fi y Acceso Remoto) Este electrodoméstico puede ser configurado para un IXQFLRQDPLHQWRUHPRWRHQFXDOTXLHUPRPHQWR1RJXDUGH ningún ítem inflamable o sensible a la temperatura en la parte interior. Al usar la función Wi-Fi Connect (Conexión Wi-Fi), usted podrá controlar funciones esenciales de su horno tales como las configuraciones de temperatura, temporizadores y modos de cocción, utilizando su teléfono inteligente o tableta*. Seleccione las y luego Wi-Fi & Remote Enable±VLJDODV instrucciones de la pantalla de su horno y de la aplicación de su teléfono. Es necesario activar la función Wi-Fi antes de usar Remote Enable (Acceso Remoto) en su horno. Conecte su horno con Conexión Habilitada de Wi-Fi 1. Tenga preparado su teléfono inteligente o tableta con la posibilidad de acceso a Internet y a la descarga de aplicaciones. 8VWHGGHEHUiFRQRFHUODFRQWUDVHxDGHOHQUXWDGRU:L)LGH su hogar. Tenga esta contraseña a mano al configurar el horno de GE Appliances. 3. En su teléfono inteligente o tableta, visite GEAppliances.com/connect para conocer más sobre las funciones del electrodoméstico conectado y para descargar la aplicación para conectarse a su horno. 4. Siga las instrucciones en pantalla de la aplicación para FRQHFWDUVXKRUQRGH*($SSOLDQFHV8QDYH]FRQHFWDGR su horno debe mostrar que se encuentra conectado a la red de Wi-Fi de su hogar. 5. Si se producen inconvenientes para conectarse de forma inalámbrica a su horno, por favor comuníquese al 800.220.6899 y solicite asistencia en relación a la conectividad inalámbrica de su horno. Para conectar dispositivos inteligentes adicionales, repita los pasos 3 y 4. Inicio Del Horno en Forma Remota Para poder iniciar el horno de forma remota una vez conectado a Wi-Fi, presione Remote Enable (Acceso Remoto) en el menú principal o acceda a Wi-Fi & Remote Enable (Wi-Fi y Acceso Remoto) desde el menú de configuraciones y active Remote Enable (Acceso Remoto). El horno puede ser iniciado ahora de forma remota con un dispositivo conectado. El ícono deberá estar activo para iniciar el horno de forma remota. Para desconectar su teléfono de Remote Enable (Acceso Remoto), acceda a las configuraciones de Wi-Fi & Remote Enable (Wi-Fi y Acceso Remoto) y desactive Remote Enable (Acceso Remoto). Luego de usar el horno, recuerde verificar que el ícono esté iluminado, si desea iniciar el horno de forma remota en el futuro. NOTA: Las comidas que se echan a perder rápidamente, tales como leche, huevos, pescado, rellenos, ave y cerdo, no se deberán dejar reposar por más de 1 hora antes y después de la cocción. La temperatura ambiente estimula el desarrollo de bacterias nocivas. Asegúrese de que la luz del horno esté apagada, ya que el calor de la lámpara acelerará el crecimiento de bacterias nocivas. * Se requiere el uso de dispositivos y de una red Wi-Fi hogareña que sean compatibles con Apple o Android. 49-2000375 Rev. 1 7 USO DEL HORNO: Settings (Configuraciones) Settings (Configuraciones) (Cont.) Existen numerosas configuraciones que son accedidas presionando en la esquina superior derecha de la pantalla principal. 12:30 PM SETTINGS Wi-Fi & REMOTE ENABLE SET CLOCK LOCK CONTROL SABBATH SOUND 12:30 PM SETTINGS SABBATH SOUND DISPLAY COOKING SYSTEM Realice el deslizamiento hacia arriba y hacia abajo para acceder a todas las configuraciones Set Clock (Configuración del Reloj) Esta función le permite configurar el reloj y especifica cómo la hora del día será exhibida. Las opciones para mostrar la hora son el horario de un reloj estándar de 12 horas con selecciones AM y PM o de estilo militar de 24 horas. Lock Control (Control de Bloqueo) Seleccione esta opción a fin de bloquear el LCD desde cualquier selección de pantalla no deseada. Para desbloquear la pantalla, presione y presione Unlock (Desbloquear) en la siguiente pantalla. Sabbath (Modo Sabático) El modo sabático desactiva las luces del horno (la luz del horno no se encenderá cuando la puerta sea abierta), todos los sonidos (el control no emitirá un pitido cuando se presione la pantalla), los modos de Convection (Convección), los modos de Broil (Asar), Warm (Calentar), Proof (Leudar), y todas las funciones de tiempo. El modo sabático sólo puede ser usado con la función tradicional de Bake (Hornear). Esta función se activa conforme con los requisitos Sabáticos Judíos de la Estrella K. Para más información, por favor consulte la sección Sabbath Mode (Modo Sabático). Sound (Sonido) Esta pantalla de configuración le permite cambiar el volumen, el tono de fin de ciclo, y encender o apagar el sonido táctil. Display (Pantalla) Esta pantalla muestra las opciones de brillo, reloj apagado, ahorro de energía, y tiempo de inactividad de la pantalla. La función de reloj apagado eliminará el reloj de la pantalla cuando la misma se encuentre inactiva, pero será mostrado luego de presionar sobre la pantalla. La pantalla puede ser configurada para que nunca quede inactiva o puede ser configurada para que se apague luego de 1, 5 o 10 minutos. Cooking (Cocción) El horno está configurado en grados Fahrenheit; sin embargo, en esta configuración la unidad de cocción puede ser cambiada a Celsius. La función Auto Recipe Conversion (Conversión de Receta Automática) puede ser activada a fin de reducir automáticamente la temperatura de cocción programada para Convection Bake (Hornear por Convección) o Convection Bake Multi (Hornear por Convección Múltiple). Observe que esto no reducirá la temperatura de cocción, ni el tiempo de horneado. Cuando la opción de 12 Hour Shut Off (Apagado Luego de 12 Horas) sea activada, la misma se apagará de forma automática luego de 12 horas de uso continuo. La función Adjust Temperature (Temperatura Ajustada) permite que la temperatura del horno sea ajustada hasta )PiVFDOLHQWHR)PiVIUtD8VHHVWDIXQFLyQVL considera que la temperatura de su horno está demasiado caliente o fría y desea modificarla. Para los modelos con horno doble, las temperaturas de los hornos superior e LQIHULRUVHDMXVWDQGHIRUPDVHSDUDGD1RXVHWHUPyPHWURV tales como los que se encuentran en tiendas, para controlar la configuración de temperatura del horno. Estos termómetros pueden variar entre 20 y 40 grados. System (Sistema) Esta pantalla le permite borrar sus datos de usuario guardados y mostrar la versión actual de su software. 8 49-2000375 Rev. 1 USO DEL HORNO: Modo Sabático Modo Sabático El modo sabático desactiva las luces del horno (la luz del horno no se encenderá cuando la puerta sea abierta), todos los sonidos (el control no emitirá un pitido cuando se presione la pantalla), los modos los modos de Convection (Convección), los modos de Broil (Asar), Warm (Calentar), Proof (Leudar), y todas las funciones de tiempo. El modo sabático sólo puede ser usado con la función tradicional de Bake (Hornear). Esta función se activa conforme con los requisitos Sabáticos Judíos de la Estrella K. NOTA: Si se produce un corte de corriente durante el momento en que el horno se encuentra en Sabbath Mode (Modo Sabático), la unidad regresará a dicho modo cuando la energía sea restablecida. Ingreso al Modo Sabático Presione en la pantalla principal para acceder al menú Settings (Configuraciones) y haga el desplazamiento hacia abajo hasta Sabbath (Sabático). Inicie un Horneado Sabático 8VHODWHFODGHODSDQWDOODSDUDLQJUHVDUODWHPSHUDWXUDTXH GHVHDXVDUSDUD6DEEDWK%DNH+RUQHDGR6DEiWLFR8QD vez configurada la temperatura, presione para configurar el tiempo de cocción del ciclo en horas y minutos. Si usará un horno doble, entonces puede seleccionar la temperatura y el tiempo deseados para la otra cavidad seleccionando los mismos sobre la izquierda de la pantalla de temperatura. Si no se configura un temporizador, el horno comenzará un ciclo de horneado durante el modo Sabbath (Sabático) \FRQWLQXDUiKDVWDTXHGLFKRPRGRVHDDSDJDGR8VWHG puede también seleccionar si la luz del horno se encenderá o apagará presionando VREUHODSDQWDOOD8QDYH]TXH haya programado la temperatura y el tiempo, presione Start (Iniciar). La siguiente pantalla exhibirá las configuraciones que programó para Sabbath Bake (Horneado Sabático). Ajuste de Temperatura Durante un Horneado Sabático Si es necesario ajustar la temperatura luego de programar el horno para Sabbath Bake (Horneado Sabático), presione uno de los íconos de temperatura exhibidos en la pantalla del ciclo Sabbath (Sabático) y presione Enter (Ingresar). Esto le permitirá ajustar la temperatura para el ciclo. Observe que la pantalla no mostrará que la temperatura del horno cambió. Salida del Modo Sabático Para salir del modo Sabbath (Sabático), presione la X en la esquina superior derecha si se encuentra en la pantalla de programación, o presione Exit Sabbath (Salir del Modo Sabático) si se encuentra en la pantalla del ciclo. Existe también la opción de apagar el ciclo cuando se encuentre en la pantalla del ciclo presionando Turn Off (Apagar), pero el horno aún permanecerá en el modo Sabbath (Sabático) hasta que salga del modo. NOTA: Si se produce un corte de energía mientras el horno se encuentra en Sabbath Mode (Modo Sabático), la unidad regresará a dicho modo cuando la energía sea restablecida; sin embargo, el horno regresará al estado de apagado incluso aunque se encuentre en el medio del ciclo de horneado cuando el corte de energía se haya producido. 12:30 PM SABBATH i BAKE TEMP 1 --- °F 4 7 2 3 5 6 8 9 0 START UPPER OVEN LOWER OVEN 12:30 PM SABBATH i BAKE TEMP 1 --- °F 4 7 2 3 5 6 8 9 0 START Programación de pantallas SABBATH 12:30 PM EXIT SABBATH ENTER 200°F 250°F Oven On 300°F 350°F TURN OFF 400°F Select temperature, then press ENTER to edit. SABBATH ENTER 200°F 12:30 PM EXIT SABBATH Upper Oven On 5:30 250°F 300°F 350°F TURN OFF 400°F ENTER 200°F Lower Oven On 5:30 250°F 300°F 350°F TURN OFF 400°F Select temperature, then press ENTER to edit. Pantallas del Ciclo Sabático en Hornos Simples y Dobles 49-2000375 Rev. 1 9 USO DEL HORNO: Estantes del Horno Estantes del Horno El horno cuenta con seis posiciones de estantes. En la Guía de Cocción, se brindan recomendaciones de posiciones de los estantes para diferentes tipos de comidas. Se ajusta un estante en una dirección para afectar los resultados de cocción. Por ejemplo, si se prefieren partes superiores más oscuras en tartas, panecillos o galletas, pruebe moviendo la comida a un estante que se encuentre una posición más arriba. Si encuentra que las comidas están demasiado doradas en la parte superior, pruebe moviendo las mismas más abajo la próxima vez. Al hornear con múltiples ollas y en múltiples estantes, asegúrese de que haya suficiente espacio entre las ollas para que fluya el aire. Es posible que su horno cuente con estantes extensibles y/o estantes planos tradicionales. Para evitar posibles quemaduras, coloque los estantes en la posición deseada antes de encender el horno. Estantes Planos Al colocar y retirar utensilios de cocina, empuje el estante hacia afuera del tope (posición de detención) sobre el soporte del estante. Para retirar el estante, empuje el mismo hacia usted, incline el extremo frontal hacia arriba y empuje hacia afuera. Para hacer un reemplazo, coloque el extremo curvo del estante (bloqueadores) en los soportes del horno, incline hacia arriba el frente y empuje el estante hacia adentro. Es posible que resulte difícil deslizar los estantes, especialmente luego de la limpieza automática. Coloque aceite vegetal en una tela húmeda o toalla de papel y frote sobre los extremos izquierdo y derecho. NOTA: El uso de otros aceites de cocina provocará una descoloración o un residuo de color similar al óxido en los estantes y laterales de las cavidades. Para limpiar este residuo, use agua y jabón o una solución de vinagre y agua. Enjuague con agua limpia y seque con una tela seca. 10 49-2000375 Rev. 1 USO DEL HORNO: Estantes del Horno Estantes del Horno (Cont.) Estantes Extensibles Siempre empuje hacia afuera el estante desde el riel frontal superior hasta la posición de detención en su máxima extensión, al colocar o retirar utensilios. Los estantes extensibles no podrán ser usados en la posición del estante superior. Si resulta difícil extender estos estantes, lubrique los mismos con lubricante de grafito, provisto con el horno. Retire el estante del horno, retire cualquier obstrucción en el recorrido deslizable con una toalla de papel, agite el lubricante de grafito y coloque 4 gotitas en los dos recorridos inferiores de los lados izquierdo y derecho. Abra y cierre el estante varias veces para distribuir el lubricante. Para ordenar un lubricante de grafito adicional, lea la sección de Accesorios de este manual. Para Retirar un Estante Extensible: 1. Asegúrese de introducir la parrilla hasta el fondo del horno, de modo que las paletas laterales del armazón de la parrilla se desenganchen de la cavidad. 2. Deslice la parrilla hacia usted hasta que llegue al tope (posición detenida) del soporte de la parrilla. 3. Tome de manera firme ambos lados de la estructura del estante y deslizando este último, incline el extremo del frente hacia arriba y empuje hacia fuera. Para Reemplazar un Estante Extensible: 1. Tome firmemente ambos lados del armazón de la parrilla y la parrilla deslizable. 2. Coloque el extremo curvo del estante en la posición deseada, incline el frente hacia arriba y presione la parrilla hacia adentro. Si resulta difícil reemplazar o retirar los estantes extensibles, limpie los soportes de los estantes del horno con aceite YHJHWDO1RTXLWHHODFHLWHGHFRFLQDGHOHVSDFLRGH deslizamiento. NOTA: El uso de otros aceites de cocina provocará una descoloración o un residuo de color similar al óxido en los estantes y laterales de las cavidades. Para limpiar este residuo, use agua y jabón o una solución de vinagre y agua. Enjuague con agua limpia y seque con una tela seca. Para lubricar la paleta: Agite el lubricante y aplique el mismo a las partes móviles de los mecanismos de las paletas como se muestra. Riel frontal superior Posición de apertura total Tomar aquí 49-2000375 Rev. 1 11 USO DEL HORNO: 3DSHO GH $OXPLQLR \ &REHUWRUHV GHO +RUQR 8WHQVLOLRV Papel de Aluminio y Cobertores del Horno PRECAUCIÓN No use ningún tipo de aluminio o cobertor de horno para cubrir el fondo del horno. Estos ítems pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. Los daños por uso inadecuado de estos ítems no están cubiertos por la garantía del producto. Se podrá usar aluminio para evitar derrames, colocando una hoja sobre un estante inferior varias pulgadas debajo de la comida. 1RXVHPiVDOXPLQLRTXHHOQHFHVDULR\QXQFDFXEUDWRWDOPHQWHHOHVWDQWHGHXQKRUQRFRQSDSHOGHDOXPLQLR0DQWHQJDHO aluminio a por lo menos 1 1/2" de las paredes del horno, para evitar una circulación deficiente del calor. Utensilios Pautas de Uso de Utensilios El material, el acabado y el tamaño de los utensilios afectan el horneado. Las ollas oscuras, revestidas y opacas absorben el calor más rápidamente que las ollas claras y brillantes. Al usar ollas que absorben el calor más rápidamente, las comidas podrán resultar más doradas, crocantes y con una capa más gruesa. Si utiliza utensilios oscuros y revestidos, controle la comida antes del tiempo mínimo de cocción. Si se obtienen resultados no deseados con este tipo de utensilios, considere la posibilidad de reducir la temperatura del horno en 25º F la próxima vez. Las ollas brillantes pueden producir resultados de horneado más parejos en tortas y galletas. Las ollas de vidrio y cerámica calientan con lentitud, pero retienen bien el calor. Estos tipos de ollas funcionan bien con platos tales como tartas y postres con natilla. Las ollas con aislante de aire calientan lentamente y pueden producir fondos dorados. Mantenga los utensilios limpios para una cocción más pareja. Utensilio para Fritura con Aire Cualquier utensilio usado en el modo Air Fry (Fritura con Aire) deberá ser de uso seguro para asar. Se recomienda el uso de una olla con superficie oscura y horneado sólidos con laterales con bordes, tales como una olla plana para el uso con la función Air Fry (Fritura con Aire). La superficie de la olla oscura permite que los alimentos queden mejor dorados y crujientes. Se podrán usar también canastas de horneado y rejillas de horneado, pero se deberá colocar una olla plana sobre el estante debajo de las comidas, a fin de atrapar cualquier goteo posible al usar la canasta para hornear. 8WHQVLOLRSULQFLSDOUHFRPHQGDGR Opciones de utensilios alternativos 12 49-2000375 Rev. 1 USO DEL HORNO: Modos de Cocción Modos de Cocción Su nuevo horno posee una variedad de modos de cocción para que pueda obtener los mejores resultados. Estos modos se describen a continuación. Para acceder a recomendaciones para comidas específicas, consulte la sección de la Guía de Cocción. Recuerde que es posible que su nuevo horno funcione de manera diferente que aquel que está reemplazando. Configuración de Temperatura Al seleccionar una temperatura, las temperaturas tradicionales configuradas previamente son exhibidas y pueden ser seleccionadas al deslizarse horizontalmente y seleccionando la temperatura deseada. Si desea cocinar en una temperatura alterna, presione la temperatura en el medio de la pantalla y una tecla numérica aparecerá de modo que la temperatura deseada pueda ser ingresada. Horneado El modo de horneado tradicional está pensado para la cocción en un solo estante. Este modo usa el calor principalmente desde el elemento inferior, pero también desde el elemento superior para cocinar la comida. Para usar este modo, presione la opción Bake (Hornear) en el menú principal y realice el deslizamiento hasta la temperatura deseada y presione Start (Iniciar). El precalentamiento generalmente se recomienda al usar este modo. Modo para Asar Siempre ase con la puerta cerrada. El elemento para asar en el horno es muy potente. Monitoree la comida de cerca al asar. Tenga cuidado al asar en posiciones de estantes superiores, ya que colocar la comida más cerca del elemento para asar incrementa el humo, salpicaduras y la posibilidad de que se incendien las grasas. No se recomienda asar en el estante de la posición 6. La función para asar puede ser usada en comidas que típicamente serían a la parrilla. Ajuste la posición del estante para variar la intensidad del calor que llega a la comida. Coloque la comida más cerca del elemento para asar, cuando se desee una superficie más soasada y un interior poco cocido. Para un mejor rendimiento, centre la comida debajo del elemento que emite calor para asar. Asar Seleccione Broil (Asar) en el menú principal, luego seleccione High (Alto) o Low (Bajo) dependiendo de su preferencia en relación a la cantidad de soasado y de la temperatura interna. La configuración High (Alta) es mejor para cortes más delgados de carne y/o comidas que prefiera que queden menos cocidas en su interior. La configuración Low (Baja) es preferida para cortes más gruesos de carne y comidas que GHVHHTXHVHDQFRFLQDGDVFRPSOHWDPHQWH1RHVQHFHVDULR calentar el horno previamente en estos modos. Modos de Convección Estos modos utilizan calor de los elementos tradicionales superior e inferior, combinados con el elemento de convección y un flujo de aire consistente para mejorar la uniformidad. Su horno está equipado con la función Auto Recipe Conversion (Conversión de Receta Automática), de modo que ajusta de forma automática la cantidad de calor a fin de mantener la temperatura adecuada usando los modos con las temperaturas especificadas. Se recomienda el precalentamiento al usar estos modos. Horneado por Convección Este modo está pensado para el horneado en un solo estante cuando se desee un flujo de aire adicional para mejorar la uniformidad. Seleccione Convect (Convección), luego Bake (Hornear), realice el deslizamiento hasta la temperatura deseada, y luego presione Start (Iniciar). El precalentamiento generalmente se recomienda al usar este modo. Horneado por Convección en Estantes Múltiples Este modo fue diseñado para permitir una cocción más pareja al utilizar estantes múltiples. Es posible que el tiempo de horneado sea un poco más prolongado en comparación con lo que se espera con un solo estante. Para usar este modo, seleccione Convect (Convección), luego Bake Multi-Rack (Hornear en Estantes Múltiples), realice el deslizamiento hasta la temperatura deseada, y presione Start (Iniciar). Generalmente se recomienda realizar el calentamiento previo al usar este modo. Dorado por Convección Este modo está pensado para dorar cortes enteros de carne en un solo estante. La utilización de los tres elementos y el flujo de aire directo desde la parte superior del horno mejoran el nivel de dorado y reducen el tiempo de cocción. Controle la comida ante de lo sugerido por la receta o use una sonda al usar este modo. Para usar este modo, seleccione Convect (Convección), luego presione Roast (Dorar), realice el deslizamiento hasta la temperatura deseada, y presione Start (Iniciar). Asar por Convección (superior sólo en modelos de horno doble) Convection Broil (Asar por Convección) posee dos opciones: Low (Bajo) y High (Alto). Low (Bajo) y High (Alto) son similares a los modos de asado tradicional con la adición del flujo de aire directo para ayudar en el soasado y dorado. Para obtener mejores resultados con las configuraciones Low (Bajo) y High (Alto), se recomienda calentar previamente el horno durante 5 minutos. Para usar estos modos, seleccione Convect (Convección), luego Broil (Asar), y luego el modo deseado. 49-2000375 Rev. 1 13 USO DEL HORNO: Modos de Cocción Modos de Cocción (Cont.) Fritura con Aire (superior sólo en modelos de horno doble) Éste es un modo de convección especial que fue diseñado para producir comidas con un exterior más crujiente que en la cocción con hornos tradicionales. El modo Air Fry (Fritura con Aire) utiliza aire caliente y de movimiento rápido dirigido sobre la comida y su finalidad es únicamente hornear en un estante simple. Seleccione More (Más), luego Air Fry (Fritura con Aire), y luego ingrese la temperatura configurada deseada y presione Start (Iniciar). La temperatura podrá ser FRQILJXUDGDHQWUH)\)1RHVQHFHVDULRUHDOL]DUHO precalentamiento en este modo. Siga las pautas de la receta o el paquete en relación a las temperaturas configuradas y tiempos de cocción; ajuste el tiempo de cocción para lograr la textura crujiente deseada. Podrá acceder a pautas adicionales para el uso de este modo en la Guía de Cocción. Leudar El modo Proof (Leudar) está diseñado para elevar (fermentar y leudar) masas de pan. Presione la opción More (Más) en el menú principal, luego Proof (Leudar), y luego Start (Iniciar). Cubra bien la masa para evitar que se seque. El pan se elevará más rápidamente que a temperatura ambiente. NOTA:1RXVHHOPRGR3URRI/HXGDUSDUDFDOHQWDUFRPLGD o mantener la comida caliente. La temperatura del horno al leudar no está lo suficientemente caliente como para mantener las comidas a temperaturas seguras. Calentar El modo Warm (Calentar) está diseñado para mantener comidas calientes hasta durante 3 horas. Para usar este modo, seleccione More (Más) en el menú principal, luego Warm (Calentar), y luego presione Start (Iniciar)1RVHUHTXLHUH SUHFDOHQWDUODVPLVPDV1RXVHODIXQFLyQ:DUP&DOHQWDU para calentar comida fría, excepto galletas crujientes, papas fritas o cereales secos. También se recomienda que la comida no se mantenga caliente por más de dos horas. Cocción de Precisión (superior sólo en modelos de horno doble) Estos modos brindan orientación y algoritmos de cocción configurados previamente para ayudar al usuario en la cocción de diferentes tipos de comidas. La selección que usted realizó en el menú Precision Cooking (Cocción de Precisión) lo guiará para ingresar la información requerida como ayuda para cocinar su comida. Algunos ciclos usan una temperatura del horno preseleccionada; en estos casos, la temperatura no se muestra. Algunos ciclos configuran de forma automática un temporizador en base a sus selecciones. Al final del tiempo de cocción estimado, controle que la comida esté hecha de acuerdo a su gusto. Si no lo está, agregue tiempo seleccionando +1min o sólo continúe cocinando. Observe que las diferencias en la forma de la comida, la preparación y las preferencias de terminación pueden afectar en el tiempo requerido para cocinar la comida. Algunos ciclos fueron diseñados para cocinar la comida sin precalentar el horno primero. Para estos ciclos, la pantalla mostrará "inserte la FRPLGD\SUHVLRQHVLJXLHQWHSDUDLQLFLDUHOKRUQR´1RHVSHUHD que el horno sea precalentado usando estos ciclos. Algunos ciclos requieren que la sonda de temperatura de la comida sea suministrada con el horno. El objetivo de temperatura para la sonda es configurado de forma automática en base a las selecciones realizadas. Siempre controle las comidas usando un termómetro de comidas secundario, ya que el posicionamiento de la sonda puede impactar en la temperatura medida. Para más detalles sobre el uso y posicionamiento correctos de la sonda, consulte la sección de la Sonda. En algunas páginas, aparecerá i . Presione i para acceder a información adicional perteneciente a los ciclos de cocción dentro de dicha categoría. Ciclos adicionales estarán disponibles a través de actualizaciones del software. Conecte su horno para tener acceso a estas actualizaciones. Para acceder a instrucciones sobre cómo conectar su horno, consulte la sección Wi-Fi Connect (Conexión Wi-Fi). 14 49-2000375 Rev. 1 USO DEL HORNO: Probe (Sonda) Probe (Sonda) ADVERTENCIA El consumo de comida semicruda puede hacer que se contraigan enfermedades producidas por la comida. Use la sonda de acuerdo con las siguientes instrucciones, a fin de asegurar que todas las partes de la comida alcancen temperaturas de cocción mínimamente seguras. Puede encontrar recomendaciones de temperaturas de cocción mínimamente seguras en foodsafety.gov o en IsItDoneYet.gov. La temperatura interna de la comida con frecuencia se usa como indicador de que está lista, especialmente al dorar o preparar carne de ave. El modo Probe (Sonda) monitorea la temperatura interna de la comida y apaga el horno cuando esta última alcanza la temperatura programada. Controle siempre la temperatura en múltiples partes de la comida, utilizando un termómetro de comidas luego de realizar la cocción, a fin de asegurar que todas las partes de la misma hayan alcanzado una temperatura interna mínimamente segura en dicha comida. Ubicación Correcta de la Sonda Luego de preparar la comida y de colocarla en la olla, siga estas instrucciones para una ubicación correcta de la sonda. ,QVHUWHODVRQGDHQODFRPLGDGHPRGRTXHODSXQWDGH la sonda se apoye en el centro de la parte más gruesa de la comida. Para un mejor rendimiento, la sonda debería ser completamente insertada en la comida. Si la sonda no es ubicada correctamente, es posible que no mida con precisión la temperatura de la parte más fría de la comida. Algunas comidas, particularmente las más pequeñas, no son adecuadas para la cocción con el uso de una sonda, debido a sus formas o tamaños. 1RGHEHUtDWRFDUHOKXHVRODJUDVDQLHOFDUWtODJR 3DUDFRFLQDUXQDYHHQWHUDLQVHUWHODVRQGDHQODSDUWH más gruesa de la pechuga. 3DUDGRUDUVLQKXHVRVLQVHUWHODVRQGDHQHOFHQWURGHO dorado. 3DUDFRFLQDUMDPyQRFRUGHURFRQKXHVRVLQVHUWHODVRQGD en el centro de la articulación o del músculo más bajo y largo. 3DUDSUHSDUDUFD]XHODVRSODWRVWDOHVFRPRSDVWHOGH carne, inserte la sonda en el centro del plato. 3DUDFRFLQDUSHVFDGRLQVHUWHODVRQGDMXVWRDUULEDGHOD agalla en la zona más carnosa paralela a columna. Uso de la Sonda Para usar la sonda sin precalentamiento: ,QVHUWHODVRQGDHQODFRPLGDFRQVXOWHVREUHOD8ELFDFLyQ Correcta de la Sonda). 2. Coloque la comida en el horno y conecte la sonda en su correspondiente tomacorriente en el horno. 3. Programe la sonda deseada y las configuraciones del modo de cocción seleccionando More (Más), luego Probe (Sonda), y eligiendo luego el modo de cocción deseado. More (Más), luego Probe (Sonda), luego eligiendo la temperatura de cocción deseada y seleccione Next (Siguiente). Finalmente seleccione la temperatura interna deseada para la comida y presione Start (Iniciar). Para usar la sonda con precalentamiento: 1. Presione la tecla del modo de cocción deseado (Horneado Tradicional, Horneado por Convección, o Dorado por Convección) e ingrese la temperatura de cocción deseada. 2. Inserte la sonda en la comidaFRQVXOWHVREUHOD8ELFDFLyQ Correcta de la Sonda). 8QDYH]TXHHOKRUQRIXHSUHFDOHQWDGRFRORTXHODFRPLGD en el mismo y conecte la sonda en su correspondiente tomacorriente, asegurándose de que esté completamente insertada. Tenga cuidado, ya que las paredes del horno y el tomacorriente de la sonda están calientes. 4. Programe la temperatura de la sonda seleccionando More (Más), luego Probe (Sonda), e ingresando luego la temperatura interna deseada para la comida. La temperatura interna máxima de la comida que se puede configurar es 200° F. Pautas para el Cuidado de la Sonda (OXVRGHXQDVRQGDTXHQRVHDDTXHOODSURYLVWDFRQHVWH producto podrá ocasionar daños sobre la ficha de entrada de la sonda. 8VHODVPDQLMDVGHODVRQGDDOHQFKXIDU\GHVHQFKXIDUOD misma, luego de insertar o de retirar la sonda de la carne o del tomacorriente. 3DUDHYLWDUGDxRVVREUHODVRQGDQRXVHDJDUUDGHUDVSDUD empujar el cable al retirarlo. 3DUDHYLWDUURPSHUODVRQGDDVHJ~UHVHGHTXHOD comida haya sido completamente descongelada antes de insertarla. 3DUDHYLWDUSRVLEOHVTXHPDGXUDVQRGHVHQFKXIHODVRQGD del tomacorriente del horno hasta que este último se haya enfriado. 1XQFDGHMHODVRQGDGHQWURGHOKRUQRGXUDQWHXQFLFORGH limpieza automática o de limpieza con vapor. 1RJXDUGHODVRQGDGHQWURGHOKRUQR 49-2000375 Rev. 1 15 USO DEL HORNO: Guía de Cocción Guía de Cocción La siguiente tabla brinda algunas pautas para los modos de cocción típicos. Si desea usar los modos de Precision Cooking (Cocción de Precisión), los mismos pueden ser sustituidos por los modos mostrados a continuación para comidas pertinentes. TIPO DE COMIDA Productos Horneados Tortas con capas, tortas rectangulares, roscas, panecillos, pan rápido en un Solo Estante Tortas con capas* en Múltiples Estantes Tortas de grasa (pastel de ángel) Galletas, galletitas, bizcochitos en un Solo Estante Galletas, galletitas, bizcochitos en Múltiples Estantes Bife y Cerdo MODO(S) RECOMENDADO(S) Horneado por Convección Horneado Tradicional Horneado por Convección Múltiple Horneado por Convección Horneado Tradicional Horneado por Convección Horneado Tradicional Horneado por Convección Múltiple Hamburguesas Asar Alto Bifes y Chuletas Asar Alto Dorados Horneado Tradicional Dorado por Convección Ave Pollo entero Horneado Tradicional Dorado por Convección Pechugas, patas, muslos con huesos Asado Bajo Horneado Tradicional Dorado por Convección Pechugas de pollo deshuesadas Asado Bajo Horneado Tradicional Dorado por Convección Pavo entero Horneado Tradicional Dorado por Convección Pechuga de Pavo Horneado Tradicional Dorado por Convección Pescado Asado por Convección Bajo Asado Bajo Cazuelas Horneado por Convección Horneado Tradicional Comidas Congeladas a Conveniencia Pizza en un estante simple Horneado por Convección Horneado Tradicional Pizza en estantes múltiples Horneado por Convección Múltiple Productos con papa, patitas de pollo fritas, aperitivos en un Solo Estante Horneado por Convección Horneado Tradicional Fritura con Aire (en hornos simples y superiores únicamente) Productos con papa, patitas de pollo fritas, aperitivos en Múltiples Estantes Horneado por Convección Múltiple POSICIÓN(ES) DE ESTANTES RECOMENDADA 3 1 ext. y 4 planos 1 3 1 ext. y 4 planos 5 ext. 5 ext. 1 o 2 2 2 o 3 2 o 3 1 o 2 1 o 2 5 (mitad del grosor o menos) 4 (>1/2 pulgada) 3 3 1 ext. y 4 planos 3 1 ext. y 4 planos SUGERENCIAS ADICIONALES 8VHXWHQVLOLRVEULOODQWHV Asegúrese de que haya un flujo de aire adecuado (Vea la ilustración). 8VHXWHQVLOLRVEULOODQWHV 8VHXWHQVLOLRVEULOODQWHV Asegúrese de que haya un flujo de aire adecuado. 8VHXQDROODSDUDDVDUPXHYDODFRPLGDKDFLDDEDMRSDUDTXHTXHGH más preparada y menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. 8VHXQDROODSDUDDVDUPXHYDODFRPLGDKDFLDDEDMRSDUDTXHTXHGH más preparada y menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Deje sin cubrir, use una olla chata tal como una olla para asar. 1RVHUHTXLHUHSUHFDOHQWDUOD 8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU 1RVHUHTXLHUHSUHFDOHQWDUOD Ase del lado de la piel hacia abajo primero. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Mueva la comida más abajo para que quede más preparada y menos soasada y más arriba para soasar/ dorar al asar. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. 8VDXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU 1RVHUHTXLHUHSUHFDOHQWDUOD 8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU 1RVHUHTXLHUHSUHFDOHQWDUOD Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. 8VHXWHQVLOLRVEULOODQWHV 8VHXWHQVLOLRVEULOODQWHV 8VHXWHQVLOLRVEULOODQWHVDOXVDUHOKRUQHDGRWUDGLFLRQDO\HOKRUQHDGR por convección. 8VHXQXWHQVLOLRRVFXURRXQDEDQGHMDGHJDOOHWDVDOXVDU Air Fry (Fritura con Aire). 8VHXWHQVLOLRVEULOODQWHV&DPELHODXELFDFLyQGHODFRPLGDSDUFLDOPHQWH durante la cocción, a fin de obtener resultados de cocción más parejos. *Al hornear cuatro capas de torta por vez, use los estantes en 2 y 4 para un horno inferior; use 1 estante extensible y 4 planos para un horno superior o simple. Coloque las ollas como se muestra, de modo que no quede una olla encima de la otra. Cocine la comida completamente para evitar que se produzcan enfermedades a partir de la comida. Puede encontrar recomendaciones sobre temperatura mínima para cocinar de forma segura en IsItDoneYet.gov. Asegúrese de usar un termómetro de comidas para medir la temperatura de las mismas. Horno simple/ superior Horno inferior 16 49-2000375 Rev. 1 CUIDADO Y LIMPIEZA: Limpieza de la Cocina - Exterior Cuidado y limpieza - Exterior Asegúrese de que todos los controles estén apagados y que las superficies estén frías antes de limpiar cualquier parte de la cocina. Panel de Control Para bloquear los controles, presione en la esquina inferior izquierda y siga las instrucciones en pantalla. Las instrucciones para realizar el desbloqueo se encuentran visibles cuando la SDQWDOODHVWiEORTXHDGD8QDEXHQDLGHDHVOLPSLDUHOSDQHOGH control luego de cada uso. Limpie con un jabón suave y agua o vinagre y agua, enjuague con agua limpia y pula en seco FRQXQDWHODVXDYH1RXVHOLPSLDGRUHVDEUDVLYRVOLPSLDGRUHV líquidos fuertes, almohadillas para fregar de plástico ni limpiadores de horno en el panel de control; dañarán el acabado. Exterior del Horno 1RXVHOLPSLDGRUHVGHKRUQROLPSLDGRUHVDEUDVLYRV limpiadores líquidos fuertes, estropajos de acero, almohadillas para fregar de plástico, ni polvos limpiadores en el interior o el exterior del horno. Limpie el mismo con agua y jabón o una solución de vinagre y agua. Enjuague con agua limpia y seque con una tela seca. Al limpiar supeficies, asegúrese de que estén a temperatura ambiente y fuera del contacto con la luz solar. Si las manchas en el borde de la ventana de la puerta son persistentes, use un limpiador abrasivo suave o una esponja con estropajo para obtener un mejor resultado. El derrame de adobo, jugos de fruta, salsas de tomate y líquidos para humedecer que contengan ácidos pueden ocasionar descoloración y se deberán limpiar de inmediato. Deje que las superficies calientes se enfríen, y luego limpie y enjuague. Superficies pintadas y Acero Inoxidable Negro (en algunos modelos) Las superficies pintadas podrán incluir la puerta y el borde alrededor del panel de control. Límpielas con jabón y agua o con una solución de agua y vinagre. 1RXWLOLFHOLPSLDGRUHVGHKRUQRFRPHUFLDOHVSROYRVOLPSLDGRUHV esponjillas de acero o abrasivos potentes sobre cualquier superficie pintada, LQFOX\HQGRHO$FHUR,QR[LGDEOH1HJUR Acero Inoxidable Excluyendo el Acero Inoxidable Negro (en algunos modelos) 1RXVHYLUXWDVGHDFHURpVWDVGDxDUiQODVXSHUILFLH Para limpiar la superficie de acero inoxidable, use agua tibia con jabón o un limpiador o pulidor para acero inoxidable. Siempre limpie la superficie en la dirección del veteado. Siga las instrucciones del limpiador para limpiar la superficie de acero inoxidable. Los limpiadores con ácido oxálico tales como Bar Keepers Friend Soft CleanserTM eliminarán el óxido, deslustres y SHTXHxDVPDQFKDVVREUHODVXSHUILFLH8VHVyORXQOLPSLDGRU líquido libre de material abrasivo y frote en la dirección de las líneas del cepillo con una esponja suave y húmeda. Para realizar consultas sobre la adquisición de productos, incluyendo limpiadores o pulidores para electrodomésticos de acero inoxidable, consulte las secciones de Accesorios y Soporte al Consumidor al final de este manual. 49-2000375 Rev. 1 17 CUIDADO Y LIMPIEZA: Limpieza de la Cocina - Interior / Probe Cuidado y limpieza - Interior El interior de su nuevo horno puede ser limpiado de forma manual o utilizando los modos Steam Clean (Limpieza con Vapor) o Self Clean (Limpieza Automática). El derrame de adobo, jugos de fruta, salsas de tomate y líquidos para humedecer que contengan ácidos pueden ocasionar descoloración y se deberán limpiar de inmediato. Espere a que las superficies calientes se enfríen, y luego limpie y enjuague. Limpieza Manual 1RXVHOLPSLDGRUHVGHKRUQROLPSLDGRUHVOtTXLGRVIXHUWHV estropajos de acero, ni almohadillas para fregar en el interior del horno. Limpie con agua y jabón suave o con una solución de vinagre y agua. Enjuague con agua limpia y seque con una tela seca. Al limpiar las superficies, asegúrese de que se encuentren a temperatura ambiente. Modo de Limpieza con Vapor La finalidad de la función Steam Clean (Limpieza con Vapor) es usar agua para limpiar la suciedad leve de su horno en una temperatura inferior a la de Self Clean (Limpieza Automática). Para usar la función Steam Clean (Limpieza con Vapor), limpie las grasas y suciedades del horno. Vierta una taza de agua en la parte inferior del horno. Cierre la puerta. Presione la opción More (Más), luego seleccione Steam Clean (Limpieza con Vapor), y luego presione Start (Iniciar) sobre la parte GHUHFKDGHODSDQWDOOD/DSXHUWDGHOKRUQRVHEORTXHDUi1R podrá abrir la puerta durante los 30 minutos de la limpieza con vapor, ya que esto reducirá su rendimiento. Al finalizar el ciclo de limpieza con vapor, la puerta se desbloqueará. Limpie cualquier exceso de agua y cualquier suciedad que haya quedado. NOTA: El agua en la parte inferior del horno podrá estar caliente justo después de finalizado el ciclo. Modo de Limpieza Automática Lea las Instrucciones de Seguridad del Horno con Limpieza Automática, en el comienzo de este manual, antes de usar el modo Self Clean (Limpieza Automática). Este modo usa temperaturas muy altas para limpiar el interior del horno. Cuando use esta función, la puerta del horno se trabará. Antes de utilizar el ciclo de limpieza automática, limpie la grasa y restos de comida que haya en el horno. Retire todos los artículos del horno, excepto los estantes esmaltados (color oscuro). Los estantes brillantes o de plata, la sonda para carne, y cualquier utensilio u otros artículos deberán ser retirados del horno antes de iniciar un ciclo de limpieza automática. Cierre la puerta. Si usará un horno doble, seleccione qué horno desea limpiar. Seleccione la opción More (Más), y luego Self Clean (Limpieza Automática). Elija un ciclo de 3, 4 o 5 horas y seleccione la tecla Start (Iniciar) iluminada sobre la parte derecha de la pantalla. Para hornos con niveles de suciedad excesiva, se recomienda usar el tiempo de limpieza máximo de 5 horas. Si desea usar el tiempo por omisión, presione la tecla Start (Iniciar) inmediatamente luego de seleccionar Self Clean (Limpieza Automática). El horno mostrará que la puerta fue bloqueada y exhibirá la cantidad de tiempo restante en el ciclo. Presione la tecla iluminada Cancel (Cancelar) sobre la parte derecha de la pantalla, si desea detener el ciclo. El horno se apagará de forma automática cuando el ciclo de limpieza automática sea completado. La puerta permanecerá bloqueada hasta que el KRUQRVHKD\DHQIULDGR8QDYH]TXHHOKRUQRVHKD\DHQIULDGR limpie cualquier ceniza que haya quedado en el horno. Durante el primer ciclo de limpieza, le recomendamos ventilar su cocina con una ventana abierta o usar un ventilador o campana de ventilación. La suciedad en la estructura frontal del horno y la parte externa de la junta de la puerta se deberán limpiar de forma manual. Limpie estas áreas con agua caliente, estropajos de acero con jabón o limpiadores tales como Soft Scrub®. Enjuague bien con agua caliente y seque. 1ROLPSLHODMXQWD(OPDWHULDOGHILEUDGHYLGULRGHODMXQWDGH la puerta del horno no resiste la abrasión. Es esencial que la junta permanezca intacta. Si observa que comienza a gastarse o deshilacharse, reemplace la misma. Asegúrese de que el cobertor de la lámpara de luz del horno se encuentre en su lugar y que la luz del mismo esté apagada. Al usar el modo Self Clean (Limpieza Automática) en un horno doble, sólo el horno superior o inferior podrán utilizar el ciclo uno por vez. De forma adicional, ningún otro modo podrá ser iniciado en la cavidad del horno alterna mientras el ciclo de limpieza automática se encuentre en progreso. IMPORTANTE: Las emanaciones producidas por el ciclo de autolimpieza de cualquier horno afectan la salud de algunas aves de manera notoria. Procure llevar sus aves a otra habitación bien ventilada. Probe (Sonda) La sonda de temperatura se puede limpiar con agua y jabón o con una almohadilla de estropajo llena de jabón. Enfríe la sonda de temperatura antes de su limpieza. Fregue las manchas difíciles con una almohadilla de estropajo llena de jabón, enjuague y seque. Para ordenar más sondas de temperatura, consulte las secciones de Accesorios y Soporte al Consumidor al final de este manual. 1RVXPHUMDODVRQGDGHWHPSHUDWXUDHQDJXD 1RJXDUGHODVRQGDGHWHPSHUDWXUDGHQWURGHOKRUQR 1XQFDGHMHODVRQGDGHWHPSHUDWXUDGHQWURGHOKRUQRGXUDQWH un ciclo de limpieza automática o de limpieza con vapor. 18 49-2000375 Rev. 1 CUIDADO Y LIMPIEZA: Luz del Horno / Puerta del Horno Luz del Horno ADVERTENCIA PELIGRO DE DESCARGA O QUEMADURAS: Antes de reemplazar la lámpara de luz del horno, desconecte la conexión eléctrica del horno del fusible principal o del panel del disyuntor. Si esto no se cumple, se podrá producir una descarga eléctrica o un incendio. PRECAUCIÓN RIESGO DE INCENDIO: La tapa de vidrio y la lámpara de luz se deberán retirar cuando estén frías. Tocar el vidrio caliente sin protección en las manos o con un trapo húmedo puede ocasionar quemaduras. 1. Desconecte la corriente desde el fusible principal o el panel del disyuntor. 2. Retire los estantes del horno. 3. Deslice un destornillador de punta plana o un cuchillo para untar manteca entre la carcasa metálica y la tapa de luz de vidrio. NOTA: algunos modelos cuentan con un sujetador metálico que visiblemente sostiene el vidrio. Es necesario insertar la herramienta entre la carcasa metálica y el sujetador que sostiene el vidrio. 4. Apoye la tapa de luz de vidrio con dos dedos para evitar que se caiga al fondo del horno. Tenga cuidado de no astillar la cubierta del horno. 5. De forma suave, gire la punta del destornillador o del cuchillo para untar manteca, a fin de aflojar la tapa de luz de vidrio. Tenga cuidado de no astillar la cubierta del horno. 6. Retire la tapa de luz de vidrio. 7. Retire la lámpara sosteniendo firmemente y deslizando la misma hacia afuera, hasta que las dos clavijas hayan dejado el soporte de cerámica. 1RWRTXHHOYLGULRGHODQXHYDOiPSDUDFRQORV dedos. Esto hará que la lámpara falle al dar luz. Tome la lámpara de reemplzado con una toalla limpia o un pañuelo de papel con las clavijas hacia abajo. Aliñe las dos clavijas en el soporte de cerámica, presionando suavemente hasta que la lámpara quede asegurada en la ficha de cerámica. 9. Deslice las lentes protectoras del soporte y presione hasta que las pinzas queden enganchadas en la caja. 10. Vuelva a conectar la corriente. Puerta del Horno Retiro de la Puerta del Horno NOTA: La remoción de la puerta no es un requerimiento de la instalación del producto, pero es una comodidad adicional. Para quitar la puerta: 1. Abra la puerta del horno en su totalidad. 2. Retire el soporte de la bisagra (de estar presente) de la estructura frontal y déjelo a un lado. El soporte de la bisagra debe ser colocado nuevamente para un funcionamiento apropiado de la puerta cuando está última sea reinstalada. 3. Presione ambas trabas de la bisagra hacia abajo en dirección del marco de la puerta hasta destrabarlas. Para esto puede hacer falta un destornillador de lados planos. ¡NO LEVANTE LA PUERTA DE LA MANIJA! 4. Coloque las manos sobre ambos lados y cierre la puerta del horno hasta la posición de remoción (aproximadamente ´±´>FP±FP@GHODSRVLFLyQGHFLHUUH 5. Levante la puerta hasta que los brazos de la bisagra hayan salido de las ranuras. NOTA: La puerta del horno es muy pesada. Asegúrese de tener un agarre firme antes de levantar la puerta del horno de sus bisagras. Tenga cuidado XQDYH]TXHKD\DTXLWDGRODSXHUWD1RGHSRVLWHODSXHUWD sobre la manija. Esto puede provocar abolladuras o rayones. Soporte de la Bisagra Ranura de la bisagra Brazo de la bisagra Posición destrabada de la bisagra Reemplazo de la Puerta del Horno NOTA: La puerta del horno es pesada. Puede necesitar ayuda para levantar la puerta lo suficiente como para deslizarla dentro GHODVUDQXUDVGHODELVDJUD1ROHYDQWHODSXHUWDGHODPDQLMD 1. Levante la puerta del horno tomándola de ambos lados. 2. Con la puerta en el mismo ángulo de la posición de UHPRFLyQDSUR[LPDGDPHQWH´±´>FP±FP@GHVGH la posición de cerrado), introduzca la muesca del brazo de la bisagra dentro del extremo inferior de la ranura de la bisagra. La ranura del brazo de la bisagra debe estar bien colocada en la parte inferior de la ranura. 3. Abra la puerta por completo. Si la puerta no se abre por completo, la muesca no está bien colocada en el extremo inferior de la ranura. 4. Presione las trabas de la bisagra hacia arriba contra el armazón frontal de la cavidad del horno, hasta alcanzar la posición de trabado. 5. Reemplace el soporte de la bisagra (de estar presente). El soporte de la bisagra debe ser colocado nuevamente para un funcionamiento apropiado de la puerta. 6. Cierre la puerta del horno. Bisagra en la posición de trabado Ranura de la bisagra bien colocada en la parte inferior de la ranura de la bisagra Lado inferior de la ranura Brazo de la bisagra Soporte de la Bisagra La bisagra sale de la ranura Ranura de la bisagra 49-2000375 Rev. 1 19 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico ¡Ahorre tiempo y dinero! Revise los cuadros de las siguientes páginas o visite GEAppliances.com/ge/service-and-support/ cookingproducts.htm para acceder a artículos y videos de apoyo útiles antes de llamar al servicio técnico. Problema Causa Posible Qué Hacer Mi horno nuevo no cocina como el anterior. ¿Hay algún problema con las configuraciones de temperatura? Su horno nuevo cuenta con un sistema de cocción diferente con relación al anterior y, por lo tanto, es posible que cocine de forma diferente. En los primeros usos, use los tiempos y temperaturas de su receta con cuidado. Si aún piensa que su horno nuevo cocina con demasiado calor o demasiado frío, podrá ajustar el termostato usted mismo para aplicar su preferencia de cocción específica. Para ajustar la temperatura del horno, consulte la sección de Funciones Especiales. NOTA: Este ajuste afecta las temperaturas de los modos Traditional Bake (Horneado Tradicional), Convection Bake (Hornear por Convección) y Convection Bake Multi (Horneado por Convección Múltiple); éste no afectará los modos Convection Roast (Dorar por Convección), Traditional Broil (Asado Tradicional), Convection Broil (Asar por Convección) o Clean (Limpiar). La comida no se hornea de Controles del horno configurados de forma incorrecta. Consulte la sección Modos de Cocción. forma apropiada La posición del estante es incorrecta o el estante no está nivelado. Consulte la sección Modos de Cocción y la Guía de Cocción. 8VRGHXQDFDFHURODLQFRUUHFWDRGHXQDFDFHURODGH &RQVXOWHODVHFFLyQ8WHQVLOLRV tamaño incorrecto. La temperatura del horno debe ser ajustada. Consulte la opción Cooking (Cocción) en la sección Settings (Configuraciones). Sustitución de ingredientes Sustituir ingredientes puede modificar el resultado de la receta. La comida no asa de forma apropiada Controles del horno configurados de forma incorrecta. Se usó una posición incorrecta del estante. Asegúrese de seleccionar el modo correcto para asar. Para acceder a sugerencias de ubicación de estantes, consulte la Guía de Cocción. Se cocinó comida en una olla caliente. Asegúrese de que el utensilio esté frío 8WHQVLOLRGHFRFLQDLQDGHFXDGRSDUDDVDU 8VHXQDROODHVSHFtILFDPHQWHGLVHxDGDSDUDDVDU El papel de aluminio usado para la olla y la rejilla para Si usará papel de aluminio, deberá usarse conforme con las asar no se ajustó ni cortó de forma apropiada, según aberturas de la olla. lo recomendado. En algunas áreas, es posible que el nivel de corriente Precaliente el elemento para asar durante 10 minutos. (voltaje) sea bajo. La temperatura del horno es demasiado caliente o demasiado fría La temperatura del horno debe ser ajustada. Consulte la opción Cooking (Cocción) en la sección Settings (Configuraciones). El horno no funciona o parece no funcionar Es posible que un fusible de su hogar se haya quemado o que el disyuntor se haya desconectado. Reemplace el fusible o reinicie el disyuntor. Controles del horno configurados de forma incorrecta. &RQVXOWHODVHFFLyQ8VRGHO+RUQR El horno se encuentra en Sabbath Mode (Modo Sabático) Verifique que el horno no esté en Sabbath Mode (Modo Sabático). Consulte la opción Sabbath (Sabático) en la sección Settings (Configuraciones). Sonido de "chisporroteo" o "traqueo" Éste es el sonido de metal calentándose o enfriándose durante las funciones de cocción y limpieza.. Esto es normal. ¿Por qué la estufa hace un sonido de "clic" cuando uso el horno? Su estufa fue diseñada para mantener un control más ajustado sobre la temperatura del horno. Es posible que escuche que los elementos de calentamiento del horno hagan sonidos de "clic" con mayor frecuencia que con hornos más antiguos para lograr mejores resultados durante los ciclos de horneado, asado, convección y limpieza automática. Esto es normal. El reloj y el temporizador no Es posible que un fusible de su hogar se haya funcionan quemado o que el disyuntor se haya desconectado. Reemplace el fusible o reinicie el disyuntor. La luz del horno no funciona La lámpara está floja o presenta defectos. Ajuste o reemplace la lámpara. El modo de limpieza automática del horno no funciona La temperatura del horno es demasiado caliente como para configurar la limpieza automática. Los controles del horno están configurados de forma incorrecta. Espere a que el horno se enfríe y reinicie los controles. Consulte la sección de Limpieza del Horno. 20 49-2000375 Rev. 1 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico Problema Causa Posible Qué Hacer Exceso de humo durante un Suciedad o grasa excesiva. ciclo de limpieza Presione Cancel (Cancelar) sobre la tecla que se encuentra sobre la parte derecha de la pantalla para detener el ciclo. Limpie el exceso de suciedad y reinicie el ciclo de limpieza. Humo excesivo al asar La comida está demasiado cerca del quemador. Baje la posición del estante con comida. La puerta del horno no se abrirá luego de un ciclo de limpieza El horno está demasiado caliente. Espere a que el horno se enfríe por debajo de la temperatura de bloqueo. El horno no limpia luego de Los controles del horno están configurados de forma Consulte la sección de Limpieza del Horno. un ciclo de limpieza incorrecta. El horno estaba demasiado sucio. Limpie derrames excesivos antes de iniciar el ciclo de limpieza. Es posible que, en hornos con mucha suciedad, sea necesario usar la limpieza automática nuevamente o usarla durante un período de tiempo más prolongado. "F y un número o letra" son exhibidos en la pantalla de LCD Tiene un código de error de función. Si el código de función se repite. Presione Dismiss (Descartar) en la pantalla de LCD. Vuelva a poner el horno en funcionamiento. Desconecte totalmente la corriente de la cocina durante por lo menos 30 minutos y vuelva a conectar la misma. Si el código de error de función se repite, llame al servicio técnico. El LCD no está funcionando Es posible que un fusible de su hogar se haya correctamente quemado o que el disyuntor se haya desconectado. Reemplace el fusible o reinicie el disyuntor. Los controles del horno están configurados de forma incorrecta. Consulte la sección de Modos de Cocción o Configuraciones para asegurar un uso correcto. Asegúrese de que la unidad se encuentre actualizada con el software más reciente. La pantalla de LCD está bloqueada. Desbloquee la pantalla presionando el ícono Unlock (Desbloquear). Si esto no corrige el problema, haga circular corriente por el disyuntor y asegúrese de que la unidad se encuentre actualizada con el software más reciente. El LCD es defectuoso. Haga circular corriente por el disyuntor y asegúrese de que la unidad se encuentre actualizada con el software más reciente. Si el problema persiste, comuníquese con el servicio técnico para evaluar el mismo. Corte de corriente, el reloj se reinicia Corte o exceso de corriente Reinicie el reloj. Si el horno se encontraba en uso, deberá reiniciar el mismo presionando la tecla Cancel (Cancelar), configurando el reloj y reiniciando cualquier función de cocción. Olor a "quemado" o "aceite" desde la ventilación Esto es normal en un horno nuevo y desaparecerá con el tiempo. Para acelerar el proceso, configure un ciclo de limpieza automática por un mínimo de 3 horas. Consulte la sección de Limpieza del Horno. Olor fuerte 8QRORUHQODDLVODFLyQDOUHGHGRUGHOLQWHULRUGHOKRUQR Esto es temporario y desaparecerá luego de varios usos o de es normal desde las primeras veces en que el horno un ciclo de limpieza automática. es usado. Ruido del ventilador Es posible que un ventilador de enfriamiento se active automáticamente. Esto es normal. El ventilador de enfriamiento se encenderá para enfriar las partes internas. Es posible que funcione hasta durante una hora y media, una vez que el horno se haya apagado. La puerta de vidrio del horno parece estar "teñida" o tener un color "arcoíris". ¿Es esto un defecto? 1R(OYLGULRGHOKRUQRLQWHUQRHVWiFXELHUWRFRQXQD barrera de calor que refleja este último nuevamente hacia el horno, a fin de evitar la pérdida de calor y de mantener fría la puerta externa mientras se hornea. Esto es normal. Bajo ciertas luces y ángulos, es posible que visualice esta tinta o arcoíris. A veces el horno tarda más 8WHQVLOLRRFRPLGDHQHOKRUQR en precalentarse a la misma temperatura El utensilio o la comida en el horno hará que éste tarde más en precalentarse. Retire estos artículos para reducir el tiempo de precalentamiento. 1~PHURGHHVWDQWHVHQHOKRUQR Agregar más estantes al horno hará que éste tarde más en precalentarse. Retire algunos estantes. Diferentes modos de cocción Los diferentes modos de cocción utilizan diferentes métodos de precalentamiento para calentar el horno en un modo de cocción específico. Algunos modos tardarán más que otros (tales como: horneado por convección múltiple). El horno no funciona en forma remota Problemas en el enrutador, no hay señal inalámbrica, Para solicitar asistencia con la conectividad de red inalámbrica, etc. comuníquese al 1-800-220-6899. El horno no está conectado. 49-2000375 Rev. 1 21 GARANTÍA LIMITADA Garantía Limitada del Horno Eléctrico de GE Appliances GEAppliances.com Todo el servicio de garantía es provisto por nuestros Centros de Servicio de Fabricación, o un técnico autorizado de Customer Care®. Para programar una visita del servicio técnico a través de Internet, visítenos en GEAppliances.com/service_and_support/, o llame al 800.GE.CARES (800.432.2737). Cuando llame para solicitar el servicio, tenga los números de serie y modelo disponibles. Para realizar el servicio técnico de su electrodoméstico, se podrá requerir el uso de datos del puerto de abordaje para su diagnóstico. Esto da al técnico del servicio de fábrica de GE Appliances la habilidad de diagnosticar de forma rápida cualquier problema con su electrodoméstico, y de ayudar a GE Appliances a mejorar sus productos al brindarle a GE Appliances la información sobre su electrodoméstico. Si no desea que los datos de su electrodoméstico sean enviados a GE Appliances, solicitamos que le indique a su técnico no entregar los datos a GE Appliances en el momento del servicio. Por el Período de GE Appliances reemplazará Un Año Cualquier parte del horno que falle debido a un defecto en los materiales o la fabricación. Durante esta Desde la fecha de la garantía limitada de un año, GE Appliances también proveerá, sin costo, todo el trabajo y el servicio compra original en el hogar para reemplazar la parte que presente defectos. Qué no cubrirá GE Appliances: Viajes del técnico del servicio a su hogar para enseñarle sobre cómo usar el producto. ,QVWDODFLyQHQWUHJDRPDQWHQLPLHQWRLQDGHFXDGRV )DOODVGHOSURGXFWRHQFDVRGHDEXVRPDOXVRPRGLILFDFLyQ o uso para propósitos diferentes al original o uso comercial. 5HHPSOD]RGHIXVLEOHVGHODFDVDRUHLQLFLRGHGLV\XQWRUHV 'DxRVRFDVLRQDGRVVREUHHOSURGXFWRSRUDFFLGHQWH incendio, inundaciones o catástrofes naturales. 'DxRVVREUHHODFDEDGRWDOHVFRPRy[LGRVREUHOD superficie, deslustres o manchas pequeñas no informadas dentro de las 48 horas luego de la entrega. 'DxRVLQFLGHQWDOHVRFRQVHFXHQWHVFDXVDGRVSRUSRVLEOHV defectos sobre este producto. 'DxRFDXVDGRGHVSXpVGHODHQWUHJD 3URGXFWRQRDFFHVLEOHSDUDEULQGDUHOVHUYLFLRUHTXHULGR 6ROLFLWHHOVHUYLFLRWpFQLFRSDUDUHSDUDURUHHPSOD]DUODV lámparas, excepto las lámparas LED. EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS Su única y exclusiva alternativa es la reparación del producto, como se indica en la Garantía Limitada. Las garantías implícitas, incluyendo garantías implícitas de comerciabilidad o conveniencia sobre un propósito particular, se limitan a un año o al período más corto permitido por la ley. Esta garantía limitada se extiende al comprador original y a cualquier propietario posterior de los productos FRPSUDGRVSDUDXVRGRPpVWLFRGHQWURGH((88 Si el producto está en un área donde no se encuentra disponible un Proveedor Autorizado del Servicio Técnico de GE Appliances, usted será responsable por el costo de un viaje o se podrá requerir que traiga el producto a una ubicación del Servicio Técnico de GE Appliances autorizado para recibir el servicio. En Alaska, la garantía limitada excluye el costo de envío o visitas de servicio a su domicilio. Algunos estados no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía limitada le otorga derechos legales específicos, y usted también podría tener otros derechos que varían de estado a estado. Para conocer cuáles son sus derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado. Garante: GE Appliances, a Haier company Louisville, KY 40225 Garantías Extendidas: Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales que están disponibles mientras su garantía aún está vigente. Puede acceder a la misma a través de Internet en cualquier momento en GEAppliances.com/extended-warranty o llamando al 800.626.2224 durante el horario comercial. Los Servicios para los GE Appliances aún estarán disponibles cuando su garantía caduque. Abroche su recibo aquí. Para acceder al servicio técnico de acuerdo con la garantía deberá contar con la prueba de la fecha original de compra. 22 49-2000375 Rev. 1 ACCESORIOS Accesorios ¿Busca Algo Más? ¡GE Appliances ofrece una variedad de accesorios para mejorar sus experiencias de cocción y mantenimiento! Para acceder a números telefónicos e información de sitios Web, consulte la página de Soporte para el Consumidor. Estos y otros productos están disponibles: Accesorios Olla para Asar Pequeña (8 ¾ " x 1 ¼" x 13 ½ ") Olla para Asar Grande* (12 ¾ " x 1 ¼" x 16 ½ ") Olla para Asar Extra Grande** (17 ¾ " x 1 ¼" x 19 ½ ") Piezas Estantes del horno Elementos del horno Lámparas de luz Sonda Suministros de Limpieza Limpiadores de Acero Inoxidable CitriShineTM Limpiador de Electrodomésticos de Acero Inoxidable CeramaBryte Lubricante de Grafito *La olla para asar grande no entra en cocinas de 20"/24". **La olla XL no entra en hornos de pared de 24", empotrables de 27" o cocinas de 20"/24". 49-2000375 Rev. 1 23 SOPORTE PARA EL CONSUMIDOR Soporte para el Consumidor Sitio Web de GE Appliances ¿Desea realizar una consulta o necesita ayuda con su electrodoméstico? ¡Intente a través del Sitio Web de GE Appliances las KRUDVGHOGtDFXDOTXLHUGtDGHODxR8VWHGWDPELpQSXHGHFRPSUDUPiVHOHFWURGRPpVWLFRVPDUDYLOORVRVGH*($SSOLDQFHV\ aprovechar todos nuestros servicios de soporte a través de Internet, diseñados para su conveniencia. (Q((88GEAppliances.com Registre su Electrodoméstico £5HJLVWUHVXHOHFWURGRPpVWLFRQXHYRDWUDYpVGH,QWHUQHWVHJ~QVXFRQYHQLHQFLD8QUHJLVWURSXQWXDOGHVXSURGXFWRSHUPLWLUi una mejor comunicación y un servicio más puntual de acuerdo con los términos de su garantía, en caso de surgir la necesidad. También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con el material embalado. (Q((88GEAppliances.com/register Servicio Programado El servicio de reparación de expertos de GE Appliances está a sólo un paso de su puerta. Conéctese a través de Internet y programe VXVHUYLFLRDVXFRQYHQLHQFLDFXDOTXLHUGtDGHODxR(Q((88GEAppliances.com/service o comuníquese al 800.432.2737 durante el horario de atención comercial. Garantías Extendidas Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales que están disponibles mientras su garantía aún está vigente. La puede adquirir en cualquier momento a través de Internet. Los servicios de GE Appliances aún estarán allí cuando su garantía caduque. (Q((88GEAppliances.com/extended-warranty o comuníquese al 800.626.2224 durante el horario de atención comercial. Conectividad Remota Para solicitar asistencia para la conectividad de red inalámbrica (para modelos con acceso remoto), visite nuestro sitio web en GEAppliances.com/connect RFRPXQtTXHVHDOHQ((88 Piezas y Accesorios Aquellos individuos calificados para realizar el servicio técnico de sus propios electrodomésticos podrán solicitar el envío de piezas o accesorios directamente a sus hogares (se aceptan las tarjetas VISA, MasterCard y Discover). Ordene hoy a través de ,QWHUQHWGXUDQWHODVKRUDVWRGRVORVGtDV(Q((88GEApplianceparts.com o de forma telefónica al 877.959.8688 durante el horario de atención comercial. Las instrucciones que figuran en este manual cubren los procedimientos que serán realizados por cualquier usuario. Otros servicios técnicos generalmente deben ser derivados a personal calificado del servicio. Se deberá tener cuidado, ya que una reparación indebida podrá hacer que el funcionamiento no sea seguro. Contáctenos Si no se encuentra satisfecho con el servicio que recibió de GE Appliances, comuníquese con nosotros a través de nuestro sitio Web con todos los detalles, incluyendo su número telefónico, o escriba a: (Q((88*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.< GEAppliances.com/contact 24 49-2000375 Rev. 1Adobe InDesign 14.0 (Windows) Acrobat Distiller 19.0 (Windows)