GE Profile - PGS930BPTS - GE Profile™ 30" Smart Slide-In Front-Control Gas Range with No Preheat Air Fry-PGS930BPTS | Elm Radio
User Manual & Care for PGS930YPFS | GE Appliances
Self-Cleaning Gas RANGES SAFETY INFORMATION . . . . . . . . . . 3 USING THE RANGE In Case of a Power Failure . . . . . . . . . . . . . . . 8 Surface Burners . . . . . . . . . . . . . . . . . . . . . . . . 8 Griddle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10 Oven Controls . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Cooking Options. . . . . . . . . . . . . . . . . . . . . . . . 12 Settings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Sabbath Mode. . . . . . . . . . . . . . . . . . . . . . . . . .14 Oven Racks . . . . . . . . . . . . . . . . . . . . . . . . . . . .15 Aluminum Foil and Oven Liners. . . . . . . . . . .15 Oven Cooking Modes . . . . . . . . . . . . . . . . . . .16 Oven Air Vents . . . . . . . . . . . . . . . . . . . . . . . . . 17 Oven Probe . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Oven Cooking Guide . . . . . . . . . . . . . . . . . . . .18 Air Fry Cooking Guide. . . . . . . . . . . . . . . . . . 20 CARE AND CLEANING Range Exterior . . . . . . . . . . . . . . . . . . . . . . . . 21 Range Interior . . . . . . . . . . . . . . . . . . . . . . . 22 Cooktop . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 Door and Drawer . . . . . . . . . . . . . . . . . . . . . . 25 Oven Probe . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 Oven Light. . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 Oven Door . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 TROUBLESHOOTING TIPS. . . . . . . 28 LIMITED WARRANTY . . . . . . . . . . . . 32 ACCESSORIES . . . . . . . . . . . . . . . . . . . . 33 CONSUMER SUPPORT . . . . . . . . . . . 34 OWNER'S MANUAL PGS930 ENGLISH / ESPAÑOL Write the model and serial numbers here: Model # _________________ Serial # _________________ You can find the rating label on the front behind the range drawer. GE is a trademark of the General Electric Company. Manufactured under trademark license. 49-2000781 Rev. 6 09-24 THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME. Whether you grew up with GE Appliances, or this is your first, we're happy to have you in the family. We take pride in the craftsmanship, innovation and design that goes into every GE Appliances product, and we think you will too. Among other things, registration of your appliance ensures that we can deliver important product information and warranty details when you need them. Register your GE appliance now online. Helpful websites and phone numbers are available in the Consumer Support section of this Owner's Manual. You may also mail in the pre-printed registration card included in the packing material. 2 49-2000781 Rev. 6 SAFETY INFORMATION IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE WARNING Read all safety instructions before using the product. Failure to follow these instructions may result in fire, electrical shock, serious injury or death. WARNING If the information in this manual is not followed exactly, a fire or explosion may result, causing property damage, personal injury or death. - Do not store or use gasoline or other flammable vapors and liquids in the vicinity of this or any other appliance. - WHAT TO DO IF YOU SMELL GAS 'RQRWWU\WROLJKWDQ\DSSOLDQFH 'RQRWWRXFKDQ\HOHFWULFDOVZLWFKGRQRWXVHDQ\SKRQHLQ\RXUEXLOGLQJ ,PPHGLDWHO\FDOO\RXUJDVVXSSOLHUIURPDQHLJKERU¶VSKRQH)ROORZWKHJDV VXSSOLHU¶VLQVWUXFWLRQV ,I\RXFDQQRWUHDFK\RXUJDVVXSSOLHUFDOOWKHILUHGHSDUWPHQW - Installation and service must be performed by a qualified installer, service agency or the gas supplier. ANTI-TIP DEVICE WARNING Tip-Over Hazard · A child or adult can tip the range and be killed. · Install the anti-tip bracket to the wall or floor. · Engage the range to the anti-tip bracket by sliding the range back such that the foot is engaged. · Re-engage the anti-tip bracket if the range is moved. · Failure to do so can result in death or serious burns to children or adults. To reduce the risk of tipping the range, the range must be secured by a properly installed anti-tip bracket. See installation instructions shipped with the bracket for complete details before attempting to install. For Free-Standing and Slide-In Ranges To check if the bracket is installed and engaged properly, look underneath the range to see that the rear leveling leg is engaged in the bracket. On some models, the storage drawer or kick panel can be removed for easy inspection. If visual inspection is not possible, slide the range forward, confirm the anti-tip bracket is securely attached to the floor or wall, and slide the range back so the rear leveling leg is under the anti-tip bracket. If the range is pulled from the wall for any reason, always repeat this procedure to verify the range is properly secured by the anti-tip bracket. Never completely remove the leveling legs or the range will not be secured to the anti-tip device properly. Anti-Tip Bracket Leveling Leg Free-Standing and Slide-In Ranges READ AND SAVE THESE INSTRUCTIONS 49-2000781 Rev. 6 3 SAFETY INFORMATION IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE WARNING GENERAL SAFETY INSTRUCTIONS WARNING NEVER use this appliance as a space heater to heat or warm the room. Doing so may result in carbon monoxide poisoning and overheating of the oven. 8VHWKLVDSSOLDQFHIRULWVLQWHQGHGSXUSRVHDV described in this owner's manual. + DYH\RXUUDQJHLQVWDOOHGDQGSURSHUO\JURXQGHGE\ a qualified installer in accordance with the provided installation instructions. $ Q\DGMXVWPHQWDQGVHUYLFHVKRXOGEHSHUIRUPHG only by a qualified gas range installer or service technician. Do not attempt to repair or replace any part of your range unless it is specifically recommended in this manual. < RXUUDQJHLVVKLSSHGIURPWKHIDFWRU\VHWIRUXVH with natural gas. It can be converted for use with propane gas. If required, these adjustments must be made by a qualified technician in accordance with the installation instructions and local codes. The agency performing this work assumes responsibility for the conversion. + DYHWKHLQVWDOOHUVKRZ\RXWKHORFDWLRQRIWKH range gas shut-off valve and how to turn it off if necessary. 3 OXJ\RXUUDQJHLQWRDYROWJURXQGHGRXWOHW only. Do not remove the round grounding prong from the plug. If in doubt about the grounding of the home electrical system, it is your responsibility and obligation to have an ungrounded outlet replaced with a properly grounded, three prong outlet in accordance with the National Electrical Code. Do not use an extension cord with this appliance. ' RQRWOHDYHFKLOGUHQDORQHRUXQDWWHQGHGLQDQ area where an appliance is in use. They should never be allowed to climb, sit or stand on any part of the appliance. CAUTION Do not store items of interest to children in cabinets above an oven - children climbing on the oven to reach items could be seriously injured. 1 HYHUEORFNWKHYHQWVDLURSHQLQJVRIWKHUDQJH They provide the air inlets and outlets that are necessary for the range to operate properly with correct combustion. Air openings are located at the rear of the cooktop, at the top and bottom of the oven door, and at the bottom of the range under the warming drawer, lower oven drawer or kick panel. 8 VHRQO\GU\SRWKROGHUV²PRLVWRUGDPSSRW holders on hot surfaces may result in burns from steam. Do not let pot holders touch surface burners, burner grate, or oven heating element. Do not use a towel or other bulky cloth in place of pot holders. ' RQRWWRXFKWKHKHDWLQJHOHPHQWVRUWKHLQWHULRU surface of the oven. These surfaces may be hot enough to burn even though they are dark in color. During and after use, do not touch, or let clothing or other flammable materials contact any interior area of the oven; allow sufficient time for cooling first. Other surfaces of the appliance may become KRWHQRXJKWRFDXVHEXUQV3RWHQWLDOO\KRWVXUIDFHV include the burners, grates, oven vent opening, surfaces near the opening, and crevices around the oven door. ' RQRWKHDWXQRSHQHGIRRGFRQWDLQHUV3UHVVXUH could build up and the container could burst, causing an injury. % HIRUHSHUIRUPLQJDQ\VHUYLFHXQSOXJWKHUDQJH or disconnect the power supply at the household distribution panel by removing the fuse or switching off the circuit breaker. % HVXUHDOOSDFNLQJPDWHULDOVDUHUHPRYHGIURPWKH range before operating to prevent ignition of these materials. $ YRLGVFUDWFKLQJRULPSDFWLQJJODVVGRRUV cooktops, or control panels. Doing so may lead to glass breakage. Do not cook on a product with broken glass. Shock, fire, or cuts may occur. & RRNIRRGWKRURXJKO\WRKHOSSURWHFWDJDLQVW foodborne illness. Minimum safe food temperature recommendations can be found at IsItDoneYet.gov and fsis.usda.gov.8VHDIRRG thermometer to take food temperatures and check several locations. ' RQRWDOORZDQ\RQHWRFOLPEVWDQGRUKDQJRQWKH oven door, drawer or cooktop. They could damage the range or tip it over causing severe injury or death. READ AND SAVE THESE INSTRUCTIONS 4 49-2000781 Rev. 6 SAFETY INFORMATION IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE Failure to do so may result in fire or personal injury. 'RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVLQDQRYHQ or near the cooktop, including paper, plastic, pot holders, linens, wall coverings, curtains, drapes and gasoline or other flammable vapors and liquids. 1HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOH using the appliance. These garments may ignite if they contact hot surfaces causing severe burns. 'RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH materials accumulate in or near the range. Grease in the oven or on the cooktop may ignite. WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING STEPS TO PREVENT INJURY AND FIRE SPREADING 'RQRWXVHZDWHURQJUHDVHILUHV1HYHUSLFNXS a flaming pan. Turn the controls off. Smother a flaming pan on a surface unit by covering the pan completely with a well-fitting lid, cookie sheet or flat WUD\8VHDPXOWLSXUSRVHGU\FKHPLFDORUIRDPW\SH fire extinguisher. ,IWKHUHLVDILUHLQWKHRYHQGXULQJEDNLQJVPRWKHU the fire by closing the oven door and turning the oven off or by using a multi-purpose dry chemical or foam-type fire extinguisher. ,IWKHUHLVDILUHLQWKHRYHQGXULQJVHOIFOHDQWXUQ the oven off and wait for the fire to go out. Do not force the door open. Introduction of fresh air at selfclean temperatures may lead to a burst of flame from the oven. Failure to follow this instruction may result in severe burns. WARNING COOKTOP SAFETY INSTRUCTIONS WARNING NEVER Operate the Top Surface Cooking Section of this Appliance Unattended. · Failure to follow this warning statement could result in fire, explosion, or burn hazard that could cause property damage, personal injury, or death. · If a fire should occur, keep away from the appliance and immediately call your fire department. DO NOT ATTEMPT TO EXTINGUISH AN OIL/GREASE FIRE WITH WATER. 1HYHUOHDYHWKHVXUIDFHEXUQHUVXQDWWHQGHG)RRGV especially oily foods, may ignite resulting in fire that could spread to surrounding cabinets. 1 HYHUOHDYHRLOXQDWWHQGHGZKLOHIU\LQJ,IDOORZHG to heat beyond its smoking point, oil may ignite resulting in fire that may spread to surrounding FDELQHWV8VHDGHHSIDWWKHUPRPHWHUZKHQHYHU possible to monitor oil temperature. 7 RDYRLGRLOVSLOORYHUDQGILUHXVHWKHPLQLPXP amount of oil when using a shallow pan-frying and avoid cooking frozen foods with excessive amounts of ice. 8 VHSURSHUSDQVL]HDQGDYRLGSDQVWKDWDUH unstable or easily tipped. Select cookware that is matched to the size of the burner. Burner flames should be adjusted so that they do not extend beyond the bottom of the pan. Excessive flame may be hazardous. $ OZD\VXVHWKH/,7(SRVLWLRQZKHQLJQLWLQJWKHWRS burners and make sure the burners have ignited. : KHQXVLQJJODVVFHUDPLFFRRNZDUHPDNHVXUHLW is suitable for cooktop service; others may break because of sudden change in temperature. 7 RPLQLPL]HWKHSRVVLELOLW\RIEXUQVLJQLWLRQRI flammable materials and spillage, the handle of a container should be turned toward the center of the range without extending over nearby burners. ' RQRWXVHDZRNZLWKDURXQGPHWDOVXSSRUWULQJ The ring may trap heat and block air to the burner resulting in a carbon monoxide hazard. READ AND SAVE THESE INSTRUCTIONS 49-2000781 Rev. 6 5 SAFETY INFORMATION IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE WARNING COOKTOP SAFETY INSTRUCTIONS (Cont.) ' RQRWDWWHPSWWROLIWWKHFRRNWRS'RLQJVRPD\ damage the gas tubing to the surface burners resulting in a gas leak and risk of fire. : KHQGLVDEOLQJ/RFN&RQWURORQVRPHPRGHOV make sure the surface controls are set to the OFF position. This will prevent unintended gas flow from the burners. ' RQRWXVHDOXPLQXPIRLOWRFRYHUWKHJUDWHVRU line any part of the cooktop. Doing so may result in carbon monoxide poisoning, overheating of the cooktop surfaces, or a potential fire hazard. WARNING OVEN SAFETY INSTRUCTIONS WARNING NEVER cover any slots, holes, or passages in the oven bottom or cover an entire rack with materials such as aluminum foil or oven liners. Doing so blocks air flow through the oven and may cause carbon monoxide poisoning. Never place foil or oven liners on the oven bottom. They can trap heat causing risk of smoke or fire. 6WDQGDZD\IURPWKHUDQJHZKHQRSHQLQJWKHRYHQ door. Hot air or steam which escapes can cause EXUQVWRKDQGVIDFHDQGRUH\HV 1HYHUSODFHFRRNLQJXWHQVLOVSL]]DRUEDNLQJVWRQHV or any type of foil or liner on the oven floor. These items can trap heat or melt, resulting in damage to the product and risk of shock, smoke or fire. 3ODFHRYHQUDFNVLQGHVLUHGORFDWLRQZKLOHRYHQLV cool. If rack must be moved while oven is hot, be careful to avoid touching hot surfaces. 'RQRWOHDYHLWHPVVXFKDVSDSHUFRRNLQJXWHQVLOV or food in the oven when not in use. Items stored in an oven can ignite. 'RQRWOHDYHLWHPVRQWKHFRRNWRSQHDUWKHRYHQ vent. Items may overheat resulting in a risk of fire or burns. 1HYHUEURLOZLWKGRRURSHQ2SHQGRRUEURLOLQJLV not permitted due to overheating of control knobs. WARNING SELF-CLEANING OVEN SAFETY INSTRUCTIONS The self-cleaning feature operates the oven at temperatures high enough to burn away food soils in the oven. Follow these instructions for safe operation. 'RQRWWRXFKRYHQVXUIDFHVGXULQJVHOIFOHDQ ,IWKHVHOIFOHDQLQJPRGHPDOIXQFWLRQVWXUQWKH operation. Keep children away from the oven during self-cleaning. Failure to follow these instructions may cause burns. % HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHUHPRYHSDQV shiny metal oven racks, and other utensils from the oven. Only porcelain-coated oven racks may be left in the oven. % HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHZLSHJUHDVH and food soils from the oven. Excessive amount of grease may ignite leading to smoke damage to your home. oven off and disconnect the power supply. Have it serviced by a qualified technician. ' RQRWXVHRYHQFOHDQHUV1RFRPPHUFLDORYHQ cleaner or oven liner protective coating of any kind should be used in or around any part of the oven. ' RQRWFOHDQWKHGRRUJDVNHW7KHGRRUJDVNHWLV essential for a good seal. Care should be taken not to rub, damage or move the gasket. IMPORTANT: The health of some birds is extremely sensitive to the fumes given off during the self-cleaning cycle of any range. Move birds to another well-ventilated room. READ AND SAVE THESE INSTRUCTIONS 6 49-2000781 Rev. 6 SAFETY INFORMATION IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE Remote Enable Equipment 7KLVGHYLFHFRPSOLHVZLWKSDUWRIWKH)&&5XOHV 2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQV This device may not cause harmful interference, and WKLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHUHFHLYHG including interference that may cause undesired operation. The wireless communication equipment installed on this range has been tested and found to comply with the OLPLWVIRUD&ODVV%GLJLWDOGHYLFHSXUVXDQWWRSDUWRI the FCC Rules. These limits are designed to: (a) provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses, and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: 5HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQD ,QFUHDVHWKHVHSDUDWLRQEHWZHHQWKHHTXLSPHQWDQG receiver. &RQQHFWWKHHTXLSPHQWLQWRDQRXWOHWRQDFLUFXLW different from that to which the receiver is connected. &RQVXOWWKHGHDOHURUDQH[SHULHQFHGUDGLR79 technician for help. (b) accept any interference received, including interference that may cause undesired operation of the device. Note that any changes or modifications to the wireless communication device installed on this oven that are not expressly approved by the manufacturer could void the user's authority to operate the equipment. PROPER DISPOSAL OF YOUR APPLIANCE Dispose of or recycle your appliance in accordance with Federal and Local Regulations. Contact your local authorities for the environmentally safe disposal or recycling of your appliance. How to Remove Protective Shipping Film and Packaging Tape Carefully grasp a corner of the protective shipping film with your fingers and slowly peel it from the appliance surface. Do not use any sharp items to remove the film. Remove all of the film before using the appliance for the first time. To assure no damage is done to the finish of the product, the safest way to remove the adhesive from packaging tape on new appliances is an application of a household liquid dishwashing detergent. Apply with a soft cloth and allow to soak. NOTE: The adhesive must be removed from all parts. It cannot be removed if it is baked on. Consider recycling options for your appliance packaging material. READ AND SAVE THESE INSTRUCTIONS 49-2000781 Rev. 6 7 USING THE RANGE: ,Q &DVH RI D 3RZHU )DLOXUH 6XUIDFH %XUQHUV In Case of a Power Failure In the event of a power failure, the oven is inoperable and no attempt should be made to operate it. However, WKH VXUIDFH EXUQHUV PD\ EH OLW ZLWK D PDWFK 8VLQJ extreme caution, hold a lit match near the ports beneath Surface Burners the surface burner cap, then slowly turn the knob to the LITE position. Once lit, surface burners will continue to operate normally. Lighting a Surface Burner WARNING Burners should be operated only when covered by cookware. Burner flames not covered by cookware present a risk of fire or clothing ignition. Never let flames extend beyond the sides of the cookware. Failure to comply may result in serious injury. Make sure all burners are in their correct locations and fully assembled before attempting to operate any burner. 6HOHFW D EXUQHU DQG ILQG LWV FRQWURO NQRE 3XVK WKH NQRE in and turn it to the LITE position. <RX ZLOO KHDU D FOLFNLQJ QRLVH² the sound of the electric spark igniting the burner. When one burner is turned to LITE, all burners will spark. Sparking will continue as long as the knob remains at LITE. Once gas is ignited, turn the knob to adjust the flame size. 3XVK WKH FRQWURO NQRE LQ DQG turn it to the LITE position. Selecting a Flame Size Watch the flame, not the knob, as you adjust heat. When rapid heating is desired, the flame size should match the size of the cookware you are using. Flames larger than the bottom of the cookware will not heat faster and may be hazardous. These flames are too large for the pot Using the Surface Burners NOTES: 'R QRW RSHUDWH WKH EXUQHU IRU DQ H[WHQGHG SHULRG RI time without cookware on the grate. The finish on the grate may discolor or chip without cookware to absorb the heat. 'R QRW DWWHPSW WR GLVDVVHPEOH DQ\ EXUQHU ZKLOH DQRWKHU burner is on. Damage to the product may occur. %H VXUH WKH EXUQHUV DQG JUDWHV DUH FRRO EHIRUH \RX place your hand, a pot holder or cleaning materials on them. Your rangetop has sealed gas burners that offer convenience, cleanability and flexibility for a wide range of cooking applications. The smallest burner is the simmer burner. A simmer burner turned down to LO provides precise cooking performance for foods such as delicate sauces that require low heat for a long cooking time. The extra-large burner is designed to quickly bring large amounts of liquid to a boil. Some models have a 32:(5 %2,/ VHWWLQJ HVSHFLDOO\ GHVLJQHG IRU XVH ZLWK FRRNZDUH ZLWK D GLDPHWHU RI LQFKHV RU ODUJHU Types of Surface Burners Round Burner 8VH WKLV EXUQHU IRU JHQHUDO cooking purposes. Size cookware appropriately to the flames. Multi-Ring Burner (on some models) 8VH WKLV EXUQHU IRU ODUJH cookware or for simmering applications. Dual Oval Burner (on some models) 8VH WKLV EXUQHU WR FRRN RQ WKH griddle or with small cookware. 8 49-2000781 Rev. 6 USING THE RANGE: Surface Burners Surface Burners (Cont.) Multi-Ring Burner (some models) Dual Oval Burner (some models) For large cookware, activate all rings by setting set the burner between Hi and Med. For small cookware or low heating applications, only activate the inner rings by setting the burner between Lo and Sim. For small cookware, only activate the round burner. When using a griddle, activate both the oval and round burner sections. Side View Of The Multi-Ring Burner Knob Side View Of The Dual Oval Burner Knob Top-of-Range Cookware Aluminum: Medium-weight cookware is recommended because it heats quickly and evenly. Most foods brown HYHQO\LQDQDOXPLQXPVNLOOHW8VHVDXFHSDQVZLWKWLJKW fitting lids when cooking with minimum amounts of water. Stainless Steel: This metal alone has poor heating properties and is usually combined with copper, aluminum or other metals for improved heat distribution. Combination metal skillets usually work satisfactorily if they are used with medium heat or as the manufacturer recommends. Cast-Iron: If heated slowly, most skillets will give satisfactory results. Enamelware:8QGHUVRPHFRQGLWLRQVWKHHQDPHO of some cookware may melt. Follow the cookware manufacturer's recommendations for cooking methods. Glass:7KHUHDUHWZRW\SHVRIJODVVFRRNZDUH²WKRVH for oven use only and those for top-of-range cooking VDXFHSDQVFRIIHHDQGWHDSRWV*ODVVFRQGXFWVKHDW very slowly. Heatproof Glass Ceramic: Can be used for either surface or oven cooking. It conducts heat very slowly and cools very slowly. Check the cookware manufacturer's directions to be sure it can be used on gas ranges. Stove Top Grills Do not use an after-market stove top grill on your gas surface burners. A stove top grill will cause incomplete combustion resulting in carbon monoxide levels above allowable standards. This could be hazardous to your health. Do not use stove top grills Using a Wok 8VHRQO\DIODWERWWRPHGZRNZLWKDGLDPHWHURILQFKHV or less. Make sure the wok bottom sits flat on the grate. 'RQRWXVHDZRNVXSSRUWULQJ3ODFLQJWKHULQJRYHUWKH burner or grate may cause the burner to work improperly, resulting in carbon monoxide levels above allowable standards. This could be hazardous to your health. 8VHDIODWERWWRPHGZRN 49-2000781 Rev. 6 9 USING THE COOKTOP: Griddle Griddle (on some models) WARNING Fire Hazard 8VH FDUH ZKHQ FRRNLQJ JUHDV\ IRRGV 6SLOOHG JUHDVH PD\ UHVXOW LQ ILUH 1HYHU SODFH DQ\ LWHPV RQ WKH JULGGOH ZKHQ LW LV QRW LQ XVH +HDW IURP VXUURXQGLQJ EXUQHUV FDQ KHDW the griddle and may result in fire. 3ODFH DQG UHPRYH WKH JULGGOH RQO\ ZKHQ JULGGOH LV FRRO DQG DOO VXUIDFH EXUQHUV DUH WXUQHG 2)) Using Your Cast Iron Griddle The ribbed side of the reversible griddle can be used for food normally grilled. Your griddle provides an extra-large cooking surface for meats, pancakes and other foods usually prepared in a skillet. Before first use, rinse with hot water and dry WKRURXJKO\ 3UHSDUH WKH VXUIDFH ZLWK FRRNLQJ VSUD\ RU vegetable oil. Griddle Precautions: 'R QRW SODFH WKH JULGGOH LQ D PLFURZDYH RYHQ 'R QRW FOHDQ \RXU JULGGOH LQ WKH GLVKZDVKHU ,I VRPHWKLQJ KDV VSLOOHG XQGHU WKH JULGGOH LW VKRXOG EH cleaned up as soon as possible to prevent "baked on" food soil. 'R QRW DOORZ JUHDVH WR DFFXPXODWH XQGHU WKH JULGGOH as it can be a fire hazard. Clean under the griddle with hot, soapy water as soon as it is cool. Positioning Your Griddle 7KH FDVWLURQ JULGGOH FDQ RQO\ EH XVHG RYHU WKH FHQWHU EXUQHUV RI WKH UDQJHWRS 7R SRVLWLRQ WKH JULGGOH UHPRYH WKH FHQWHU JUDWH LI SUHVHQW DQG UHSODFH LW ZLWK WKH JULGGOH 'R QRW WXUQ RQ WKH FHQWHU EXUQHUV XQWLO \RX DUH FHUWDLQ WKH griddle has been positioned correctly. Preheating Your Griddle :LWK D UHYHUVLEOH JULGGOH SUHKHDW \RXU JULGGOH E\ VHWWLQJ \RXU FHQWHU EXUQHU WR +L IRU PLQXWHV EHIRUH SODFLQJ IRRG RQ WKH JULGGOH 2QFH WKH JULGGOH LV SUHKHDWHG WXUQ WKH NQRE RQ WKH EXUQHUV WR WKH FRRN VHWWLQJ RXWOLQHG LQ WKH table. Preseasoned Reversible Cast-Iron Griddle Type of Food Cook Setting Bacon Med Breakfast Sausage Links Med Eggs Lo Grilled Cheese Med Hamburgers Med 3DQFDNHV Med Warming Tortillas Lo Cook settings may need to be reduced if the griddle is used for an extended time. Replace the center grate with the reversible cast iron griddle 49-2000781 Rev. 6 USING THE RANGE: Oven Controls Oven Controls 1 7 2 8 9 10 3 10 6 5 9 4 1. Traditional Cooking Modes: Your oven has the following traditional cooking modes: Bake, Broil and Warm. See the Oven Cooking Modes section for more information. 2. Convection Cooking Modes: Convection cooking mode uses increased air circulation to improve performance. See the Oven Cooking Modes section for more information. 3. Clean: Your oven has two cleaning modes: Self Clean and Steam Clean. See the Cleaning the Oven section for important information about using these modes. 4. Start/Enter: Must be pressed to start any cooking, cleaning, or timed function. NOTE: If your display and keys dim, opening the oven door or pressing any key will wake and illuminate the control. 5. Cancel/Off: Cancels ALL oven operations except the clock and timer. 6. Timer: :RUNVDVDFRXQWGRZQWLPHU3UHVVWKH Timer pad and use the number pads to program the WLPHLQKRXUVDQGPLQXWHV3UHVVWKHStart/Enter pad. The oven will continue to operate when the timer countdown is complete. To turn the timer off, press the Timer pad. 7. Air Fry: Air Fry cooking mode is designed to produce foods with a crispier exterior than traditional oven cooking. See the Oven Cooking Modes section for more information. 8. Oven Probe: Monitors internal food temperature and turns the oven off when the food reaches the programmed temperature. Insert the probe, press the desired cooking mode, and program the probe temperature. See the Cooking Modes Section for more information. The probe can only be used with Bake, Convection Bake, and Convection Roast. 9. Lock Controls: Locks out the control so that pressing the pads does not activate the controls. 3UHVVDQGKROGWKHLock Controls pad, for three seconds to lock or unlock the control. Cancel/Off is always active, even when the control is locked. 10. Cooking Options and Settings: The Cooking Options and Settings pads open up more detailed menus in the display that allow access to additional functions and cooking modes. For each you select the function in the display using the associated number pad. You can exit at any time by pressing the Cooking Options or Settings pad again. See the Settings, Cooking Options, and Cooking Modes Sections for more details. 11. Oven Light: Turns the oven light on or off. There is a control panel knob that controls the oven light. 49-2000781 Rev. 6 USING THE RANGE:&RRNLQJ2SWLRQV6HWWLQJV Cooking Options The Cooking Options pad opens up a menu of more cooking modes when the oven is off. It opens a menu with additional features if a cooking mode is already in process. You can exit the menu at any time by pressing the Cooking Options pad again. You must first select a mode (bake, convection bake, convection roast) and then select Cooking Options to get to the following functions. Cook Time Counts down cooking time and turns off the oven when the cooking time is complete. Select a desired cooking PRGH8VHWKHQXPEHUSDGVWRSURJUDPDEDNLQJ WHPSHUDWXUH3UHVVWKHCooking Options pad and select Cook Time8VHWKHQXPEHUSDGWRSURJUDPFRRNWLPH in hours and minutes. Then press Start/Enter. This can only be used with Bake, Convection Bake, Convection Roast and Air Fry. Delay Time 'HOD\VZKHQWKHRYHQZLOOWXUQRQ8VHWKLVWRVHWD time when you want the oven to start. Select a desired FRRNLQJPRGH8VHWKHQXPEHUSDGWRSURJUDPDEDNLQJ WHPSHUDWXUH3UHVVWKHCooking Options pad and select Delay Time8VHWKHQXPEHUSDGVWRSURJUDPWKHWLPHRI day for the oven to turn on, and then press Start/Enter. Delay Time is not available with all modes. NOTE: When using the Delay Time feature, foods that spoil easily such as milk, eggs, fish, stuffing, poultry, and pork should not be allowed to sit for more than KRXUEHIRUHRUDIWHUFRRNLQJ5RRPWHPSHUDWXUH promotes the growth of harmful bacteria. Be sure that the oven light is off because heat from the bulb will speed harmful bacteria growth. Settings The Cooking Options and Settings pads open up more detailed menus in the display that allow access to additional functions. For each you select the function in the display using the associated number pad. You can exit at any time by pressing the Cooking Options or Settings pad again. WiFi Connect and Remote Enable Your oven is designed to provide you with two-way communication between your appliance and smart device. By using the WiFi Connect features, you will be able to control essential oven operations such as temperature settings, timers and cooking modes using your smartphone or tablet.* Select Settings then Wifi - follow the instructions on your oven display and phone app. It is necessary to turn on WiFi before using Remote Enable on your oven. Connecting your WiFi Connect Enabled Oven What you will need Your GE Appliances oven uses your existing home WiFi network to communicate between the appliance and your smart device. In order to setup your GE Appliances oven, you will need to gather some information: (DFK*($SSOLDQFHVRYHQKDVDFRQQHFWHGDSSOLDQFH LQIRUPDWLRQODEHOWKDWLQFOXGHVDQ$SSOLDQFH83' ID. This is an important detail that you will need to connect to the appliance. The label is typically located inside the door of the oven or drawer. Connected Appliance Information Contains FCCID: ZKJ-WCATA009 UPD ID: XX-XX-XX-XX-XX-XX Contains IC: 10229A-WCATA009 MAC ID: D8-28-C9-XXXXXXXX PT. NO. XXXXXXXXXXXX Sample Label 2. Have your smart phone or tablet ready with the ability to access the internet and download apps. 3. You will need to know the password of your home WiFi router. Have this password ready while you are setting up your GE Appliances oven. Connect your GE Appliances oven 2Q\RXUVPDUWSKRQHRUWDEOHWYLVLW GEAppliances.com/connect to learn more about connected appliance features and to download the appropriate app. 2. Follow the app onscreen instructions to connect your GE Appliances oven. 3. Once the process is complete, the connection light located on your GE Appliances oven display will stay on solid and the app will confirm you are connected. * Compatible Apple or Android devices and home WiFi network required. 49-2000781 Rev. 6 USING THE RANGE: Settings Settings WiFi Connect and Remote Enable (cont.) Auto Conv (Auto Conversion) 4. If the connection light does not turn on or is blinking, follow the instructions on the app to reconnect. If issues continue, please call the Connected Call &HQWHUDQGDVNIRUDVVLVWDQFH regarding oven wireless connectivity. 7RFRQQHFWDGGLWLRQDOVPDUWGHYLFHVUHSHDWVWHSVDQG Note that any changes or modifications to the remote enable device installed on this oven that are not expressly approved by the manufacturer could void the user's authority to operate the equipment. REMOTE STARTING YOUR OVEN To be able to start the oven remotely once connected to WiFi, press the Remote Enable pad and the icon will turn on in the display. The oven can now be remotely started with a connected device. Opening an oven door or turning off the oven will turn off the icon. The icon must be lit to start the oven remotely. The icon is not required to change the oven temperature while it is running, set a timer or to turn the oven off from the phone app while the icon shows it is Wifi Connected. After using the oven, remember to verify that the icon is lit if you wish to start the oven remotely in the future. NOTE: )RRGVWKDWVSRLOHDVLO\²VXFKDVPLONHJJVILVK VWXIILQJVSRXOWU\DQGSRUN²VKRXOGQRWEHDOORZHGWR VLWIRUPRUHWKDQKRXUEHIRUHRUDIWHUFRRNLQJ5RRP temperature promotes the growth of harmful bacteria. Be sure that the oven light is off because heat from the bulb will speed harmful bacteria growth. Clock 7KLVVHWWLQJVHWVWKHRYHQFORFNWLPH3UHVVWKHSettings pad and select Clock. Select Set Clock and follow the instructions to set the clock. This feature also specifies how the time of day will be displayed. You can select a VWDQGDUGKRXUFORFN+KRXUPLOLWDU\WLPHGLVSOD\ +RUQRFORFNGLVSOD\HG2II3UHVVWKHSettings pad, select Set Clock and select either 12/24 hr or On/Off. Bluetooth® - Chef Connect When using Convection Bake and Convection Roast cooking, Auto Recipe Conversion will automatically convert the regular baking temperatures entered to convection bake cooking temperatures when turned on. Note that this option does not convert convection bake cooking times, it only converts temperatures. This feature may be turned On or Off. Select Settings and Auto Conversion, then follow the prompts to turn this feature on or off. Auto Off 7KLVIHDWXUHVKXWVWKHRYHQGRZQDIWHUKRXUVRI continuous operation. It may be enabled or disabled. Select Settings, More, and Auto Off to turn this feature on or off. Sound You can adjust the volume and type of alert your appliance uses. Select Settings, More, and Sound. Follow prompts for making volume adjustments or for changing between continuous and single alert tones. A continuous setting will continue to sound a tone until a button on the control is pressed. The oven tone volume can be adjusted. The control will sound the oven tone at the new volume level each time the sound level is changed. F/C (Fahrenheit or Celsius) The oven control is set to use Fahrenheit temperatures )EXW\RXFDQFKDQJHLWWRXVH&HOVLXVWHPSHUDWXUHV &6HOHFWSettings, More, and F/C to alter between temperature scales displayed. Adjust the Oven temperature This feature allows the oven baking and convection baking temperature to be adjusted up to 35ºF hotter RUGRZQWR)FRROHU8VHWKLVIHDWXUHLI\RXEHOLHYH your oven temperature is too hot or too cold and wish to change it. This adjustment affects Bake and Convection %DNHPRGHV'RHVQRWFKDQJH3URRIRU&OHDQLQJPRGHV Select Settings and Oven Adjust to add More Heat or Less Heat and then press Save. This is a pairing feature for use with other compatible Chef Connect enabled products like an over-therange microwave oven or range hood. To pair those SURGXFWVWRWKHUDQJH3UHVVWKHSettings pad and select Bluetooth®. Select Pair and follow the corresponding instructions included with the mating Chef Connect enabled product. The range will cancel pairing mode after two minutes if no mating device is detected. Select Remove to confirm product is paired or to un-pair from UDQJH7KH3UHFLVLRQ&RRNLQJ3UREHFDQDOVREHSDLUHG using the Bluetooth® feature. Oven Info Select Settings, More, and Oven Info to turn this feature on or off. This setting displays Model Number and 6RIWZDUH9HUVLRQ 49-2000781 Rev. 6 USING THE RANGE: Sabbath Mode Sabbath Mode 7KH 6DEEDWK PRGH LQFOXGHV WKH GLVDEOLQJ RI WRQHV GLVDEOLQJ RI RYHQ OLJKWV DQG GHOD\V RI DERXW VHFRQGV WR RQH minute on display changes. Only continuous baking or timed baking is allowed in the Sabbath mode. Cooking in the Sabbath mode is a two-step process; first the Sabbath mode must be set and then the bake mode must be set. Setting the Sabbath Mode 3UHVV WKH Settings pad, select Sabbath, and select Turn on. A single bracket "]" will appear in the display indicating that the Sabbath mode is set. The clock will not be displayed. Continuous bake or timed bake can now be programmed. Starting a Continuous Bake 3UHVV WKH Bake SDG )RU GRXEOH RYHQV WKLV RSHUDWHV the upper oven. If desiring to use Lower Oven, press Lower Oven and then Bake ,I WKH GHVLUHG WHPSHUDWXUH LV ) SUHVV Start/ Enter. If a different cooking temperature is desired, use the 1 through 5 number pads to select a preset cooking temperature, then press Start/Enter. Refer to the graphic below to determine which pad sets the desired cooking temperature. After a delay, a second bracket "] [" will appear in the display indicating that the oven is baking. 7HPSHUDWXUH ) 7LPH KRXUV 325 2h 2.5h 3h 3.5h Adjusting the Temperature 3UHVV Bake (or press Lower Oven and then Bake for ORZHU RYHQ LQ D GRXEOH RYHQ XQLW XVH WKH 1 through 5 number pads to select a different preset cooking temperature, and press Start/Enter. 2. Since no feedback is given during temperature change, an oven thermometer can be used to confirm temperature changes. Starting a Timed Bake 3UHVV WKH Bake pad. ,I WKH GHVLUHG WHPSHUDWXUH LV ) XVH WKH 6 through 0 number pads to select a cooking time. If a cooking WHPSHUDWXUH RWKHU WKDQ ) LV GHVLUHG XVH WKH 1 through 5 number pads to select a preset cooking temperature, then select the cooking time. Refer to the graphic on this page to determine which pad sets the desired cooking temperature and cooking time. 3UHVV Start/Enter. After a delay, a second bracket "] [" will appear in the display indicating that the oven is baking. When the cook time expires, the display will change back to a single bracket "]" indicating that the oven is no longer baking. No tone will sound when the cook time is complete. Exit the Sabbath Mode Exiting the Sabbath mode should be done after the Sabbath is over. 3UHVV Cancel/Off to end any bake mode that may be running. 3UHVV DQG KROG Settings pad until Sabbath Mode off is displayed. 4h ) ) ) ) ) Sabbath Mode Power Outage Note If a power outage occurs while the oven is in Sabbath Mode, the unit will return to Sabbath Mode when power is restored, however the oven will return to the off state even if it was in the middle of a bake cycle when the power outage occurred. KRXUV KRXUV KRXUV KRXUV KRXUV 49-2000781 Rev. 6 USING THE RANGE:2YHQ5DFNV$OXPLQXP)RLO&RRNZDUH Oven Racks Recommended rack positions for various types of foods are provided in the Cooking Guide. Adjusting rack position is one way to impact cooking results. For example, if you would prefer darker tops on cakes, muffins, or cookies, try moving food one rack position higher. If you find foods are too brown on top try moving them down next time. When baking with multiple pans and on multiple racks, HQVXUHWKHUHLVDWOHDVWòEHWZHHQSDQVWRDOORZ sufficient space for air to flow. <RXU2YHQPD\KDYHH[WHQVLRQUDFNVDQGRUWUDGLWLRQDO flat racks. To avoid possible burns, place the racks in the desired position before you turn the oven on. Removing and Replacing Flat Racks When placing and removing cookware, pull the rack out WRWKHEXPSVWRSSRVLWLRQRQWKHUDFNVXSSRUW To remove a rack, pull it toward you until it reaches the stop position, tilt up the front of the rack and pull it out. To replace a rack, place the curved end of the rack onto the rack supports. Tilt up the front of the rack and push the rack in until it stops. Then lay the rack flat and push it in until it is all the way into the oven. Racks may become difficult to slide, especially after a self-clean cycle. To improve sliding conditions, use a soft cloth or paper towel to rub vegetable oil on the left and ULJKWHGJHVRIWKHUDFNVDQGRUUDFNVXSSRUWV NOTE: Remove unused racks when using the oven for faster preheat, improved efficiency, and optimal cooking performance. The number of rack positions may vary by model. Rack stop position Removing racks Replacing racks Aluminum Foil and Oven Liners CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of these items is not covered by the product warranty. Foil may be used to catch spills by placing a sheet on a lower rack, several inches below the food. Do not use more IRLOWKDQQHFHVVDU\DQGQHYHUHQWLUHO\FRYHUDQRYHQUDFNZLWKDOXPLQXPIRLO.HHSIRLODWOHDVW´IURPRYHQZDOOV to prevent poor heat circulation. 49-2000781 Rev. 6 USING THE RANGE: Oven Cooking Modes Oven Cooking Modes Your new oven has a variety of cooking modes to help you get the best results. These modes are described below. Refer to the Cooking Guide section for rack position and other recommendations for specific modes and foods. Bake The traditional bake mode is intended for single rack cooking. This mode uses heat primarily from the lower element but also from the upper element to cook food. 3UHKHDWLQJLVJHQHUDOO\UHFRPPHQGHGZKHQXVLQJWKLV mode. To use this mode press the Bake pad, enter a temperature with the number pads, and then press Start/ Enter. Convection Bake Multi Rack The Convection Bake Multi Rack mode is intended for baking on multiple racks at the same time. This mode uses heat primarily from the rear element but also heat from the upper and lower elements, along with air movement from the convection fan to enhance cooking evenness. Your oven is equipped with Auto Recipe Conversion, so it is not necessary to convert the temperature when using this mode. Baking time might be slightly longer for multiple racks than what would be expected for a single rack. To use this mode press the Conv Bake pad, enter a temperature with number pads, and then press Start/Enter. 3UHVVWKHBroil pad twice for High or once for Low depending on the amount of searing and the internal temperature that is preferred. The High setting is best for WKLQQHUFXWVRIPHDWDQGRUIRRGV\RXSUHIHUOHVVGRQH on the interior. The Low setting is preferred for thicker cuts of meat and foods you liket o be cooked all the way through. It is not necessary to preheat the oven for these modes. Then press Start/Enter. Air Fry Air Fry is a special, no-preheat, cooking mode that is designed to produce foods with a crispier exterior than traditional oven cooking. The Air Fry mode is intended IRUVLQJOHUDFNFRRNLQJRQO\3UHVVWKHAir Fry pad, then input the desired set temperature and press 6WDUW7KHWHPSHUDWXUHFDQEHVHWEHWZHHQ)DQG )3UHKHDWLQJLVQRWUHFRPPHQGHGIRUWKLVPRGH Follow traditional oven recipe or package guidelines for set temperatures and cook times; adjust cook time to achieve your desired crispness. Additional guidelines for using this mode can be found in the Cooking Guide. Baked Goods Convection Roast This mode is intended for roasting whole cuts of meat on a single rack. The utilization of all three elements and direct airflow down from the top of the oven improves browning and reduces cooking time. Check food earlier than the recipe suggests or use the probe when using this mode. To use this mode press the Conv Roast pad, enter a temperature with the number pads, and then press Start/ Enter. Broiling Modes Always broil with the door closed. The broil element in this oven is very powerful. Monitor food closely while EURLOLQJ8VHFDXWLRQZKHQEURLOLQJRQXSSHUUDFN positions as placing food closer to the broil element increases smoking, spattering, and the possibility of fats igniting. Broiling on rack position 6 is not recommended. Broiling can be used for foods that would typically be grilled. Adjust the rack position in order to vary the intensity RIWKHKHDWWRWKHIRRG3ODFHIRRGVFORVHUWRWKHEURLO element when a seared surface and rare interior are desired. For best performance center the food below the broil heating element. The Baked Goods mode is designed for cooking cakes, breads, cookies, and similar foods on a single rack. This mode is designed to provide lighter top browning and better volume. Some foods may require slightly longer cook times relative to when cooked in the traditional bake PRGH3UHVVCooking Options and select Baked Goods than follow any display prompts to access this mode. Frozen Snacks The Frozen Snacks modes are designed to cook frozen foods such as potato nuggets, French fries, and similar frozen snacks and appetizers. Most foods will cook within package recommended time. Adjust cooking time DFFRUGLQJWRLQGLYLGXDOSUHIHUHQFHV3UHVVCooking Options and select Frozen then follow any display prompts to access this mode. 8VH)UR]HQ6QDFNV6LQJOHZKHQFRRNLQJIUR]HQVQDFNV on a single rack. This mode does not require preheating the oven. Food should be placed in the oven before or immediately upon starting this mode. 8VH)UR]HQ6QDFNV0XOWLZKHQFRRNLQJIUR]HQVQDFNV on two racks simultaneously. This mode includes a preheating cycle to prepare the oven for multi-rack baking. 49-2000781 Rev. 6 USING THE RANGE:&RRNLQJ0RGHV2YHQ$LU9HQWV2YHQ&RRNLQJ*XLGH Cooking Modes (Cont.) Frozen Pizza 7KH)UR]HQ3L]]DPRGHVDUHGHVLJQHGWRFRRN frozen pizzas. Most pizzas will cook within package recommended times. Adjust cooking time according to LQGLYLGXDOSUHIHUHQFHV3UHVVCooking Options and select Frozen then follow any display prompts to access this mode. 8VH)UR]HQ3L]]D6LQJOHZKHQFRRNLQJRQDVLQJOHUDFN This mode does not require preheating the oven. Food should be placed in the oven before or immediately upon starting this mode. 8VH)UR]HQ3L]]D0XOWLZKHQFRRNLQJRQWZRUDFNV simultaneously. This mode includes a preheating cycle to prepare the oven for multi-rack baking. Warm Warm mode is designed to keep hot foods at a higher WHPSHUDWXUHIRUXSWRKRXUV3UHKHDWLQJLVQRWUHTXLUHG Do not use warm to heat cold food other than crisping crackers, chips, or dry cereal. It is also recommended WKDWIRRGQRWEHNHSWZDUPIRUPRUHWKDQKRXUV3UHVV the Warm pad and then press Start/Enter. Proof 3URRIPRGHLVGHVLJQHGIRUULVLQJIHUPHQWLQJDQG SURRILQJEUHDGGRXJKV&RYHUGRXJKZHOOWRSUHYHQW drying out. Bread will rise more rapidly than at room temperature. NOTE:'RQRWXVHWKH3URRIPRGHIRU warming food or keeping food hot. The proofing oven temperature is not hot enough to hold foods at safe WHPSHUDWXUHV3UHVVCooking Options and select Proof then follow any display prompts or press the Proof pad RQVRPHPRGHOVWRDFFHVVWKLVPRGH Oven Air Vents 1HYHUEORFNWKHYHQWVDLURSHQLQJVRIWKHUDQJH7KH\ provide the air inlet and outlet that are necessary for the range to keep cool and operate properly with correct combustion. Air openings are located at the rear of the cooktop, at the top and bottom of the oven door, and at the bottom of the range. 9HQWDSSHDUDQFHDQGORFDWLRQYDU\ Oven Probe WARNING Consuming undercooked food can result in foodborne illness. Use probe according to the following instructions to ensure all portions of the food reach minimum safe cooking temperatures. Recommendations for minimum safe food temperatures can be found at foodsafety.gov or IsItDoneYet.gov. Internal food temperature is frequently used as an indicator of doneness, especially for roasts and poultry. 7KH3UREHPRGHPRQLWRUVWKHLQWHUQDOIRRGWHPSHUDWXUH and turns the oven off when the internal food temperature reaches the programmed temperature. Always check the temperature at multiple locations in the food with a food thermometer after cooking to ensure that all portions of the food have reached the minimum safe internal temperature for that food. Proper Probe Placement After preparing the meat and placing it on the cooking pan follow these instructions for proper probe placement. ,QVHUWWKHSUREHLQWRWKHIRRGVRWKDWWKHWLSRIWKH probe will rest in the center of the thickest part of the food. For best performance the probe should be fully inserted into the food. If the probe is not located properly, it may not accurately measure the temperature of the coolest portion of the food. Some foods, particularly small items, are not well suited for cooking with the probe due to their shape or size. 7KHSUREHVKRXOGQRWWRXFKERQHIDWRUJULVWOH )RUZKROHSRXOWU\LQVHUWWKHSUREHLQWRWKHWKLFNHVW part of the breast. )RUERQHOHVVURDVWVLQVHUWWKHSUREHLQWRWKHFHQWHU of the roast. )RUERQHLQKDPRUODPELQVHUWWKHSUREHLQWRWKH center of the lowest large muscle or joint. )RUFDVVHUROHVRUGLVKHVVXFKDVPHDWORDILQVHUWWKH probe into the center of the dish. )RUILVKLQVHUWWKHSUREHIURPMXVWDERYHWKHJLOOLQWR the meatiest area, parallel to the backbone. 49-2000781 Rev. 6 USING THE RANGE:2YHQ3UREH2YHQ&RRNLQJ*XLGH Oven Probe (Cont.) Probe Usage The temperature probe can only be used with Bake, Convection Bake, and Convection Roast. To use the probe with preheating: 6HOHFWWKHGHVLUHGFRRNPRGHBake, Convection Bake, or Convection RoastSDGDQGHQWHUWKH desired cooking temperature with the number pads. ,QVHUWWKHSUREHLQWRWKHIRRGVHH3URSHU3UREH 3ODFHPHQW 3. Once the oven is preheated, place the food in the oven and connect the probe to the probe outlet, PDNLQJVXUHLWLVIXOO\LQVHUWHG8VHFDXWLRQWKHRYHQ walls and probe outlet are hot. 4. When the probe is connected, the display will prompt you to enter the desired food temperature. The maximum internal food temperature that you can set LV) 8VHRISUREHVRWKHUWKDQWKHRQHSURYLGHGZLWKWKLV product may result in damage to the probe outlet. 8VHWKHKDQGOHVRIWKHSUREHDQGSOXJZKHQLQVHUWLQJ and removing them from the meat and outlet 7RDYRLGGDPDJLQJ\RXUSUREHGRQRWXVHWRQJVWR pull on the cable when removing it. 7RDYRLGEUHDNLQJWKHSUREHPDNHVXUHIRRGLV completely defrosted before inserting the probe. 7RSUHYHQWSRVVLEOHEXUQVGRQRWXQSOXJWKHSUREH from the outlet until the oven has cooled. 1HYHUOHDYHWKHSUREHLQVLGHWKHRYHQGXULQJDVHOIRU steam clean cycle. 'RQRWVWRUHWKHSUREHLQWKHRYHQ To use the probe without preheating: ,QVHUWWKHSUREHLQWRWKHIRRGVHH3URSHU3UREH 3ODFHPHQW 3ODFHWKHIRRGLQWKHRYHQDQGFRQQHFWWKHSUREHLQWR the probe outlet in the oven. 3UHVVWKHCook ModeSDGTraditional Bake, Convection Bake, or Convection RoastDQGHQWHU the desired cooking temperature with the number pads. Select the Probe pad then follow the display prompts to enter the desired food temperature. Probe Care Guidelines Oven Cooking Guide Cook food thoroughly to help protect against food borne illness. Minimum safe food temperature recommendations for food safety can be found at IsItDoneYet.gov8VHDIRRGWKHUPRPHWHUWRPHDVXUHIRRGWHPSHUDWXUHV Oven Cookware Guidelines The material, finish, and size of cookware affect baking performance. Dark, coated and dull pans absorb heat more readily WKDQOLJKWVKLQ\SDQV3DQVWKDWDEVRUEKHDWPRUH readily can result in a browner, crisper, and thicker crust. If using dark and coated cookware check food earlier than minimum cook time. If undesirable results are obtained with this type of cookware consider reducing RYHQWHPSHUDWXUHE\)QH[WWLPH Shiny pans can produce more evenly cooked baked goods such as cakes and cookies. Glass and ceramic pans heat slowly but retain heat well. These types of pans work well for dishes such as pies and custards. Air insulated pans heat slowly and can reduce bottom browning. Keep cookware clean to promote even heating. Stoneware heats slowly and retains heat well. It is recommended to preheat this type of cookware if possible. Additional cook time may be required. Cookware used in broil modes and air fry must be broilsafe. 49-2000781 Rev. 6 USING THE RANGE: Oven Cooking Guide Oven Cooking Guide FOOD TYPE Baked Goods Layer cakes, sheet cakes, bundt cakes, muffins, quick breads on a Single Rack Layer cakes* on Multiple Racks &KLIIRQFDNHVDQJHOIRRG Cookies, biscuits, scones on a Single Rack Cookies, biscuits, scones on Multiple Racks Yeast Breads Beef & Pork Hamburgers RECOMMENDED MODE(S) Bake Bake Goods Bake Convection Bake Bake Bake Goods Bake Bake Goods Convection Bake 3URRI Bake Bake Goods Broil High RECOMMENDED RACK POSITION(S) 3 3 flat and 5 flat 4 3 flat and 5 flat 2 ext, 4 flat, 6 flat 3 or 4 3 or 4 6 flat Steaks & Chops Roasts Poultry Whole chicken Bone-in chicken breasts, legs, thighs Boneless chicken breasts Whole turkey Turkey Breast Fish Casseroles Frozen Convenience Foods 3L]]DRQD6LQJOH5DFN 3L]]DRQ0XOWLSOH5DFNV 3RWDWRSURGXFWVFKLFNHQ nuggets, appetizers on a Single Rack 3RWDWRSURGXFWVFKLFNHQ nuggets, appetizers on Multiple Racks Broil High Bake Convection Roast Bake Convection Roast Broil Low Bake Broil Low Bake Bake Convection Roast Bake Convection Roast Broil Low Bake )UR]HQ3L]]D6LQJOH )UR]HQ3L]]D0XOWL Frozen Snacks Single Frozen Snacks Multi 6 flat or 5 ext 2 or 3 2 or 3 3 3 3 LQFKWKLFNRUOHVV !LQFK 3 or 4 4 3 and 5 4 3 and 5 *When baking four cake layers at a time use racks DQG3ODFHWKHSDQVDVVKRZQVRWKDWRQHSDQLVQRW directly above another. Cook food thoroughly to help protect against food borne illness. Minimum safe food temperature recommendations for food safety can be found at IsItDoneYet.gov. Make sure to use a food thermometer to take food temperatures. 49-2000781 Rev. 6 ADDITIONAL SUGGESTIONS 8VHVKLQ\FRRNZDUH 8VHVKLQ\FRRNZDUH(QVXUHDGHTXDWHDLUIORZVHHLOOXVWUDWLRQEHORZ 8VHVKLQ\FRRNZDUH 8VHVKLQ\FRRNZDUH 8VHVKLQ\FRRNZDUH(QVXUHDGHTXDWHDLUIORZ Cover dough loosely. 8VHDEURLOSDQPRYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ Watch food closely when broiling. For best performance center food below the broil heater. 8VHDEURLOSDQPRYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ Watch food closely when broiling. For best performance center food below the broil heater. 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ3UHKHDWLQJLVQRWQHFHVVDU\ 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ3UHKHDWLQJLVQRWQHFHVVDU\ If breaded or coated in sauce avoid Broil High modes. Broil skin side down first. Watch food closely when broiling. For best performance when broiling, center food below the broil heater. 0RYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJDQGXSIRUJUHDWHU VHDULQJEURZQLQJZKHQEURLOLQJ)RUEHVWSHUIRUPDQFHZKHQEURLOLQJ center food below the broil element or burner. 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ3UHKHDWLQJLVQRWQHFHVVDU\ 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ3UHKHDWLQJLVQRWQHFHVVDU\ Watch food closely when broiling. For best performance center food below the broil heater. 3ODFHIRRGLQRYHQSULRUWRVWDUWLQJPRGH Stagger pizzas left to right, do not place directly over each other. 3ODFHIRRGLQRYHQSULRUWRVWDUWLQJPRGH8VHGDUNFRRNZDUHIRUPRUH EURZQLQJFULVSLQJXVHVKLQ\FRRNZDUHIRUOHVVEURZQLQJ 8VHGDUNFRRNZDUHIRUPRUHEURZQLQJFULVSLQJXVHVKLQ\FRRNZDUH for less browning. 5HDU3ODFHPHQW )URQW3ODFHPHQW Rack positions USING THE RANGE: Oven Cooking Guide Oven Cooking Guide Air Fry Cooking Guide Air Fry is a special, no-preheat, cooking mode that is designed to produce foods with a crispier exterior than WUDGLWLRQDO RYHQ FRRNLQJ 3UHVV WKH Air Fry pad, then input the desired set temperature and press Start. The WHPSHUDWXUH FDQ EH VHW EHWZHHQ ) DQG ) Air Fry Cookware Guidelines · Only use broil safe cookware when using Air Fry mode. · A dark sheet pan is recommended. A dark pan promotes better browning and crisping. · Oven baking baskets and baking grids can also be used. A sheet pan should be placed on the rack below the foods to catch any drippings when using a baking basket. 3ULPDU\ UHFRPPHQGHG FRRNZDUH General Tips for Air Fry Mode · The Air Fry mode is designed for cooking on a single rack. · The Air Fry mode is designed to be used without preheating. 5DFN SRVLWLRQ LV UHFRPPHQGHG IRU PRVW IRRGV 8VH rack position 3 for thicker foods. · Foods may cook faster than expected if the oven is already hot when food is placed in the oven. · When air frying foods with sauce, it is recommended to apply the sauce at the end of cooking. · If foods are browning too quickly, try a lower rack position or lower oven set temperature. · For packaged foods, use traditional oven cooking instructions for set temperature and expected cook time. · It is not necessary to flip or stir food during cooking · Arrange food in a single layer on the pan, do not overload the pan. · Always check internal food temperature to confirm minimum safe temperatures have been reached. Minimum safe food temperatures can be found on packages and at IsItDoneYet.gov. Alternate cookware options FOOD TYPE Fresh boneless fish or poultry pieces, breaded such as nuggets, tenders, fillets Fresh bone in chicken wings Fresh bone in chicken drumsticks or thighs Fresh French fries, WKLQ ò LQFK Fresh French fries, WKLFN ! ò LQFK Frozen packaged foods RECOMMENDED RACK POSITION(S) 4 4 3 or 4 4 3 or 4 3 or 4 XVH UDFN SRVLWLRQ IRU WKLFNHU IRRGV RECOMMENDED RECOMMENDED SET TEMPERATURES (F) COOK TIME (MIN) NOTES 8VHU ORZHU VHW WHPSHUDWXUHV IRU ODUJHU SLHFHV 8VH VKLQ\ FRRNZDUH Salt wings or coat in a dry rub, if using sauce apply after cooking or toward the end of cooking 8VHU ORZHU VHW WHPSHUDWXUHV IRU ODUJHU SLHFHV 3DUFKPHQW SDSHU LV UHFRPPHQGHG ZKHQ preparing fresh French fries. For crispier fries, toss fries in corn starch or rice flour before cooking. 3DUFKPHQW SDSHU LV UHFRPPHQGHG ZKHQ preparing fresh French fries. For crispier fries, toss fries in corn starch or rice flour before cooking. 8VH WUDGLWLRQDO RYHQQRW $LU )U\ FRRNLQJ LQVWUXFWLRQV DV D JXLGHOLQH IRU VHW WHPSHUDWXUH DQG FRRN WLPH$GGLWLRQDO cook time beyond recommended package time may be required for some foods. If oven is hot when starting, food may cook faster than the minimum package time. 49-2000781 Rev. 6 CARE AND CLEANING: Range Exterior Range Exterior Be sure all controls are off and all surfaces are cool before cleaning any part of the range. WARNING If your range is removed for cleaning, servicing or any reason, be sure the anti-tip device is reengaged properly when the range is replaced. Failure to take this precaution could result in tipping of the range and can result in death or serious burns to children or adults. Control Lockout If desired, the touch pads may be deactivated before cleaning. See Lock Controls in the Oven Controls section in this manual. Clean up splatters with a damp cloth. You may also use a glass cleaner. Remove heavier soil with warm, soapy water. Do not use abrasives of any kind. Reactivate the touch pads after cleaning. Control Panel It's a good idea to wipe the control panel after each use. Clean with mild soap and water or vinegar and water, rinse with clean water and polish dry with a soft cloth. Do not use abrasive cleansers, strong liquid cleansers, plastic scouring pads or oven cleaners on the control SDQHO²WKH\ZLOOGDPDJHWKHILQLVKLQFOXGLQJ%ODFN Stainless Steel. Oven Exterior Do not use oven cleaners, abrasive cleansers, strong liquid cleansers, steel wool, plastic scouring pads, or cleaning powders on the interior or exterior of the oven. Clean with a mild soap and water or vinegar and water solution. Rinse with clean water and dry with a soft cloth. When cleaning surfaces, make sure that they are at room temperature and not in direct sunlight. If stain on the door vent trim is persistent, use a mild abrasive cleaner and a sponge-scrubber for best results. Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration and should be wiped up immediately. Let hot surfaces cool, then clean and rinse. Painted Surfaces 3DLQWHGVXUIDFHVLQFOXGHWKHVLGHVRIWKHUDQJHDQGWKH door, top of control panel and the drawer front. Clean these with soap and water or a vinegar and water solution. Do not use commercial oven cleaners, cleaning powders, steel wool or harsh abrasives on any painted surface, including Black Stainless Steel. Stainless Steel excluding Black Stainless Steel (on some models) Do not use a steel wool pad; it will scratch the surface. Cleaners with oxalic acid such as Bar Keepers Friend 6RIW&OHDQVHUZLOOUHPRYHVXUIDFHUXVWWDUQLVKDQG VPDOOEOHPLVKHV8VHRQO\DOLTXLGFOHDQVHUIUHHRIJULW and rub in the direction of the brush lines with a damp, soft sponge. To clean the stainless steel surface, use warm sudsy water or a stainless steel cleaner or polish. Always wipe the surface in the direction of the grain. Follow the cleaner instructions for cleaning the stainless steel surface. To inquire about purchasing cleaning products including stainless steel appliance cleaner or polish, see the Accessories and Consumer Support sections at the end of this manual. 49-2000781 Rev. 6 CARE AND CLEANING: Range Interior Range Interior The interior of your new oven can be cleaned manually or by using Steam Clean or Self Clean modes. Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration and should be wiped up immediately. Let hot surfaces cool, then clean and rinse. Manual Cleaning Do not use oven cleaners, strong liquid cleansers, steel wool, or scouring pads on the interior of the oven. For soils on the oven bottom and other enameled surfaces, use a gentle abrasive containing oxalic acid, such as Bar Keepers Friend®, with a non-scratch sponge. Take care not to apply any abrasive cleaners or sponges to the door glass, as it will scratch the reflective coating. The oven interior and door glass may be cleaned using a soft cloth with a mild soap and water, or vinegar and water solution. After cleaning, rinse with clean water and dry with a soft cloth. Steam Clean Mode The Steam Clean feature is for cleaning light soil from your oven at a lower temperature than Self Clean. To use the Steam Clean feature: 6WDUWZLWKWKHRYHQDWURRPWHPSHUDWXUH 2. Wipe excess grease and soils from the oven. 3RXURQHFXSRIZDWHURQWRWKHERWWRPRIWKHRYHQ 4. Close the door. 3 UHVVWKHClean pad, select Steam Clean and then press Start/Enter. 'RQRWRSHQWKHGRRUGXULQJWKHPLQXWH6WHDP&OHDQ cycle. At the end of the Steam Clean cycle, soak up the remaining water, and wipe the moisture-softened soil from the oven walls and door. Self Clean Mode Read Self-Cleaning Oven Safety Instructions at the beginning of this manual before using the Self Clean Mode. Self Clean uses very high temperatures to clean the oven interior. For a moderately soiled oven, run a 3 hour self-clean cycle. For a heavily soiled oven, run DKRXUVHOIFOHDQF\FOH2QO\VHOIFOHDQEODFNUDFNV and grates may remain in the oven during the self-clean F\FOH$OORWKHULWHPVLQFOXGLQJQLFNHOSODWHGVLOYHUUDFNV VKRXOGEHUHPRYHG,IQLFNHOSODWHGVLOYHUUDFNVDUHOHIW in the oven during a self-clean cycle, the racks will tarnish. If either type of rack is left in the oven during a self-clean cycle, the rack may become difficult to slide. See the Oven Racks section for instructions on how to improve. IMPORTANT: The health of some birds is extremely sensitive to the fumes given off during the self-cleaning cycle of any range. Move birds to another wellventilated room. To use the Self Clean feature: 6WDUWZLWKWKHRYHQDWURRPWHPSHUDWXUH 2. Wipe excess grease and soils from the oven and interior door. 5 HPRYHDOOLWHPVRWKHUWKDQVHOIFOHDQEODFN racks and grates, if desired. See Cleaning the Cooktop to determine if your grates may be selfcleaned and for important details regarding grate placement. 4. Close the door. 3 UHVVWKHClean pad, select Self Clean and then press Start/Enter. You cannot open the door during the self-clean cycle. The door will remain locked after the self-clean cycle until the oven cools below the unlocking temperature. At the end of the self-clean cycle, allow the oven to cool and wipe any ash out of the oven. Racks All racks can be washed with warm, soapy water. (QDPHOHGQRWVKLQ\UDFNVFDQEHOHIWLQWKHFDYLW\ during self clean. Racks may be more difficult to slide, especially after DVHOIFOHDQ3XWVRPHYHJHWDEOHRLORQDVRIWFORWKRU paper towel and rub onto the left and right edges. 22 49-2000781 Rev. 6 CARE AND CLEANING: Cooktop Cooktop Removal of Surface Burners for Cleaning Turn all controls OFF. Allow cooktop to cool before removing grates and burner parts. When removing the burner caps and heads, remember their size and location. Replace them in the same location after cleaning. CAUTION Do not attempt to remove oval or dual oval burner caps from the burner heads. Round Burner Cap 5HPRYDEOH Inner Burner Cap 5HPRYDEOH Round Burner Cap 5HPRYDEOH Round Burner Head Electrode Outer Burner Cap 5HPRYDEOH Round Burner Head Electrode Round Burner Multi-Ring Burner (on some models) Dual Oval Burner Caps 1RQ5HPRYDEOH Dual Oval Burner Cleaning the Surface Burners Cleaning the Burner Caps Wash burner caps in hot, soapy water and rinse with clean water. You may scour with a plastic scouring pad to remove burned-on food particles. The round burner caps may also be cleaned in your dishwasher. Cleaning the Burner Heads Wash the burner heads routinely, especially after bad spillovers which could clog the burner openings. Lift burners off when cool. Wash with hot, soapy water. Rinse with clean water. For more stubborn stains, use a brush with plastic bristles. NOTE: Do not use steel wool or scouring pads to clean the burner parts as these may clog the openings. Never wash burner heads in your dishwasher as dishwasher. Doing so may cause them to discolor. The ports in the burner heads must be kept clean at all times for an even, unhampered flame. Clogged or dirty burner ports or electrodes will not allow the burner to operate properly. Replacing Surface Burners Before replacingWKHEXUQHUFDSVKHDGVDQGRYDOKHDG cap assembly, shake out excess water and allow them to dry thoroughly. Replace burner heads in the correct locations according to size. Ensure each cap is properly seated on the burner head, as pictured below. CAUTION Do not operate the cooktop without all burner parts and grates in place. Any spill on or around an electrode must be carefully cleaned. Avoid hitting the electrode with anything hard or it could be damaged. Electrode The electrode of the spark igniter is exposed when the burner head is removed. When one burner is turned to LITE, all the burners spark. Do not attempt to disassemble or clean around any burner while another burner is on. Burner cap is NOT properly seated. Burner cap is NOT properly seated. Burner cap is properly seated. 49-2000781 Rev. 6 23 CARE AND CLEANING: Cooktop Cooktop (Cont.) Burner Grates Manual Cleaning Grates should be washed in hot, soapy water and rinsed with clean water. To soften burned-on food, place grates in a solution containing ¼-cup of household ammonia for several hours. Afterward, scrub grates with a plastic scouring pad soaked in hot, soapy water. Rinse well and dry. Self Clean Mode (on some models) If your grates do not have rubber bumpers on their bottom surface, they may be cleaned in the oven using the self-clean cycle. Do not attempt to clean your grates in the oven if your grates have rubber bumpers. Doing so will destroy the rubber bumpers and may affect the function of your surface burners. 3RUFHODLQFRDWHGJUDWHVPD\JUDGXDOO\GXOOLIFRQWLQXDOO\ exposed to self-clean temperatures. ,I\RXURYHQLVHTXLSSHGZLWKVHOIFOHDQEODFNUDFNV it is recommended to follow the instructions for placing grates on racks. If your oven is equipped with nickelSODWHGVLOYHUUDFNVLWLVUHFRPPHQGHGWRIROORZWKH instructions for placing grates on the oven bottom. Nickel-plated racks should not remain in the oven during the self clean cycle. Doing so will tarnish the racks. If either type of rack is left in the oven during a self-clean cycle, the rack may become difficult to slide. NOTE: When placing or removing grates from the oven, do not slide the grates on the racks or oven bottom. Doing so could damage the enamel on the racks or oven bottom. To self-clean your grates on self-clean racks: ,QVHUWUDFNVLQSRVLWLRQVDQGRUSRVLWLRQVDQG 2. Gently place one grate on each rack. To self clean your grates on the oven bottom: 5HPRYHDOORYHQUDFNV 2. Gently place one grate on the center of the oven bottom with the grate oriented in the upright position. 6WDFNUHPDLQLQJJUDWHVDVVKRZQEHORZ'RQRW place or stack grates in any other configuration. Once the grates are placed in the oven, operate the selfclean cycle per the instruction in the Cleaning the Oven section. NOTE:8VHFDXWLRQZKHQUHPRYLQJWKHJUDWHVIURPWKH oven after the self-clean cycle has ended. The grates may still be hot. Once the self-clean cycle is complete, the grates may carefully be removed. You may notice a white residue on the grates. Wipe it off with a damp sponge. If white spots SHUVLVWZHWWKHVSRQJHZLWKDVROXWLRQRIYLQHJDU and water and wipe the grates again. When replacing the grates on the cooktop, be sure to locate them correctly. Grates should fit securely into the cooktop. Grate Support Bumpers (on some models) If any of the rubber grate support bumpers in the cooktop are missing or damaged, replacement parts can be obtained by visiting our website at GEAppliances.com/ parts. To insert the new bumpers, simply place the coneshaped end of the bumper into the hole in the cooktop and push down while gently twisting the bumper. Grate Support Bumpers Griddle Reversible Cast-Iron: Clean your reversible cast-iron JULGGOHZLWKDVWLIIEUXVKDQGKRWZDWHU8VLQJVRDSLV not recommended, and harsh detergents should never be used as they will remove the seasoning. Rinse with hot water and dry thoroughly. After rinsing, preseason the griddle by applying a light coat of cooking oil to the griddle surface. Wipe off excess oil with a paper towel. Store in a cool, dry place. Griddle Precautions: If something has spilled under the griddle, it should be cleaned up as soon as possible to prevent the spill from getting baked onto the cooktop. D o not allow grease to accumulate under the griddle as it can be a fire hazard. Clean under the griddle with hot, soapy water as soon as it is cool. D o not wash your griddle in the dishwasher. ' RQRWFOHDQWKHJULGGOHLQWKHVHOIFOHDQLQJRYHQ 24 49-2000781 Rev. 6 CARE AND CLEANING: 'RRUDQG'UDZHU2YHQ3UREH Door and Drawer Cleaning the Oven Door Cleaning the Door Interior Cleaning the Door Exterior Do not allow excess water to run into any holes or slots in the door. Wipe dish soap over any baked-on spatters on the glass. 8VHDVLQJOHVLGHGVDIHW\UD]RUEODGHWRFOHDQLWRII7KHQ wipe over the glass with a soapy cloth to remove any residue and dry off. The area outside the gasket can be cleaned with a soapfilled plastic scouring pad. Do not rub or clean the door gasket - it has an extremely low resistance to abrasion. If you notice the gasket becoming worn, frayed or damaged in any way or if it has become displaced on the door, you should have it replaced. If a stain on the door vent trim is persistent, use a mild abrasive cleaner and a sponge-scrubber for best results. Do not use this method on any other surface. Stainless Steel Surfaces (on some models) Do not use a steel wool pad; it will scratch the surface. To clean the stainless steel surface, use warm sudsy water or a stainless steel cleaner or polish. Always wipe the surface in the direction of the grain. Follow the cleaner instructions for cleaning the stainless steel surface. To inquire about purchasing cleaning products including stainless steel appliance cleaner or polish, see the Accessories and Consumer Support sections at the end of this manual. Removable Storage Drawer Most cleaning can be done with the drawer in place. However, the drawer may be removed if further cleaning LVQHHGHG8VHVRDSDQGZDUPZDWHUWRWKRURXJKO\FOHDQ To remove the drawer: 1. 3XOOGUDZHUVWUDLJKWRXWXQWLOLWVWRSV 2. 3UHVVWKHOHIWUDLOUHOHDVHXSDQGSUHVVWKHULJKWUDLO release down, while pulling the drawer forward and free. To replace the drawer: 1. 3ODFHWKHOHIWGUDZHUUDLODURXQGWKHLQQHUOHIWUDLO guide and slide it in slightly to hook it. 2. 3ODFHWKHULJKWGUDZHUUDLODURXQGWKHLQQHUULJKWUDLO guide and slide it in slightly to hook it. 3. Slide the drawer all the way in. Oven Probe The temperature probe may be cleaned with soap and water or a soap-filled scouring pad. Cool the temperature probe before cleaning. Scour stubborn spots with a soapfilled scouring pad, rinse and dry. To order additional temperature probes, see the Accessories and Consumer Support sections at the end of this manual. Do not immerse the temperature probe in water. Do not store the temperature probe in the oven. Do not leave the temperature probe inside the oven during a self or steam clean cycle. 49-2000781 Rev. 6 25 CARE AND CLEANING: Oven Light Oven Light (Features and appearance may vary from your model) WARNING SHOCK OR BURN HAZARD: Before replacing oven light bulb, disconnect the electrical power to the oven at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn. CAUTION BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with bare hands or a damp cloth can cause burns. To Remove the Light Bulb 3XVKWKHEXOEVWUDLJKWLQWRWKHUHFHSWDFOHDOOWKHZD\ 7XUQWKHJODVVFRYHUFRXQWHUFORFNZLVHXQWLOWKHJODVV is removed. Wearing latex gloves may offer a better grip. 8VLQJJORYHVRUDGU\FORWKUHPRYHWKHEXOEE\SXOOLQJ it straight out. 4. Replace the glass cover. For improved lighting inside the oven, clean the glass cover frequently using a wet cloth. This should be done when the oven is completely cool and the light is off. 5. Reconnect electrical power to the oven. To Replace the Light Bulb 8VHDQHZYROWKDORJHQEXOEQRWWRH[FHHG ZDWWV5HSODFHWKHEXOEZLWKWKHVDPHW\SHRIEXOE that was removed. Be sure the replacement bulb is UDWHGYROWVRUYROWV127YROWVDQGKDVD G9 base. 8VLQJJORYHVRUDGU\FORWKUHPRYHWKHEXOEIURPLWV packaging. Do not touch the bulb with bare fingers. Oil from skin will damage the bulb and shorten its life. Receptacle Socket G9 Bulb Glass cover Oven Light Replacement (on some models) To remove: 7XUQWKHJODVVFRYHU FRXQWHUFORFNZLVHWXUQXQWLOWKH tabs of the glass cover clear the grooves of the socket. Wearing latex gloves may offer a better grip. 2. Remove the bulb by turning it counter-clockwise. To replace: 5HSODFHEXOEZLWKDQHZZDWWDSSOLDQFHEXOE Insert the bulb and turn it clockwise until it is tight. 3ODFHWKHWDEVRIWKHJODVVFRYHULQWRWKHJURRYHVRI WKHVRFNHW7XUQWKHJODVVFRYHUFORFNZLVHWXUQ For improved lighting inside the oven, clean the glass cover frequently using a wet cloth. This should be done when the oven is completely cool. 3. Reconnect electrical power to the oven. Oven Light Replacement (on some models) The oven light bulb is covered with a removable glass cover that is held in place with a bail-shaped wire. Remove the oven door, if desired, to reach the cover easily. See the Lift-Off Oven Door section for detailed oven door removal instructions. Replacing the Light Bulb: 'LVFRQQHFWHOHFWULFDOSRZHUWRWKHUDQJH 2. Hold the glass cover stable, so it doesn't fall when released. 3. Slide near the indent of the cover holder until the cover is released. Do not remove any screws to release the glass cover. 5HSODFHEXOEZLWKDZDWWKRXVHKROGDSSOLDQFH bulb. Do not touch hot bulb with hand or wet cloth. Only remove bulb when it is cool. 5. Hold glass cover stable over new bulb. 3XOOWKHZLUHFRYHUKROGHUQHDUWKHLQGHQWXQWLOWKH indent in the Glass cover wire cover RQVHOIFOHDQ holder is located PRGHORQO\ in the indent of the glass cover. 7. Connect electrical power to range. Indent Wire cover holder 26 49-2000781 Rev. 6 CARE AND CLEANING: Oven Door Oven Door The door is very heavy. Be careful when removing and lifting the door. Do not lift door by the handle. To Remove the Door: )XOO\ RSHQ WKH GRRU 3XOO WKH KLQJH ORFNV XS DQG DZD\ IURP WKH UDQJH frame to the unlocked position. 3. Firmly grasp both sides of the door near the top. 4. Close door until the top of the door is approximately 6" from the range frame. 5. Lift door up and away from the range until both hinge arms are clear of the slots in the range frame. To Replace the Door: )LUPO\ JUDVS ERWK VLGHV RI WKH GRRU QHDU WKH WRS 2. With the door at the same angle as the removal position, rest the notch on the underside of the left hinge arm on the bottom edge of the left hinge slot. The notch in the hinge arm must be fully seated into the bottom of the slot. Repeat for the right side. 3XOO KLQJH ORFNV XS WR XQORFN Bottom edge of slot Hinge arm Notch Removal position 3. Fully open the door. If the door will not fully open, the notches in the bottoms of the hinge arms have not seated correctly in the bottom edge of the slot. Lift the door off the range and repeat previous step. 3XVK WKH KLQJH ORFNV WRZDUG WKH UDQJH FDYLW\ DQG down to the locked position. Rest notch on bottom edge of hinge slot 3XVK KLQJH ORFNV GRZQ WR ORFN 5. Close the oven door. 49-2000781 Rev. 6 27 TROUBLESHOOTING TIPS Troubleshooting Tips ... Before you call for service Save time and money! Review the charts on the following pages first and you may not need to call for service. Problem My new oven doesn't cook like my old one. Is something wrong with the temperature settings? Food does not bake properly Food does not broil properly Oven temperature too hot or too cold Oven and/or display appears not to work "Crackling" or "popping" sound Why is my range making a "clicking" noise when using my oven? Sometimes the oven takes longer to preheat to the same temperature Possible Cause Your new oven has a different cooking system from your old oven and therefore may cook differently than your old oven. Oven controls improperly set. Rack position is incorrect or rack is not level. Incorrect cookware or cookware of improper size being used. Oven temperature needs adjustment. Oven controls improperly set. Improper rack position being used. Cookware not suited for broiling. Aluminum foil on the broil pan has not been fitted properly or slit to drain grease. Oven temperature needs adjustment. What To Do For the first few uses, follow your recipe times and temperatures carefully and use rack positions recommended in the Cooking Guide. If you still think your new oven is too hot or too cold, you can adjust the temperature yourself to meet your specific cooking preference. See the Settings section. See the Cooking Modes section. See the Cooking Modes section and Cooking Guide. See the Cookware section. See the Settings section. Make sure you select the appropriate broil mode. See Cooking Guide for rack location suggestions. 8VHDSDQVSHFLILFDOO\GHVLJQHGIRUEURLOLQJ If using aluminum foil on broil pan, wrap tightly and add slits conforming to those in the pan to allow grease to drain. See the Oven Controls section. A fuse in your home may be blown or the circuit breaker tripped. Oven controls improperly set. Oven is in Sabbath Mode. The clock is turned off. This is the sound of the metal heating and cooling during both the cooking and cleaning functions. Your range has been designed to maintain a tighter control over your oven's temperature. You may hear your oven's heating elements "click" on and off more frequently than in older ovens to achieve better results during baking, broiling, and self-clean cycles. Cookware, food, and/or number of racks in oven. Replace the fuse or reset the circuit breaker. 6HHWKH8VLQJWKH2YHQVHFWLRQ 9HULI\WKDWWKHRYHQLVQRWLQ6DEEDWK0RGH See the Sabbath Mode section. See the Settings section. This is normal. This is normal. Cookware, food, and racks in the oven will cause differences in preheat times. Remove excess items to reduce preheat time. 28 49-2000781 Rev. 6 TROUBLESHOOTING TIPS Troubleshooting Tips ... Before you call for service Problem Oven light does not work Oven will not self-clean Excessive smoking during clean cycle Oven not clean after a clean cycle Strong "burning" or "oily" odor emitting from the vent Excessive smoking during broiling Oven door will not open or LOCKED light is on when you want to cook. "LOCK DOOR" flashes in the display "F-- and a number or letter" flash in the display Power outage, clock flashes Lock Controls or Control Lockout feature is activated Burners do not light Possible Cause Light bulb is loose or defective. The temperature is too high to set a self-clean operation. Oven controls improperly set. Excessive soil or grease. Oven controls improperly set. Oven was heavily soiled. This is normal in a new oven and will disappear in time. Food too close to burner element. The oven door is locked because the temperature inside the oven has not dropped below the locking temperature. The self-clean cycle has been selected but the door is not closed. You have a function error code. Power outage or surge Plug on range is not completely inserted in the electrical outlet. Gas supply not connected or turned on. A fuse in your home may be blown or the circuit breaker tripped. Burner parts not replaced correctly. Burner slots near the electrode, or the round lighter port on the oval burner, may be clogged. Food residue on electrode What To Do Tighten or replace bulb. See the Maintenance section for instructions on how to replace the bulb. Allow the oven to cool and reset the controls. See the Cleaning the Oven section. 3UHVVWKH Cancel/Off pad. Open the windows to rid the room of smoke. Wait until the LOCKED light goes off. Wipe up the excess soil and reset the clean cycle. See the Cleaning the Oven section. Clean up heavy spillovers before starting the clean cycle. Heavily soiled ovens may need to self-clean again or for a longer period of time. To speed the process, set a self-clean cycle for a minimum of 3 hours. See the Cleaning the Oven section. This is temporary. Lower the rack position of the food. 3UHVVWKHCancel/Off pad. Allow the oven to cool below the locking temperature. Close the oven door. 3UHVVWKHCancel/Off pad. Allow the oven to cool for one KRXU3XWWKHRYHQEDFNLQWRRSHUDWLRQ,IWKHIXQFWLRQFRGH UHSHDWVGLVFRQQHFWDOOSRZHUWRWKHRYHQIRUDWOHDVW seconds and then reconnect power. If the function error code repeats again, call for service. Reset the clock. If the oven was in use, you must reset it by pressing the Cancel/Off pad, setting the clock and resetting any cooking function. If LOC ON appears in the display, the range control is locked. Turn this feature off to use the range. See the Lock Control feature in the Oven Controls section. Make sure electrical plug is plugged into a live, properly grounded outlet. See the Installation Instructions that came with your range. Replace the fuse or reset the circuit breaker. See the Care and Cleaning of the range section. Remove the burners and clean them. Check the electrode area for burned-on food or grease. See the Care and Cleaning of the range section. Lightly polish flat tip of electrode with nail file or sandpaper until shiny. 49-2000781 Rev. 6 29 TROUBLESHOOTING TIPS Troubleshooting Tips ... Before you call for service Problem Top burners do not burn evenly Burner flames are very large or yellow Surface burners light but bake and broil burners do not. Possible Cause Improper burner assembly. Burner slots on the side of the burner may be clogged. Improper air to gas ratio. Gas to the oven burners may have been shut off. What To Do Make sure the burner caps are seated correctly. See the Care and Cleaning of the range section. Remove the burners for cleaning. See the Care and Cleaning of the range section. ,IUDQJHLVFRQQHFWHGWR3URSDQHJDVFRQWDFWWKHWHFKQLFLDQ who installed your range or made the conversion. The oven gas shut-off is located on the gas regulator near the gas line attachment to your range. Locate it and flip the lever. My oven door glass appears to be "tinted" or have a "rainbow" color. Drawer does not slide smoothly or drags The inner oven glass is coated with a heat barrier to reflect the heat back into the oven to prevent heat loss and keep the outer door cool while baking. The drawer is out of alignment. Drawer is over-loaded or load is unbalanced. Lever is shown closed. 38//7223(1 Sealed burner models 7KLVLVQRUPDO8QGHUFHUWDLQOLJKWRUDQJOHV\RXPD\VHHWKLV tint or rainbow color. Fully extend the drawer and push it all the way in. See the Care and Cleaning of the range section. Reduce weight or redistribute drawer contents. 49-2000781 Rev. 6 Notes 49-2000781 Rev. 6 LIMITED WARRANTY GE Appliances Gas Range Limited Warranty GEAppliances.com All warranty service is provided by our Factory Service Centers, or an authorized Customer Care® technician. To schedule service online, visit us at geappliances.com/serviceRUFDOO*($SSOLDQFHVDW*(&$5(63OHDVH have your serial number and your model number available when calling for service. Servicing your appliance may require the use of the onboard data port for diagnostics. This gives a GE Appliances factory service technician the ability to quickly diagnose any issues with your appliance and helps GE Appliances improve its products by providing GE Appliances with information on your appliance. If you do not want your appliance data to be sent to GE Appliances, please advise your technician not to submit the data to GE Appliances at the time of service. For the period of One year From the date of the original purchase GE Appliances will replace Any part of the range which fails due to a defect in materials or workmanship. During this limited one-year warranty, GE Appliances will provide, free of charge, all labor and in-home service to replace the defective part. What GE Appliances will not cover: Service trips to your home to teach you how to use the product. ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH )DLOXUHRIWKHSURGXFWLILWLVDEXVHGPLVXVHG modified, or used for other than the intended purpose or used commercially. 5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW breakers. 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUH floods, or acts of God. 'DPDJHWRILQLVKVXFKDVVXUIDFHUXVWWDUQLVKRU small blemishes not reported within 48 hours of delivery. ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\ possible defects with this appliance. 'DPDJHFDXVHGDIWHUGHOLYHU\ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH 6HUYLFHWRUHSDLURUUHSODFHOLJKWEXOEVH[FHSWIRU/(' lamps. EXCLUSION OF IMPLIED WARRANTIES Your sole and exclusive remedy is product repair as provided in this Limited Warranty. Any implied warranties, including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or the shortest period allowed by law. This limited warranty is extended to the original purchaser and any succeeding owner for products purchased for home XVHZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($SSOLDQFHV$XWKRUL]HG6HUYLFHULVQRW available, you may be responsible for a trip charge or you may be required to bring the product to an Authorized GE Appliances Service location for service. In Alaska, the warranty excludes the cost of shipping or service calls to your home. Some states do not allow the exclusion or limitation of incidental or consequential damages. This limited warranty gives you specific legal rights, and you may also have other rights which vary from state to state. To know what your legal rights are, consult your local or state consumer affairs office or your state's Attorney General. Warrantor: GE Appliances, a Haier company Louisville, KY 40225 Extended Warranties:3XUFKDVHD*($SSOLDQFHVH[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUH available while your warranty is still in effect. You can purchase it online anytime at geappliances.com/extended-warranty RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV*($SSOLDQFHV6HUYLFHZLOOVWLOOEHWKHUHDIWHU\RXUZDUUDQW\H[SLUHV 6WDSOH\RXUUHFHLSWKHUH3URRIRIWKHRULJLQDOSXUFKDVH date is needed to obtain service under the warranty. 32 49-2000781 Rev. 6 ACCESSORIES Accessories Looking For Something More? GE Appliances offers a variety of accessories to improve your cooking and maintenance experiences! Refer to the Consumer Support page for phone numbers and website information. The following products and more are available: Accessories Nickel Flat Rack Reinforced Nickel Flat Rack Self Clean Flat Rack Nickel Extension Rack Self Clean Extension Rack %URLOHU3DQô´[ó´[ò³ Roasting Rack Accessory Cooktop Center Grate Nonstick Aluminum Griddle Reversible Cast-Iron Griddle Cleaning Supplies &LWUX6KLQH6WDLQOHVV6WHHO:LSHV 6WDLQOHVV6WHHO3ROLVKLQJ&ORWK Burnt-On Grease Remover 49-2000781 Rev. 6 33 CONSUMER SUPPORT Consumer Support GE Appliances Website Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day, any day of the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support VHUYLFHVGHVLJQHGIRU\RXUFRQYHQLHQFH,QWKH86GEAppliances.com Register Your Appliance Register your new appliance on-line at your convenience! Timely product registration will allow for enhanced communication and prompt service under the terms of your warranty, should the need arise. You may also mail in WKHSUHSULQWHGUHJLVWUDWLRQFDUGLQFOXGHGLQWKHSDFNLQJPDWHULDO,QWKH86GEAppliances.com/register Schedule Service Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at \RXUFRQYHQLHQFHDQ\GD\RIWKH\HDU,QWKH86GEAppliances.com/service RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV Extended Warranties 3XUFKDVHD*($SSOLDQFHVH[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUHDYDLODEOHZKLOH\RXU warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your ZDUUDQW\H[SLUHV,QWKH86GEAppliances.com/extended-warranty RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV Remote Connectivity )RUDVVLVWDQFHZLWKZLUHOHVVQHWZRUNFRQQHFWLYLW\IRUPRGHOVZLWKUHPRWHHQDEOH visit our website at GEAppliances.com/connectRUFDOOLQWKH86 Parts and Accessories Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes 9,6$0DVWHU&DUGDQG'LVFRYHUFDUGVDUHDFFHSWHG2UGHURQOLQHWRGD\KRXUVHYHU\GD\ ,QWKH86GEApplianceparts.com or by phone at 877.959.8688 during normal business hours. Instructions contained in this manual cover procedures to be performed by any user. Other servicing generally should be referred to qualified service personnel. Caution must be exercised, since improper servicing may cause unsafe operation. Contact Us If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the details including your phone number, or write to: ,QWKH86*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.< GEAppliances.com/contact 3ULQWHGLQ0H[LFR 34 49-2000781 Rev. 6 ESTUFAS a Gas con Función de Auto Limpieza INFORMACIÓN DE SEGURIDAD . . . . . 3 USO DE LA ESTUFA En Caso de Corte de Corriente . . . . . . . . . . . . . . . . 8 Quemadores . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Plancha. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Controles del Horno. . . . . . . . . . . . . . . . . . . . . . . . . 11 Opciones de Cocción. . . . . . . . . . . . . . . . . . . . . . . . 12 Settings (Configuraciones). . . . . . . . . . . . . . . . . . . 12 Modo Sabático . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 Estantes del Horno. . . . . . . . . . . . . . . . . . . . . . . . . . 15 Papel de Aluminio y Cobertores del Horno . . . . . 15 Modos de Cocción al Horno . . . . . . . . . . . . . . . . . . 16 Ventilaciones de Aire del Horno . . . . . . . . . . . . . . 17 Sonda del Horno. . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Guía de Cocción del Horno. . . . . . . . . . . . . . . . . . . 18 Modo de Cocción para Freír con Aire . . . . . . . . .20 CUIDADO Y LIMPIEZA Estufa - Exterior . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 Estufa - Interior. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 Placa de Cocción . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 Puerta y el Cajón . . . . . . . . . . . . . . . . . . . . . . . . . . .25 Sonda del Horno. . . . . . . . . . . . . . . . . . . . . . . . . . . .25 Luz del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .26 Puerta del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS . . . . . . . .28 GARANTÍA LIMITADA. . . . . . . . . . . . . . . .32 ACCESORIOS . . . . . . . . . . . . . . . . . . . . . . . . . .33 SOPORTE PARA EL CONSUMIDOR . . . . . . . . . . . . . . . . . . . . .34 MANUAL DEL PROPIETARIO PGS930 Escriba los números de modelo y de serie aquí: Nº de Modelo ____________ Nº de Serie ______________ Encontrará la etiqueta de calificación en el frente, detrás del cajón de la estufa. GE es una marca registrada de General Electric Company. Fabricado bajo licencia de marca. 49-2000781 Rev. 6 09-24 GRACIAS POR HACER QUE GE APPLIANCES SEA PARTE DE SU HOGAR. Ya sea que haya crecido usando GE Appliances, o que ésta es su primera vez, nos complace tenerlo en la familia. Sentimos orgullo por el nivel de arte, innovación y diseño de cada uno de los electrodomésticos de GE Appliances, y creemos que usted también. Entre otras cosas, el registro de su electrodoméstico asegura que podamos entregarle información importante del producto y detalles de la garantía cuando los necesite. Registre su electrodoméstico GE ahora a través de Internet. Sitios Web y números telefónicos útiles están disponibles en la sección de Soporte para el Consumidor de este Manual del Propietario. También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con el material embalado. 2 49-2000781 Rev. 6 INFORMACIÓN DE SEGURIDAD INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO ADVERTENCIA Lea todas las instrucciones de seguridad antes de utilizar este producto. No seguir estas instrucciones puede generar un incendio, una descarga eléctrica, lesiones corporales o la muerte. ADVERTENCIA Si la información de este manual no se sigue exactamente, se podrá producir un incendio o explosión, ocasionando daños sobre la propiedad, lesiones o la muerte. - No guarde ni use gasolina u otros vapores inflamables y líquidos cerca de este ni de otros electrodomésticos. - QUÉ DEBE HACER SI HUELE GAS 1RLQWHQWHLOXPLQDUQLQJ~QHOHFWURGRPpVWLFR 1RWRTXHQLQJ~QLQWHUUXSWRUHOpFWULFRQRXVHWHOpIRQRVHQVXHGLILFLR ' HLQPHGLDWROODPHDVXSURYHHGRUGHJDVGHVGHHOWHOpIRQRGHXQYHFLQR 6LQRVHSXHGHFRPXQLFDUFRQVXSURYHHGRUGHJDVOODPHDOGHSDUWDPHQWRGHERPEHURV - La instalación y las reparaciones deberán ser realizadas por un instalador calificado, agencia de servicios o el proveedor de gas. DISPOSITIVO ANTI-VOLCADURAS ADVERTENCIA Para reducir el riesgo de volcar la estufa, ésta debe sujetarse mediante un soporte anti- Riesgo de Caída volcaduras con una adecuada instalación. Ver · Un niño o adulto pueden volcar la estufa y morir. las instrucciones de instalación enviadas con el · Instale el soporte anti-volcaduras sobre la pared o el piso. · Asegúrese la estufa al soporte anti-volcaduras deslizando la unidad hacia atras de tal manera que la pata niveladora sea enganchada. · Vuelva a adherir el soporte anti-volcaduras si la estufa se mueve de lugar. soporte para obtener detalles completos antes de iniciar la instalación. Para Estufas Sin Apoyo y Deslizabless Para controlar si el soporte es instalado y · Si esto no se hace, se podrá producir la muerte o quemaduras graves en niños o adultos. ajustado de forma apropiada, mire que debajo de la estufa la pata niveladora trasera esté ajustada al soporte. En algunos modelos, el cajón de almacenamiento o el panel de protección se pueden retirar para una fácil inspección. Si no es posible realizar una inspección visual, deslice la estufa hacia adelante, confirme que el soporte anti-volcaduras esté ajustado de forma segura al Soporte Anti-Volcaduras piso o la pared, y deslice la estufa hacia atrás de modo que la pata niveladora trasera se encuentre debajo del soporte anti-volcaduras. Si la estufa es expulsada de la pared por alguna razón, siempre repita este procedimiento a fin de verificar que esté asegurado de forma correcta con un soporte anti volcaduras. Pata Niveladora Nunca quite las patas de nivelación por completo ya que la estufa no quedará bien sujeta al dispositivo anti-volcaduras. Estufas Sin Apoyo y Deslizables LEA Y GUARDE ESTAS INSTRUCCIONES 49-2000781 Rev. 6 3 INFORMACIÓN DE SEGURIDAD INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD ADVERTENCIA NUNCA use este electrodoméstico para calentar el ambiente. Como consecuencia de esto, se podrá producir envenenamiento con monóxido de carbono y el sobrecalentamiento del horno. 8VHHVWHHOHFWURGRPpVWLFRVyORSDUDVXSURSyVLWRRULJLQDO como se describe en el manual del propietario. 6 ROLFLWHTXHXQLQVWDODGRUFDOLILFDGRLQVWDOHVXHVWXID\ que esté correctamente conectada a tierra, de acuerdo con las instrucciones de instalación provistas. & XDOTXLHUDMXVWH\WUDEDMRGHVHUYLFLRWpFQLFRGHEHUi ser realizado únicamente por instaladores calificados de estufas a gas o técnicos del servicio. No intente reparar o reemplazar ninguna parte de la estufa, a menos que esto se recomiende específicamente en este manual. 6 XHVWXIDHVHQYLDGDGHVGHODIiEULFDSDUDXVRFRQJDV natural. Puede ser convertida para uso con gas propano. Si se requieren, estos ajustes deben ser realizados por un técnico calificado de acuerdo con las instrucciones de instalación y códigos locales. La agencia que realiza este trabajo asume la responsabilidad de la conversión. 6 ROLFLWHTXHHOLQVWDODGRUOHPXHVWUHODXELFDFLyQGHOD válvula de cierre de la estufa a gas y cómo apagarla en caso de ser necesario. ( QFKXIHODHVWXIDHQXQWRPDFRUULHQWHFRQFRQH[LyQ a tierra de 120 voltios únicamente. No retire la pata redonda de conexión a tierra del enchufe. Si tiene dudas sobre la conexión a tierra del sistema eléctrico para hogar, es su responsabilidad y obligación contar con el reemplazo de un tomacorriente sin conexión a tierra por un tomacorriente de tres patas correctamente conectado a tierra, de acuerdo con el Código Nacional de Electricidad. No use prolongadores con este electrodoméstico. $ QWHVGHUHDOL]DUFXDOTXLHUVHUYLFLRWpFQLFRGHVHQFKXIH la estufa o desconecte el suministro de corriente desde el panel de distribución del hogar, retirando el fusible o desconectando el disyuntor. $ VHJ~UHVHGHTXHWRGRVORVPDWHULDOHVGHHPEDODMHVHDQ retirados de la estufa antes de su uso, a fin de evitar que estos materiales se incendien. ( YLWHUDOODGXUDVRLPSDFWRVVREUHODVSXHUWDVGHPHWDO estufas o paneles de control. Hacer esto podrá producir la rotura de vidrios. No cocine un producto con un vidrio roto. Es posible que se produzcan descargas, incendio o cortes. 1 RGHMHDORVQLxRVVRORVRIXHUDGHVXUDGLRGHDWHQFLyQ en el área donde el electrodoméstico se encuentre en uso. Nunca se les deberá permitir trepar, sentarse o pararse sobre ninguna parte del electrodoméstico. ADVERTENCIA No coloque artículos de interés para los niños sobre los gabinetes que están sobre un horno si los niños se trepan sobre el horno para llegar a estos artículos podrían sufrir lesiones graves. 1 XQFDEORTXHHODVYHQWLODFLRQHVDEHUWXUDVGHDLUHGHOD estufa. Las mismas brindan las entradas y salidas de aire que son necesarias para que la estufa opere de forma correcta con la combustión adecuada. Las aberturas de aire están ubicadas en la parte trasera de la estufa, en la parte superior e inferior de la puerta del horno, y en la parte inferior de la estufa debajo del cajón calentador, del cajón del horno inferior o del panel de protección. 8VHVyORVRVWHQHGRUHVGHROODVVHFRV±ORVVRVWHQHGRUHV húmedos sobre superficies calientes pueden producir quemaduras debido al vapor. No permita que los sostenedores de ollas tengan contacto con los quemadores superficiales, la parrilla de los quemadores, o el elemento de calefacción del horno. No use una toalla u otra tela voluminosa para reemplazar el mango de las cacerolas. 1 RWRTXHHOHOHPHQWRFDOHQWDGRUQLODVXSHUILFLHLQWHULRU del horno. Es posible que estas superficies estén demasiado calientes como para quemar, aunque su color sea oscuro. Durante y después del uso, no toque ni permita que telas u otros materiales inflamables toquen cualquier área interior del horno; espere a que haya pasado un tiempo suficiente para que se enfríen. Otras superficies del electrodoméstico se podrán calentar lo suficiente como para ocasionar lesiones. Las superficies potencialmente calientes incluyen la abertura de la ventilación del horno, superficies cercanas a la abertura y grietas alrededor de la puerta del horno. 1 RFDOLHQWHHQYDVHVGHFRPLGDTXHQRKD\DQVLGR abiertos. Se podría acumular presión y el envase podría explotar, ocasionando una lesión. & RFLQHODFRPLGDFRPSOHWDPHQWHSDUDHYLWDUTXHVH produzcan enfermedades a partir de la comida. Puede encontrar recomendaciones de seguridad mínima sobre la temperatura de la comida en www.IsItDoneYet.gov y ZZZIVLVXVGDJRY8WLOLFHXQWHUPyPHWURSDUDWRPDUOD temperatura de la comida y haga controles en diferentes ubicaciones. 1 RSHUPLWDTXHQDGLHVHWUHSHSDUHRFXHOJXHGHOD puerta del horno, del cajón o la estufa. Se podrá dañar la estufa o provocar su caída, ocasionando lesiones graves o la muerte. LEA Y GUARDE ESTAS INSTRUCCIONES 4 49-2000781 Rev. 6 INFORMACIÓN DE SEGURIDAD INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO ADVERTENCIA MANTENGA LOS MATERIALES INFLAMABLES ALEJADOS DE LA ESTUFA Si esto no se cumple, se podrán sufrir lesiones personales graves o incendios. 1RJXDUGHQLXVHPDWHULDOHVLQIODPDEOHVHQXQKRUQR o cerca de la parte superior de la estufa, incluyendo papel, plástico, sostenedores de ollas, trapos, cobertores de pared, cortinas, paños y gasolina u otros vapores y líquidos inflamables. 1XQFDXVHSUHQGDVKROJDGDVRTXHFXHOJXHQPLHQWUDV usa el electrodoméstico. Evite acumular artículos comúnmente usados en gabinetes sobre la estufa, y tenga cuidado al extender la mano sobre la estufa. La ropa que se encuentre cerca de los quemadores o superficies calientes se podrá encender, ocasionando quemaduras graves. 1RSHUPLWDTXHODJUDVDGHODFRFFLyQXRWURVPDWHULDOHV inflamables se acumulen en o cerca de la estufa. La grasa del horno o sobre la estufa se podrá incendiar. ADVERTENCIA EN CASO DE INCENDIO, SIGA LOS SIGUIENTES PASOS PARA EVITAR LA PROPAGACIÓN DEL FUEGO 1RXVHDJXDVREUHHOIXHJRGHODJUDVD1XQFDWRPH una olla que se esté incendiando. Apague los controles. Extinga la olla que se esté incendiando sobre un quemador superficial, cubriendo la olla completamente con su tapa correspondiente, una hoja metálica de galletas o una bandeja plana. Si es necesario, use un químico seco multiuso o un extintor de chorro de espuma. 6LKD\XQLQFHQGLRHQHOKRUQRGXUDQWHHOKRUQHDGR ahogue el fuego cerrando la puerta del horno y apagando el mismo o usando un químico seco multipropósito o un extintor de incendio con espuma. (QFDVRGHTXHKD\DIXHJRHQHOKRUQRGXUDQWHHOSHUtRGR de auto limpieza, apague el horno y espere a que el fuego se extinga. No fuerce la puerta para abrirla. La entrada de aire fresco sobre las temperaturas de auto limpieza podrá conducir a la producción de llamas en el horno. ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DE LA PARTE SUPERIOR DE LA ESTUFA ADVERTENCIA NUNCA Pierda de Vista la Sección Superior de la Superficie de Cocción de este 1XQFDSLHUGDGHYLVWDHODFHLWHFXDQGRHVWpIULHQGR6L se calienta más allá de su punto de cocción, el aceite se puede quemar y provocar un incendio que se puede SURSDJDUDORVJDELQHWHVSUy[LPRV8VHXQWHUPyPHWUR para grasas profundas siempre que sea posible, a fin de monitorear la temperatura del aceite. Electrodoméstico. · No seguir esta advertencia podrá resultar en incendio, explosión, o riesgos de quemaduras que podrán ocasionar daños sobre la propiedad, lesiones personales o la muerte. · Si se produce un incendio, manténgase alejado del 3DUDHYLWDUGHUUDPHVHLQFHQGLRVXVHXQDFDQWLGDG mínima de aceite al usar una sartén poco profunda y evite la cocción de comidas congeladas con cantidades excesivas de hielo. 8VHHOWDPDxRGHROODDGHFXDGRSDUDHYLWDUTXHVHDQ inestables o que sufran caídas fácilmente. Seleccione utensilios que coincidan con el tamaño del quemador. Las llamas del quemador se deberán ajustar de modo que no VHH[WLHQGDQPiVDOOiGHODSDUWHLQIHULRUGHODROOD8QD cantidad excesiva de llama puede representar un riesgo. electrodoméstico y de inmediato llame al departamento de bomberos. NO INTENTE EXTINGUIR CON AGUA UN INCENDIO PRODUCIDO CON COMBUSTIBLE/ GRASA. 6LHPSUHXVHODSRVLFLyQ/,7(DOHQFHQGHUORV quemadores superiores y asegúrese de que estos se hayan encendido. $OXVDUXWHQVLOLRVGHYLGULRFHUiPLFDDVHJ~UHVHGHTXH sean adecuados para el servicio de estufa; otros se podrán romper debido a un cambio repentino de temperatura. 1XQFDSLHUGDGHYLVWDORVTXHPDGRUHV/DVFRPLGDV especialmente las que se preparan con aceite, se pueden incendiar, lo cual puede ocasionar un incendio que se propague a los gabinetes próximos. $ILQGHPLQLPL]DUSRVLEOHVTXHPDGXUDVLQFHQGLRGH materiales inflamables y derrames, la manija de un envase deberá ser inclinada hacia el centro de la estufa sin que se extienda sobre los quemadores cercanos. LEA Y GUARDE ESTAS INSTRUCCIONES 49-2000781 Rev. 6 5 INFORMACIÓN DE SEGURIDAD INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DE LA PARTE SUPERIOR DE LA ESTUFA (Cont.) 1RXVHXQZRNFRQXQDQLOORFRQVRSRUWHGHPHWDO redondo. El anillo podrá atrapar calor y bloquear el aire hacia el quemador, produciendo el riesgo de emisión de monóxido de carbono. 1RLQWHQWHHOHYDUODHVWXID+DFHUHVWRSRGUtDGDxDU la tubería de gas hasta los quemadores superficiales, ocasionando una pérdida de gas y riesgo de incendio. $OLQKDELOLWDUHO%ORTXHRGHO&RQWUROGH*DVHQDOJXQRV PRGHORVDVHJ~UHVHGHTXHORVFRQWUROHVGHVXSHUILFLH VHHQFXHQWUHQHQODSRVLFLyQ2))$SDJDGR(VWR evitará que haya un flujo de gas no intencional desde los quemadores. 1RXVHSDSHOGHDOXPLQLRSDUDFXEULUUHMLOODV cualquier parte de la estufa. Si se hace esto se podrá producir envenenamiento con monóxido de carbono, sobrecalentamiento de las superficies de la estufa o un posible riesgo de incendio. ADVERTENCIA INSTRUCCIONES DE SEGURIDAD ADVERTENCIA NUNCA cubra ninguna ranura, agujeros o pasajes en el fondo del horno ni cubra un estante entero con materiales tales como papel de aluminio o cobertores de horno. Hacer esto bloquea el flujo de aire a través del horno y puede ocasionar envenenamiento con monóxido de carbono. Nunca coloque papel de aluminio o cobertores de horno en el fondo del horno. Podrán atrapar el calor, ocasionando riesgos de humo o incendio. o cobertor en la base del horno. Este ítems pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. &RORTXHORVHVWDQWHVGHOKRUQRHQODXELFDFLyQ correspondiente mientras éste se encuentra frío. Si es necesario retirar el estante mientras el horno se encuentra caliente, evite tocar las superficies calientes. 1RGHMHSURGXFWRVWDOHVFRPRSDSHOXWHQVLOLRVGHHVWXID ni comida en el horno cuando no esté en uso. Los artículos guardados en el horno se pueden incendiar. 1RGHMHQLQJ~QSURGXFWRVREUHODVXSHUILFLHGHFRFFLyQ 0DQWpQJDVHDOHMDGRGHODHVWXIDDODEULUODSXHUWDGHO horno. El aire caliente o el vapor que sale puede causar TXHPDGXUDVHQODVPDQRVURVWUR\XRMRV 1XQFDFRORTXHORVXWHQVLOLRVGHHVWXIDSLHGUDVSDUD pizza u horneado o cualquier otro tipo de aluminio cerca de la ventilación del horno. Los artículos se pueden sobrecalentar, y existe riesgo de incendio o quemaduras. 1XQFDDVHFRQODSXHUWDDELHUWD6HSURKtEHDVDUFRQ la puerta abierta debido al sobrecalentamiento de las perillas de control. ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DEL HORNO CON FUNCIÓN DE AUTO LIMPIEZ La función de auto limpieza usa el horno en temperaturas lo suficientemente altas como para consumir restos de comida que haya dentro del mismo. Para un funcionamiento seguro, siga estas instrucciones. 1RWRTXHODVVXSHUILFLHVGHOKRUQRGXUDQWHHOFLFORGH 6LHOPRGRGHDXWROLPSLH]DIXQFLRQDGHIRUPDLQFRUUHFWD limpieza automática. Mantenga a los niños alejados del horno durante la limpieza automática. Si no se siguen estas instrucciones, se podrán producir quemaduras. $QWHVGHXWLOL]DUHOFLFORGHDXWROLPSLH]DUHWLUHODV ollas, estantes de metal brillante del horno y otros utensilios que haya dentro del mismo. Sólo se pueden dejar dentro del horno los estantes para horno con recubrimiento de porcelana. $QWHVGHXWLOL]DUHOFLFORGHDXWROLPSLH]DOLPSLHODJUDVD \UHVWRVGHFRPLGDTXHKD\DHQHOKRUQR8QDFDQWLGDG excesiva de grasa se puede incendiar, lo cual puede producir daños con humo en su hogar. apague el horno y desconecte el suministro de corriente. Solicite el servicio de un técnico calificado. 1RXVHOLPSLDGRUHVSDUDKRUQR1RVHGHEHUiXVDU limpiador para hornos comerciales ni revestimientos de protección para hornos de ningún tipo en o alrededor de cualquier parte del horno. 1ROLPSLHODMXQWDGHODSXHUWD/DMXQWDGHODSXHUWDHV esencial para un buen sellado. Se debe tener cuidado de no frotar, dañar ni mover la junta. IMPORTANTE: La salud de algunas aves es extremadamente sensible a los humos emitidos durante el ciclo de limpieza automática de cualquier estufa. Coloque las aves en otra habitación bien ventilada. LEA Y GUARDE ESTAS INSTRUCCIONES 6 49-2000781 Rev. 6 INFORMACIÓN DE SEGURIDAD INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO Equipo de Acceso Remoto Instalado Este dispositivo cumple con la Parte 15 de la Normativa de la FCC. Su funcionamiento está sujeto a las dos condiciones VLJXLHQWHV(VWHGLVSRVLWLYRQRSRGUiRFDVLRQDU LQWHUIHUHQFLDVQRFLYDV\HVWHGLVSRVLWLYRGHEHDFHSWDU cualquier interferencia recibida, incluyendo interferencias que puedan ocasionar un funcionamiento no deseado. El equipo de comunicación inalámbrica instalado en esta estufa fue probado y cumple con los límites establecidos SDUDXQGLVSRVLWLYRGLJLWDOGH&ODVH%VHJ~QODSDUWHGHOD Normativa de la FCC. Estos límites fueron diseñados para: (a) brindar una protección razonable contra interferencias nocivas en una instalación residencial. Este equipo genera, usa y puede emitir energía de radiofrecuencia y, si no se instala y utiliza de acuerdo con las instrucciones, puede ocasionar interferencias perjudiciales en las comunicaciones de radio. Sin embargo, no se garantiza que no se presenten interferencias en una instalación en particular. Si el equipo provoca interferencias perjudiciales para la recepción de radio o televisión, lo cual puede comprobar encendiendo y apagando el equipo, se aconseja al usuario que intente corregir la interferencia con una de las siguientes medidas: 5HRULHQWHRUHXELTXHODDQWHQDUHFHSWRUD $XPHQWHODVHSDUDFLyQHQWUHHOHTXLSR\HOUHFHSWRU &RQHFWHHOHTXLSRDXQWRPDFRUULHQWHGHXQFLUFXLWRGLIHUHQWH del tomacorriente al que se encuentra conectado el receptor. 3DUDVROLFLWDUD\XGDFRQVXOWHFRQHOSURYHHGRUPLQRULVWDRD XQWpFQLFRH[SHULPHQWDGRGHUDGLR79 (b) tolerar cualquier interferencia recibida, incluyendo las interferencias que puedan provocar un funcionamiento no deseado del dispositivo. Observe que todos los cambios o modificaciones sobre el dispositivo de comunicación inalámbrico instalado en este horno que no estén expresamente aprobados por el fabricante podrían anular la autoridad del usuario para operar el equipamiento. FORMA ADECUADA DE DESCARTAR SU ELECTRODOMÉSTICO Descarte o recicle su electrodoméstico de acuerdo con las Regulaciones Federales y Locales. Comuníquese con las autoridades locales para descartar o reciclar su electrodoméstico de forma ambientalmente segura. Cómo Retirar la Película Protectora de Envío y la Cinta de Embalaje Con cuidado tome un extremo de la película protectora de envío con los dedos y lentamente retire la misma de la superficie del electrodoméstico. No utilice ningún producto filoso para retirar la película. Retire toda la película antes de usar el electrodoméstico por primera vez. NOTA: El adhesivo deberá ser eliminado de todas las partes. No se puede retirar si se hornea con éste dentro. Tenga en cuenta las opciones de reciclaje del material de embalaje de su electrodoméstico. Para asegurar que no haya daños sobre el acabado del producto, la forma más segura de retirar el adhesivo de la cinta de embalaje en electrodomésticos nuevos es aplicando un detergente líquido hogareño para lavar platos. Aplique con una tela suave y deje que se seque. LEA Y GUARDE ESTAS INSTRUCCIONES 49-2000781 Rev. 6 7 USO DE LA ESTUFA: (Q &DVR GH &RUWH GH &RUULHQWH 4XHPDGRUHV En Caso de Corte de Corriente En el caso de un corte de luz, el horno quedará inoperable y no se deberá intentar usarlo. Sin embargo, los quemadores superficiales se podrán encender con un fósforo. Con extremo cuidado, sostenga un fósforo encendido cerca de los Quemadores puertos debajo de la tapa del quemador superficial; luego de IRUPD OHQWD JLUH OD SHULOOD KDVWD OD SRVLFLyQ /,7( %DMR 8QD vez encendidos, los quemadores superficiales continuarán funcionando normalmente. Iluminación de un Quemador Superficial ADVERTENCIA Los quemadores sólo deben ser usados cuando estén cubiertos por los utensilios. Las llamas de los quemadores que no estén cubiertas por el utensilio presentan un riesgo de incendio o incendio de telas. Nunca permita que las llamas se extiendan más allá de los costados del utensilio. Si esto no se cumple, se podrán producir lesiones graves. Asegúrese de que todos los quemadores estén en sus ubicaciones correspondientes y que estén totalmente ensamblados antes de usar cualquiera de estos. Seleccione un quemador y busque su perilla de control. Empuje y gire la perilla hasta la posición LITE. Escuchará un ruido de clic el sonido de la chispa eléctrica que enciende el quemador. Cuando un quemador se gire a LITE, todos los quemadores generarán chispas. El chispeo continuará mientras la SHULOOD SHUPDQH]FD HQ /,7( 8QD vez encendido el gas, gire la perilla para ajustar el tamaño de la llama. Empuje el mango de control y gire el mismo hasta la posición LITE. Selección del Tamaño de la Llama Observe la llama, no la perilla, a medida que reduce el calor. Cuando se desee calentar de forma rápida, el tamaño de la llama de un quemador deberá ser equivalente al tamaño del utensilio de estufa que esté usando. Cuando las llamas sean más grandes que la parte inferior del utensilio de estufa, no calentarán el utensilio más rápido y podrían ser riesgosas. Estas llamas son demasiado grandes para la olla. Uso de los Quemadores NOTAS: No utilice el quemador durante un período de tiempo prolongado sin un utensilio de estufa sobre la parrilla. El acabado de la parrilla se puede resquebrajar si no hay un utensilio de estufa que absorba el calor. No intente desensamblar un quemador mientras otro quemador está encendido. Es posible que se produzca una descarga eléctrica, lo cual podría hacer que vuelque un utensilio de estufa caliente. Asegúrese de que los quemadores y las parrillas estén fríos antes de colocar la mano, tomar el mango de una olla, trapos de limpieza u otros materiales sobre estos. Su horno cuenta con quemadores de gas sellados que ofrecen conveniencia, higiene y flexibilidad para una amplia variedad de aplicaciones de cocción. (O TXHPDGRU PiV SHTXHxR HV SDUD IXHJR OHQWR 8Q TXHPDGRU GH IXHJR OHQWR TXH VH FRORTXH HQ /2 %DMR EULQGD XQD cocción precisa para comidas tales como salsas delicadas que requieren poco calor durante un tiempo de cocción prolongado. El quemador extra grande está diseñado para llevar rápidamente grandes cantidades de líquido a punto de hervor. Algunos modelos cuentan con una configuración de 32:(5 %2,/ HVSHFLDOPHQWH GLVHxDGD SDUD XVDU FRQ utensilios de un diámetro de 11 pulgadas o más. Tipos de Quemadores Superficiales Quemador Redondo 8VH HVWH TXHPDGRU SDUD propósitos de cocción general. Olla de tamaño adecuado a las llamas. 4XHPDGRU GH 0~OWLSOHV $QLOORV (en algunos modelos) 8VH HVWH TXHPDGRU SDUD ROODV grandes o para aplicaciones de cocción a fuego lento. Quemador Oval Dual (en algunos modelos) 8VH HVWH TXHPDGRU SDUD cocinar en la plancha o con una olla pequeña. 8 49-2000781 Rev. 6 USO DE LA ESTUFA:4XHPDGRUHV 4XHPDGRUHV&RQWLQ~D 4XHPDGRUGH$QLOORV0~OWLSOHV (en algunos modelos) Quemador Oval Dual (en algunos modelos) Para utensilios grandes, active todos los anillos configurando el quemador HQWUH+L$OWR\0HG0HGLR Para utensilios pequeños o aplicaciones con poco calor, sólo active los anillos internos configurando el quemador HQWUH/R%DMR\6LP+HUYRU D)XHJR/HQWR Para ollas pequeñas, sólo active el quemador redondo. Al usar una plancha, active las secciones del quemador oval y del redondo. Vista Lateral de la Perilla del Quemador Oval Dual 9LVWD/DWHUDOGHOD3HULOODGHO4XHPDGRUGH$QLOORV0~OWLSOHV Utensilio sobre la Estufa Aluminio: Se recomienda un utensilio de peso mediano, ya que calienta de forma rápida y pareja. La mayoría de las comidas se doran de forma pareja en un sartén de aluminio. 8VHFDFHURODVFRQWDSDKHUPpWLFDFXDQGRFRFLQHFRQ cantidades mínimas de agua. Acero Inoxidable: Este metal posee propiedades de calentamiento limitadas y normalmente se combina con cobre, aluminio u otros materiales para una mejor distribución del calor. Los sartenes con combinación de metales normalmente funcionan de forma satisfactoria si se usan con calor medio, como lo recomienda el fabricante. Hierro Forjado: Si cocinará de forma lenta, la mayoría de los sartenes le darán resultados satisfactorios. Utensilios de esmalte:%DMRFLHUWDVFRQGLFLRQHVHOHVPDOWH de algunos utensilios de estufa se pueden derretir. Siga las recomendaciones sobre métodos de cocción del fabricante de utensilios de estufa. Vidrio: Existen dos tipos de utensilios de estufa de vidrio aquellos para uso con el horno únicamente y aquellos para ODFRFFLyQHQODSDUWHVXSHULRUGHODHVWXIDFDFHURODVFDIp\ WHWHUDV/RVFRQGXFWRUHVGHYLGULRFDOLHQWDQGHIRUPDPX\OHQWD Cerámica de Vidrio Resistente al Calor: Se pueden usar para cualquier superficie o para cocción en el horno. Conduce el calor de forma muy lenta y se enfría de forma muy rápida. Consulte las instrucciones del fabricante de utensilios de estufa para saber con seguridad si se puede usar con estufas a gas. Parrillas para la Parte Superior de la Estufa No use cualquier repuesto de rejilla para la parte superior de la estufa con sus quemadores de gas, ya que realizará una combustión incompleta, generando niveles de monóxido de carbono superiores a los estándares permitidos. Esto puede ser peligroso para su salud. No use rejillas para la parte superior de la estufa. Cómo Usar un Wok 8VHVyORZRNVFRQEDVHSODQDGHXQGLiPHWURGHSXOJDGDV RPHQRV$VHJ~UHVHGHTXHHOIRQGRGHOZRNVHDSR\HGH forma plana sobre la rejilla. 1RXVHXQDQLOORGHVRSRUWHSDUDZRN&RORFDUHODQLOORVREUH el quemador o parrilla podrá hacer que el quemador funcione de forma inadecuada, produciendo niveles de monóxido de carbono que superan los estándares permitidos. Esto puede ser peligroso para su salud. 8VHXQZRNFRQIRQGRSODQR 49-2000781 Rev. 6 9 USO DE LA ESTUFA: Plancha Plancha (en algunos modelos) ADVERTENCIA Riesgo de Incendio 7HQJD FXLGDGR DO FRFLQDU FRPLGDV FRQ JUDVD /D JUDVD HVSDUFLGD SXHGH SURYRFDU XQ LQFHQGLR 1XQFD FRORTXH QL JXDUGH XQ DUWtFXOR HQ OD SODQFKD LQFOXVR FXDQGR QR HVWp HQ XVR (O FDORU GH ORV GHPiV quemadores puede calentar la plancha y provocar un incendio. &RORTXH \ UHWLUH OD SODQFKD VyOR FXDQGR WRGDV ODV SDUULOODV \ OD SODQFKD HVWpQ IUtDV \ WRGDV ODV XQLGDGHV superficiales estén en OFF (Apagado). Uso de su Plancha de Hierro Fundido El lado acanalado de la plancha reversible puede ser usado para comidas normalmente cocinadas a la plancha. Su plancha le brinda una superficie de cocción extra grande para carnes, panqueques y otras comidas normalmente preparadas en una sartén. Antes del primer uso, enjuague la misma con agua caliente y séquela completamente. Prepare la superficie con espray de estufa o aceite vegetal. Precauciones de la Plancha: 1R FRORTXH OD SODQFKD HQ XQ KRUQR PLFURRQGDV 1R ODYH OD SODQFKD HQ HO ODYDYDMLOODV 6L DOJR VH GHUUDPy GHEDMR GH OD SODQFKD VH GHEHUi OLPSLDU tan pronto como sea posible para evitar la suciedad de la comida "horneada". 1R SHUPLWD TXH VH DFXPXOH JUDVD GHEDMR GH OD SODQFKD \D que puede haber riesgo de incendio. Limpie debajo de la plancha con agua caliente y jabón en cuanto esté fría. Posicionamiento de la Plancha /D SODQFKD GH KLHUUR IXQGLGR VyOR SXHGH VHU XVDGD VREUH HO TXHPDGRUHV FHQWUDO GH OD SDUWH VXSHULRU GH OD HVWXID 3DUD SRVLFLRQDU OD SODQFKD UHWLUH OD UHMLOOD FHQWUDO GH HVWDU SUHVHQWH \ UHHPSODFH OD PLVPD SRU OD SODQFKD 1R JLUH HO TXHPDGRUHV central hasta que esté seguro de que la plancha se posicionó correctamente. Precalentamiento de la Plancha &RQ SODQFKD UHYHUVLEOH SUHFDOLHQWH HVWD ~OWLPD FRQILJXUDQGR DPERV TXHPDGRUHV FHQWUDOHV HQ +L $OWR GXUDQWH HQWUH \ PLQXWRV DQWHV GH FRORFDU FRPLGD VREUH OD SODQFKD 8QD YH] SUHFDOHQWDGD OD SODQFKD JLUH OD SHULOOD GHO TXHPDGRUHV KDVWD OD configuración de cocción resaltada en la tabla. Plancha Precurada de Hierro Fundido Reversible Tipo de Comida Panceta Embutidos para el Desayuno Huevos 4XHVR D OD 3ODQFKD Hamburguesas Panqueques Cómo Calentar Tortillas Configuración de Cocción Med Med %DMR /R Med Med Med %DMR /R Es posible que sea necesario ajustar las configuraciones de la plancha si se usará por un período prolongado. Reemplace la rejilla central por la plancha de hierro fundido reversible. 10 49-2000781 Rev. 6 USO DE LA ESTUFA: Controles del Horno Controles del Horno 1 10 2 8 9 10 3 10 6 5 9 4 1. Traditional Cooking Modes (Modos de 7. Freír con Aire: (OPRGR$LU)U\)UHtUFRQ$LUH Cocción Tradicionales): Su horno cuenta con ORVVLJXLHQWHVPRGRVGHFRFFLyQWUDGLFLRQDOHV%DNH +RUQHDU%URLO$VDUDQG:DUP&DOHQWDU3DUDPiV información, consulte la sección de Modos de Cocción al fue diseñado para producir comidas con un exterior más crocante que en la cocción de horno tradicional. Para más información, consulte la sección de Modos de Cocción en el Horno. Horno. 8. Sonda del Horno: Monitorea la temperatura 2. Convection Cooking Modes (Modos de Cocción por Convección): Los modos de cocción por convección utilizan una circulación de aire incrementada para mejorar el rendimiento. Para más información, consulte la sección de Modos de Cocción al Horno. interna de la comida y apaga el horno cuando la comida alcanza la temperatura programada. Inserte la sonda, presione el modo de cocción deseado, y programe la temperatura de la sonda. Para más información, consulte la sección de Modos de Cocción. La sonda sólo puede VHUXVDGDFRQODVIXQFLRQHV%DNH+RUQHDU&RQYHFWLRQ %DNH+RUQHDUSRU&RQYHFFLyQ\&RQYHFWLRQ5RDVW 3. Clean (Limpieza): El horno cuenta con dos modos GHOLPSLH]D6HOI&OHDQ/LPSLH]D$XWRPiWLFD\6WHDP &OHDQ/LPSLH]DFRQ9DSRU3DUDDFFHGHUDLQIRUPDFLyQ importante sobre el uso de estos modos, consulte la sección de Limpieza del Horno. 'RUDUSRU&RQYHFFLyQ 9. Lock Controls (Controles de Bloqueo) (en algunos modelos): %ORTXHDQHOFRQWURO de modo que al presionar las teclas no se activen los controles. Mantenga presionada la tecla Lock Controls 4. Start/Enter (Iniciar/ Ingresar): Se deberá presionar para comenzar cualquier función de cocción, limpieza o por tiempo. NOTA: Si la pantalla y las teclas se atenúan, abrir la puerta del horno o presionar cualquier (Controles de Bloqueo) durante tres segundos para bloquear o desbloquear el control. Cancel/Off (Cancelar/ Apagar) siempre está activa, incluso cuando el control está bloqueado. tecla activarán e iluminarán el control. 10. Cooking Options (Opciones de Cocción) 5. Cancel/Off (Cancelar/ Apagar): Cancela TODAS las funciones del horno, excepto el relo y, el temporizador. y Settings (Configuraciones): Las teclas &RRNLQJ2SWLRQV2SFLRQHVGH&RFFLyQ\6HWWLQJV &RQILJXUDFLRQHVDEUHQPHQ~VPiVGHWDOODGRVHQ 6. Timer (Temporizador): Funciona como un temporizador con cuenta regresiva. Presione la tecla Timer (Temporizador) y utilice las teclas numéricas para programar el tiempo en horas y minutos. Presione la tecla Start/Enter (Iniciar/ Ingresar). El horno continuará funcionando cuando la cuenta regresiva del temporizador se haya completado. Para apagar el temporizador, presione la tecla Timer (Temporizador). la pantalla, los cuales permiten acceso a funciones adicionales y modos de cocción. Para cada uno, seleccione la función en la pantalla a través de la tecla numérica asociada. Puede salir en cualquier momento presionando la tecla Cooking Options (Opciones de Cocción) o Settings (Configuraciones) nuevamente. Para más detalles, consulte las secciones de &RQILJXUDFLRQHV&RRNLQJ2SWLRQV2SFLRQHVGH&RFFLyQ y Modos de Cocción. 11. Oven Light (Luz del Horno) Enciende o apaga la luz del horno. El panel de control cuenta con una perilla que controla la luz del horno. 49-2000781 Rev. 6 11 USO DE LA ESTUFA:&RRNLQJ2SWLRQV2SFLRQHVGH&RFFLyQ6HWWLQJV&RQILJXUDFLRQHV Cooking Options (Opciones de Cocción) La tecla de Opciones de Cocción abre un menú con más modos de cocción cuando el horno está apagado. Abre un menu con funciones adicionales si un modo de cocción ya está en proceso. Puede salir del menú en cualquier momento presionando la tecla Cooking Options (Opciones de Cocción) nuevamente. Primero deberá seleccionar un modo (hornear, hornear por convección, dorar por convección) y luego seleccionar Cooking Options (Opciones de Cocción) para acceder a las siguientes funciones. Cook Time (Tiempo de Cocción) Cuenta el tiempo de cocción y apaga el horno cuando el tiempo de cocción está completo. Seleccione un modo de FRFFLyQGHVHDGR8VHODVWHFODVQXPpULFDVSDUDSURJUDPDUXQD temperatura de horneado. Presione la tecla Cooking Options (Opciones de Cocción) y seleccione Cook Time (Tiempo de Cocción)8VHODWHFODQXPpULFDSDUDSURJUDPDUXQWLHPSR de cocción en horas y minutos. Luego presione Start/Enter (Iniciar/ Ingresar). Esto sólo puede ser usado con las funciones %DNH+RUQHDU&RQYHFWLRQ%DNH+RUQHDUSRU&RQYHFFLyQ &RQYHFWLRQ5RDVW'RUDUSRU&RQYHFFLyQ\$LU)U\)UHtUFRQ $LUH Delay Time (Tiempo de Retraso) *HQHUDXQUHWUDVRFXDQGRHOKRUQRHVHQFHQGLGR8VHHVWD tecla para configurar el momento en que desee que el horno VHLQLFLH6HOHFFLRQHXQPRGRGHFRFFLyQGHVHDGR8VHOD tecla numérica para programar una temperatura de horneado. Presione la tecla Cooking Options (Opciones de Cocción) y seleccione Delay Time (Tiempo de Retraso)8VHODVWHFODV numéricas para programar la hora del día en que desee que el horno se encienda, y luego presione Start/Enter (Iniciar/ Ingresar)/DIXQFLyQ'HOD\5HWUDVRQRHVWiGLVSRQLEOHHQ todos los modos. NOTA:$OXVDUODIXQFLyQ'HOD\7LPH7LHPSRGH5HWUDVRODV comidas que se echan a perder rápidamente, tales como leche, huevo, pescado, rellenos, ave y cerdo, no se deberán dejar reposar por más de 1 hora antes y después de la cocción. La temperatura ambiente estimula el desarrollo de bacterias nocivas. Asegúrese de que la luz del horno esté apagada, ya que el calor de la lámpara acelerará el crecimiento de bacterias nocivas. Settings (Configuraciones) Las teclas Cooking Options (Opciones de Cocción)\6HWWLQJV&RQILJXUDFLRQHVDEUHQPHQ~VPiVGHWDOODGRVHQOD pantalla, los cuales permiten acceso a funciones adicionales. Para cada uno, seleccione la función en la pantalla a través de la tecla numérica asociada. Puede salir en cualquier momento presionando la tecla Cooking Options (Opciones de Cocción) o Settings (Configuraciones) nuevamente. Conexión WiFi y Acceso Remoto Su horno de está diseñado para brindarle una comunicación recíproca entre su electrodoméstico y dispositivos inteligentes. Mediante el uso de las funciones WiFi Connect, usted podrá controlar funciones esenciales de su horno tales como las configuraciones de temperatura, temporizadores y modos de cocción, utilizando su teléfono inteligente o tableta*. Seleccione las Settings (Configuraciones) y luego WiFi siga las instrucciones de la pantalla de su horno y de la aplicación de su teléfono. Es necesario activar la función WiFi antes de XVDU5HPRWH(QDEOH$FFHVR5HPRWRHQVXKRUQR Conexión de su Horno con Opción de WiFi Connect Qué necesitará Su horno de GE Appliances utiliza su red de WiFi hogareña existente para realizar la comunicación entre el electrodoméstico y su dispositivo inteligente. A fin de configurar su horno de GE Appliances, usted necesitará reunir cierta información: 1. Cada horno GE Appliances cuenta con una etiqueta de HOHFWURGRPpVWLFRFRQHFWDGRTXHLQFOX\HXQ,'GH83' del Electrodoméstico. Éste es un detalle importante que necesitará para realizar la conexión al electrodoméstico. La etiqueta está ubicada normalmente dentro de la puerta del horno o en el cajón. Connected Appliance Information Contains FCCID: ZKJ-WCATA009 UPD ID: XX-XX-XX-XX-XX-XX Contains IC: 10229A-WCATA009 MAC ID: D8-28-C9-XXXXXXXX PT. NO. XXXXXXXXXXXX Ejemplo de Etiqueta 2. Su teléfono inteligente o tableta deben estar preparados con la capacidad de acceder a Internet y descargar aplicaciones. 8VWHGGHEHUiFRQRFHUODFRQWUDVHxDGHOHQUXWDGRU:L)LGH su hogar. Tenga esta contraseña a mano al configurar el horno de GE Appliances. Conexión de su horno de GE Appliances 1. A través de su teléfono inteligente o tableta, visite ZZZ*($SSOLDQFHVFRPFRQQHFWSDUDDSUHQGHUPiV sobre las funciones del electrodoméstico conectado y para descargar la aplicación correspondiente. 2. Siga las instrucciones en pantalla de la aplicación para conectar su horno de GE Appliances. 8QDYH]TXHHOSURFHVRVHKD\DFRPSOHWDGRODOX] de conexión ubicada en la pantalla de su horno GE Appliances, permanecerá en sólido y la aplicación confirmará que usted está conectado. * Se requiere el uso de dispositivos y de una red WiFi hogareña que sean compatibles con Apple o Android. 12 49-2000781 Rev. 6 USO DE LA ESTUFA:6HWWLQJV&RQILJXUDFLRQHV 6HWWLQJV&RQILJXUDFLRQHV&RQWLQ~D Conexión WiFi y Acceso Remoto (cont.) 4. Si la luz de conexión no se enciende o está titilando, siga las instrucciones en la aplicación para volver a realizar la conexión. Si los problemas continúan, comuníquese al &RQQHFWHG&DOO&HQWHU&HQWURGH&RQH[LyQGH/ODPDGDV al 1.866.626.2000 y solicite asistencia en relación a la conectividad inalámbrica del horno. Para conectar dispositivos inteligentes adicionales, repita los pasos 1 y 2. Observe que todos los cambios o modificaciones al dispositivo de acceso remoto instalado en este horno que no están expresamente aprobados por el fabricante podrían anular la autoridad del usuario para operar el equipamiento. INICIO DEL HORNO EN FORMA REMOTA Para poder iniciar el horno en forma remota una vez conectado a WiFi, presione la tecla Remote Enable (Acceso Remoto) y el ícono se encenderá en la pantalla. El horno puede ser iniciado ahora de forma remota con un dispositivo conectado. Abrir una puerta del horno o apagar el horno hará que se apague el ícono . El ícono deberá estar iluminado para iniciar el horno de forma remota. No se requiere el ícono para modificar la temperatura del horno mientras esté funcionando, configurar un temporizador o apagar el horno desde la aplicación del teléfono mientras el ícono muestre que está Conectado a WiFi. Luego de usar el horno, recuerde verificar que el ícono esté iluminado, si desea iniciar el horno de forma remota en el futuro. NOTA: Las comidas que se echan a perder rápidamente, tales como leche, huevos, pescado, rellenos, ave y cerdo, no se deberán dejar reposar por más de 1 hora antes y después de la cocción. La temperatura ambiente estimula el desarrollo de bacterias nocivas. Asegúrese de que la luz del horno esté apagada, ya que el calor de la lámpara acelerará el crecimiento de bacterias nocivas. Clock (Reloj) Esta configuración ajusta el tiempo del reloj del horno. Presione la tecla Settings (Configuraciones) y seleccione Clock (Reloj). Seleccione Set Clock (Configurar Reloj) y siga las instrucciones para configurar el reloj. Esta función también especifica cómo se mostrará la hora del día. Puede seleccionar HOUHORMFRQKRUDHVWiQGDUGHKRUDV+ODKRUDPLOLWDU GHKRUDV+RTXHQRVHH[KLEDQLQJ~QUHORM2II $SDJDGR3UHVLRQHODWHFODSettings (Configuraciones), seleccione Set Clock (Configurar Reloj) y seleccione la opción 12/24 u On/Off (Encender/ Apagar). Bluetooth® - Chef Connect Se trata de una función de emparejamiento para uso con otros productos compatibles con Chef Connect, tales como un horno microondas para uso sobre la estufa o una campana de estufa. A fin de emparejar estos productos a la estufa, presione la tecla Settings (Configuraciones) y seleccione Bluetooth®. Seleccione Pair (Emparejar) y siga las instrucciones correspondientes incluidas con el producto de emparejamiento permitido por Chef Connect. La estufa cancelará el modo de emparejamiento luego de dos minutos, si no es detectado ningún dispositivo para emparejar. Seleccione Remove (Retirar) para confirmar que el producto está emparejado o para desemparejar el mismo de su estufa. La Sonda de Cocción de Precisión WDPELpQSXHGHVHUHPSDUHMDGDXVDQGRODIXQFLyQ%OXHWRRWK®. Auto Conv (Conversión Automática) $OXVDUODVRSFLRQHVGHFRFFLyQ&RQYHFWLRQ%DNH+RUQHDU SRU&RQYHFFLyQR&RQYHFWLRQ5RDVW'RUDUSRU&RQYHFFLyQ $XWR5HFLSH&RQYHUVLRQ&RQYHUVLyQGH5HFHWD$XWRPiWLFD convertirá de forma automática las temperaturas de horneado regular ingresadas a temperaturas de cocción de horneado por convección cuando se active. Se debe observar que esta opción no convierte los tiempos de cocción del horneado por convección, sino sólo las temperaturas. Esta función podrá ser encendida o apagada. Seleccione Settings (Configuraciones) y Auto Conversion (Conversión Automática), y luego siga las indicaciones para activar o desactivar esta función. Auto Off (Apagado Automático) Esta función apaga el horno luego de 12 horas de funcionamiento continuo. Podrá estar activada o desactivada. Seleccione Settings (Configuraciones), More (Más), y Auto Off (Apagado Automática) para activar o desactivar esta función. Sound (Sonido) Podrá ajustar el volumen y el tipo de alerta que su dispositivo utilice. Seleccione Settings (Configuraciones), More (Más), y Sound (Sonido). Siga las instrucciones para realizar ajustes de volumen o para cambiar entre tonos de alerta continuos o VLPSOHV8QDFRQILJXUDFLyQFRQWLQXDVHJXLUiKDFLHQGRTXHXQ tono suene hasta que un botón del control sea presionado. El volumen del tono del horno podrá ser ajustado. El control hará que el tono del horno suene en el nuevo nivel de volumen cada vez que el nivel de sonido sea modificado. F/C (Fahrenheit o Celsius) El control del horno está configurado para su uso con WHPSHUDWXUDV)DKUHQKHLW)SHURSXHGHVHUPRGLILFDGR DWHPSHUDWXUDV&HOVLXV&6HOHFFLRQHSettings (Configuraciones), More (Más), y F/C para alternar entre las escalas de temperatura exhibidas. Adjust the Oven temperature (Ajuste de la Temperatura del Horno) Esta función permite que la temperatura de horneado del horno y de horneado por convección sean ajustadas hasta 35°F más FDOLHQWHR)PiVIUtD8VHHVWDIXQFLyQVLFRQVLGHUDTXHOD temperatura de su horno está demasiado caliente o demasiado IUtD\GHVHDPRGLILFDUOD(VWHDMXVWHDIHFWDORVPRGRV%DNH +RUQHDU\&RQYHFWLRQ%DNH+RUQHDUSRU&RQYHFFLyQ1R PRGLILFDORVPRGRV3URRI/HXGDUR&OHDQLQJ/LPSLH]D Seleccione Settings (Configuraciones) y Oven Adjust (Ajuste del Horno) para agregar More Heat (Más Calor) o Less Heat (Menos Calor) y luego presione Save (Guardar). Oven Info (Información del Horno) Seleccione Settings (Configuraciones), More (Más), y Oven Info (Información del Horno) para activar o desactivar esta función. Esta configuración muestra el Número de Modelo y la Versión del Software. 49-2000781 Rev. 6 13 USO DE LA ESTUFA: Modo Sabático Modo Sabático (O PRGR 6DEEDWK 6DEiWLFR LQFOX\H OD GHVDFWLYDFLyQ GH WRQRV GHVDFWLYDFLyQ GH OXFHV GHO KRUQR \ UHWUDVRV GH DSUR[LPDGDPHQWH 30 segundos a un minuto en los cambios de pantalla. Sólo el horneado continuo o los horneados con temporizador continúan DFWLYDGRV HQ HO PRGR 6DEEDWK 6DEiWLFR /D FRFFLyQ HQ HO PRGR VDEiWLFR HV XQ SURFHVR GH GRV SDVRV SULPHUR HO PRGR VDEiWLFR debe ser configurado y luego el modo hornear debe ser configurado. Configuración del Modo Sabático Presione la tecla Settings (Configuraciones), seleccione Sabbath (Sabático) y seleccione Turn On (Encender) 8Q VROR corchete "]" aparecerá en la pantalla, indicando que el modo sabático fue configurado. El reloj no aparecerá. El horneado continuo o el horneado por tiempo no pueden ser configurados. Inicio del Horneado Continuo 1. Presione la tecla Bake (Hornear) 3DUD KRUQRV GREOHV permite utilizar el horno superior. Si se desea usar el Horno ,QIHULRU SUHVLRQH /RZHU 2YHQ +RUQR ,QIHULRU \ OXHJR %DNH +RUQHDU 2. Si la temperatura deseada es 350ºF, presione Start/ Enter (Iniciar/ Ingresar). Si se desea una temperatura de cocción diferente, use las teclas numéricas de 1 a 5 para seleccionar una temperatura de cocción predeterminada, y luego presione Start/Enter (Iniciar/ Ingresar). Consulte el siguiente gráfico para determinar qué tecla configura la temperatura de cocción deseada. Luego de una demora, un segundo corchete "] [" aparecerá en la pantalla, indicando que el horno está horneando. 7HPSHUDWXUD ) 200 250 300 7LHPSR KRUDV 325 400 2h 2.5h 3h 3.5h Ajuste de Temperatura 1. Presione Bake (Hornear) R SUHVLRQH /RZHU 2YHQ +RUQR ,QIHULRU \ OXHJR %DNH +RUQHDU SDUD XVDU HO KRUQR LQIHULRU HQ XQ XQLGDG FRQ KRUQR GREOH XVH ODV WHFODV QXPpULFDV GH 1 a 5 para seleccionar una temperatura de cocción actual diferente, y presione Start/Enter (Iniciar/ Ingresar). 2. Debido a que no hay ninguna indicación durante el cambio de temperatura, se puede usar un termómetro para horno para confirmar los cambios de temperatura. Inicie un Horneado por Tiempo 1. Presione la tecla Bake (Hornear). 2. Si la temperatura deseada es de 350ºF, use las teclas numéricas de 6 a 0 para seleccionar un tiempo de cocción. Si se desea una temperatura de cocción diferente a 350ºF, use las teclas numéricas de 1 a 5 para seleccionar una temperatura de cocción predeterminada, y luego seleccione el tiempo de cocción. Consulte el gráfico en esta página para determinar qué tecla configura la temperatura de cocción deseada y el tiempo de cocción. 3. Presione Start/Enter (Iniciar/ Ingresar). Luego de una demora, un segundo corchete "] [" aparecerá en la pantalla, indicando que el horno está horneando. Cuando el tiempo de cocción finalice, la pantalla volverá a cambiar a un solo corchete "]", indicando que el horno ya no está horneando. No sonará ningún tono cuando el tiempo de cocción se haya completado. Salir del Modo Sabático Sólo se deberá salir del modo sabático una vez finalizado el mismo. 1. Presione Cancel/Off (Cancelar/ Apagar) para finalizar cualquier ciclo de horneado que pueda estar funcionando. 2. Mantenga presionada la tecla Settings (Configuraciones) hasta que se muestre Sabbath Mode off (Modo Sabático apagado). 4h 1 = 200°F, 2 = 250°F, 3 = 300°F, 4 = 325°F, 5 = 400°F 6 = 2 horas, 7 = 2.5 horas 8 = 3 horas, 9 = 3.5 horas, 0 = 4 horas Aviso de Corte de Corriente durante el Modo Sabático Si se produce un corte de corriente mientras el horno se HQFXHQWUD HQ 6DEEDWK 0RGH 0RGR 6DEiWLFR OD XQLGDG UHJUHVDUi D 6DEEDWK 0RGH 0RGR 6DEiWLFR FXDQGR HO suministro sea reestablecido; sin embargo, el horno regresará al estado de apagado incluso cuando haya estado en un ciclo de horneado en el momento del corte de corriente. 14 49-2000781 Rev. 6 USO DE LA ESTUFA:(VWDQWHVGHO+RUQR3DSHOGH$OXPLQLR8WHQVLOLRV Estantes del Horno El horno cuenta con seis posiciones de estantes. En la Guía de Cocción, se brindan recomendaciones de posiciones de los estantes para diferentes tipos de comidas. Se ajusta un estante en una dirección para afectar los resultados de cocción. Por ejemplo, si se prefieren partes superiores más oscuras en tartas, panecillos o galletas, pruebe moviendo la comida a un estante que se encuentre una posición más arriba. Si encuentra que las comidas están demasiado doradas en la parte superior, pruebe moviendo las mismas más abajo la próxima vez. Al hornear con múltiples ollas y en múltiples estantes, DVHJ~UHVHGHTXHKD\DSRUORPHQRV´HQWUHODVROODVDILQ de dejar suficiente espacio para que fluya el aire. (VSRVLEOHTXHVXKRUQRFXHQWHFRQHVWDQWHVH[WHQVLEOHV\R estantes planos tradicionales. Para evitar posibles quemaduras, coloque los estantes en la posición deseada antes de encender el horno. Retiro y Reemplazo de los Estantes Planos Al colocar y retirar utensilios de estufa, empuje el estante hacia DIXHUDGHOWRSHSRVLFLyQGHGHWHQFLyQVREUHHOVRSRUWHGHOHVWDQWH Para retirar un estante, empuje el mismo hacia usted hasta alcanzar la posición donde se detiene, incline el frente hacia arriba y empuje hacia afuera. Para reemplazar un estante, coloque el extremo curvado del mismo sobre los soportes de los estantes. Incline el frente del estante hacia arriba y empuje el mismo hasta que se detenga. Luego apoye el estante y empuje el mismo hasta que entre completamente en el horno. Es posible que resulte difícil deslizar los estantes, especialmente luego de un ciclo de limpieza automática. Para mejorar las condiciones de deslizamiento, use una tela suave o una toalla de papel para frotar aceite vegetal sobre los H[WUHPRVL]TXLHUGR\GHUHFKRGHORVHVWDQWHV\RVREUHORV soportes del estante. NOTA: Retire los estantes en desuso al usar el horno para un precalentamiento más rápido, mayor eficiencia y un rendimiento óptimo de la cocción. La cantidad de posiciones de la bandeja puede variar en relación al modelo. Posición de detención del estante Retiro de los estantes Reemplazo de los estantes Papel de Aluminio y Cobertores del Horno PRECAUCIÓN 1RXVHQLQJ~QWLSRGHDOXPLQLRRFREHUWRUGHKRUQRSDUDFXEULUHOIRQGRGHOKRUQR(VWRVtWHPV pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. Los daños por uso inadecuado de estos ítems no están cubiertos por la garantía del producto. Se podrá usar aluminio para evitar derrames, colocando una hoja sobre un estante inferior varias pulgadas debajo de la comida. No use más aluminio que el necesario y nunca cubra totalmente el estante de un horno con papel de aluminio. Mantenga el DOXPLQLRDSRUORPHQRV´GHODVSDUHGHVGHOKRUQRSDUDHYLWDUXQDFLUFXODFLyQGHILFLHQWHGHOFDORU 49-2000781 Rev. 6 15 USO DE LA ESTUFA: Modos de Cocción en Horno Modos de Cocción en Horno Su horno posee una variedad de modos de cocción para que pueda obtener los mejores resultados. Estos modos se describen a continuación. Para acceder a recomendaciones para comidas específicas, consulte la sección de la Guía de Cocción. Recuerde que es posible que su nuevo horno funcione de manera diferente que aquel que está reemplazando. Bake (Hornear) El modo de horneado tradicional fue diseñado para la cocción en un solo estante. Este modo usa el calor principalmente desde el elemento inferior, pero también desde el elemento superior para cocinar la comida. Generalmente se recomienda realizar el calentamiento previo al usar este modo. Para usar este modo, presione la tecla Bake (Hornear), ingrese una temperatura con las teclas numéricas, y luego presione Start/ Enter (Iniciar/ Ingresar). Convection Bake Multi Rack (Estantes 0~OWLSOHVSDUD+RUQHDUSRU&RQYHFFLyQ (OPRGR&RQYHFWLRQ%DNH0XOWL5DFN+RQHDUSRU&RQYHFFLyQ HQ(VWDQWHV0~OWLSOHVHVWiSHQVDGRSDUDKRQHDUHQ múltiples estantes al mismo tiempo. Este modo utiliza el calor principalmente desde el elemento trasero, pero también calor desde los elementos superior e inferior, junto con el movimiento de aire desde el ventilador por convección para mejorar una cocción pareja. El horno está equipado con ODIXQFLyQ$XWR5HFLSH&RQYHUVLRQ&RQYHUVLyQGH5HFHWD $XWRPiWLFDGHPRGRTXHQRHVQHFHVDULRFRQYHUWLUOD temperatura al usar este modo. Es posible que el tiempo de horneado sea un poco más prolongado con estantes múltiples, en comparación con lo que se espera con un solo estante. Para usar este modo, presione la tecla Conv Bake (Hornear por Convección), e ingrese una temperatura con las teclas numéricas, y luego presione Start/Enter (Iniciar/ Ingresar). Convection Roast (Dorar por Convección) Este modo está pensado para dorar cortes enteros de carne en un solo estante. La utilización de los tres elementos y el flujo de aire directo desde la parte superior del horno mejoran el nivel de dorado y reducen el tiempo de cocción. Controle la comida antes de lo sugerido por la receta o use una sonda al utilizar este modo. Para usar este modo, presione la tecla Conv Roast (Dorar por Convección), ingrese una temperatura con las teclas numéricas, y luego presione Start/ Enter (Iniciar/ Ingresar). Modo para Asar Siempre ase con la puerta cerrada. El elemento para asar en el horno es muy potente. Monitoree la comida de cerca al asar. Tenga cuidado al asar en estantes de posiciones superiores, ya que colocar la comida más cerca del elemento para asar incrementa el humo, salpicaduras y la posibilidad de que se incendien las grasas. No se recomienda asar en el estante de la posición 6. La función para asar puede ser usada en comidas que típicamente serían a la parrilla. Ajuste la posición del estante para variar la intensidad del calor que llega a la comida. Coloque la comida más cerca del elemento para asar, cuando se desee una superficie más soasada y un interior poco cocido. Para un mejor rendimiento, centre la comida debajo del elemento que emite calor para asar. 3UHVLRQHODWHFOD%URLO$VDUGRVYHFHVSDUDFRQILJXUDU+LJK $OWD\XQDYH]SDUD/RZ%DMDGHSHQGLHQGRGHODFDQWLGDG de dorado y de la temperatura interior que se prefieran. La FRQILJXUDFLyQ+LJK$OWDHVPHMRUSDUDFRUWHVPiVGHOJDGRV GHFDUQH\RFRPLGDVTXHSUHILHUDTXHTXHGHQPHQRVFRFLGDV HQVXLQWHULRU/DFRQILJXUDFLyQ/RZ%DMDHVSUHIHULGDSDUD cortes más gruesos de carne y comidas que desea que sean cocinadas completamente. No es necesario precalentar el horno en estos modos. Luego presione Start/Enter. Air Fry (Freír con Aire) $LU)U\)UHtUFRQ$LUHHVXQPRGRGHFRFFLyQHVSHFLDOVLQ precalentamiento, que fue diseñado para producir comidas que en su exterior queden más crocantes que en la cocción HQKRUQRVWUDGLFLRQDOHV(OPRGR$LU)U\)UHtUFRQ$LUHIXH diseñado para la cocción en un solo estante únicamente. Presione la tecla Air Fry (Freír con Aire) y luego ingrese la configuración de temperatura deseada y presione Start ,QLFLDU/DWHPSHUDWXUDVHSRGUiFRQILJXUDUHQWUH)\ 500°F. No es necesario precalentar en este modo. Siga las pautas de la receta tradicional para horno o del paquete en relación a los ajustes de temperatura y tiempos de cocción; ajuste el tiempo de cocción para lograr la textura crocante deseada. Se podrán encontrar pautas adicionales para utilizar este modo en la Guía de Cocción. Baked Goods (Productos Horneados) (OPRGR%DNHG*RRGV3URGXFWRV+RUQHDGRVIXHGLVHxDGR para cocinar tortas, panes, galletas, y comidas similares en un solo estante. Este modo fue diseñado para brindar un dorado superior más leve y un mejor volumen. Algunas comidas podrán requerir tiempos de cocción más prolongados en relación a cuando se estufa en el modo de horneado tradicional. Presione la tecla Opciones de Cocción y seleccione Baked Goods (Productos Horneados) y luego siga las instrucciones en pantalla para acceder a este modo. Frozen Snacks (Refrigerios Congelados) /RVPRGRV)UR]HQ6QDFNV5HIULJHULRV&RQJHODGRVIXHURQ diseñados para cocinar comidas congeladas tales como medallones de papa, papas fritas, y refrigerios congelados y aperitivos similares. La mayoría de las comidas se cocinarán dentro de los tiempos que aparecen recomendados en el paquete. Ajuste el tiempo de cocción de acuerdo con sus preferencias individuales. Presione la tecla Opciones de Cocción y seleccione Frozen (Congelado), y luego siga las instrucciones en pantalla para acceder a este modo. 8VHODIXQFLyQ)UR]HQ6QDFNV6LQJOH5HIULJHULRV&RQJHODGRV HQXQ6ROR(VWDQWHFXDQGRFRFLQHUHIULJHULRVHQXQVROR estante. Este modo no requiere el precalentamiento del horno. La comida deberá ser colocada en el horno antes o inmediatamente al iniciar el modo. 8VHODIXQFLyQ)UR]HQ6QDFNV0XOWL5HIULJHULRV&RQJHODGRV HQ0~OWLSOHV(VWDQWHVFXDQGRFRFLQHUHIULJHULRVFRQJHODGRV en dos estantes simultáneamente. Este modo incluye un ciclo de precalentamiento para preparar el horno para hornear en múltiples estantes. 16 49-2000781 Rev. 6 USO DE LA ESTUFA: 0RGRVGH&RFFLyQHQ+RUQR9HQWLODFLRQHVGH$LUHGHO+RUQR6RQGDGHO+RUQR 0RGRVGH&RFFLyQHQ+RUQR&RQWLQ~D Frozen Pizza (Pizza Congelada) /RVPRGRVGH)UR]HQ3L]]D3L]]D&RQJHODGDIXHURQ diseñados para cocinar pizzas congeladas. La mayoría de las pizzas se cocinarán dentro de los tiempos que aparecen recomendados en el paquete. Ajuste el tiempo de cocción de acuerdo con sus preferencias individuales. Presione la tecla Opciones de Cocción y seleccione Frozen (Congelado), y luego siga las instrucciones en pantalla para acceder a este modo. 8VHODIXQFLyQ)UR]HQ3L]]D6LQJOH3L]]D&RQJHODGDHQXQ (VWDQWHFXDQGRFRFLQHHQXQVRORHVWDQWH(VWHPRGRQR requiere el precalentamiento del horno. La comida deberá ser colocada en el horno antes o inmediatamente al iniciar el modo. 8VHHOPRGR)UR]HQ3L]]D3L]]D&RQJHODGDDOFRFLQDUHQ dos estantes de forma simultánea. Este modo incluye un ciclo de precalentamiento para preparar el horno para hornear en múltiples estantes. Warm (Calentar) (OPRGR:DUP&DOHQWDUIXHGLVHxDGRSDUDPDQWHQHU comidas calientes en una temperatura más alta hasta durante 3 horas. No se requiere precalentar las mismas. No use la IXQFLyQ:DUP&DOHQWDUSDUDFDOHQWDUFRPLGDIUtDH[FHSWR galletas crocantes, papas fritas o cereales secos. También se recomienda que la comida no se mantenga caliente por más de 2 horas. Presione la tecla Warm (Calentar) y luego presione Start/Enter (Iniciar/ Ingresar). Proof (Leudar) (OPRGR3URRI/HXGDUHVWiGLVHxDGRSDUDHOHYDUIHUPHQWDU\ OHXGDUPDVDVGHSDQ&XEUDELHQODPDVDSDUDHYLWDUTXHVH seque. El pan se elevará más rápidamente que a temperatura ambiente. NOTA: 1RXVHHOPRGR3URRI/HXGDUSDUDFDOHQWDU comida o mantener la comida caliente. La temperatura del horno al leudar no está lo suficientemente caliente como para mantener las comidas a temperaturas seguras. Presione la tecla Opciones de Cocción y seleccione Proof (Leudar), y luego siga las instrucciones en pantalla o presione la tecla Proof (Leudar) HQ DOJXQRVPRGHORVSDUDDFFHGHUDHVWHPRGR Ventilaciones de Aire del Horno 1XQFDEORTXHHODVYHQWLODFLRQHVDEHUWXUDVGHDLUHGHOD estufa. Las mismas brindan las entradas y salidas de aire que son necesarias para que la estufa se mantenga fresca y funcione de forma correcta con la combustión adecuada. Las aberturas de aire se encuentran ubicadas en la parte trasera de la estufa, en la parte superior e inferior de la puerta del horno, y en la parte inferior de la estufa. La apariencia y la ubicación de la ventilación varían. Sonda del Horno (en algunos modelos) ADVERTENCIA El consumo de comida semicruda puede hacer que se contraigan enfermedades producidas por la comida. Use la sonda de acuerdo con las siguientes instrucciones, a fin de asegurar que todas las partes de la comida alcancen temperaturas de cocción mínimamente seguras. Puede encontrar recomendaciones de temperaturas de cocción mínimamente seguras en foodsafety.gov o en IsItDoneYet.gov. La temperatura interna de la comida con frecuencia se usa como indicador de que está lista, especialmente al dorar o SUHSDUDUFDUQHGHDYH(OPRGR3UREH6RQGDPRQLWRUHDOD temperatura interna de la comida y apaga el horno cuando esta última alcanza la temperatura programada. Controle siempre la temperatura en múltiples partes de la comida, utilizando un termómetro de comidas luego de realizar la cocción, a fin de asegurar que todas las partes de la misma hayan alcanzado una temperatura interna mínimamente segura en dicha comida. Ubicación Correcta de la Sonda Luego de preparar la comida y de colocarla en la olla, siga estas instrucciones para una ubicación correcta de la sonda. ,QVHUWHODVRQGDHQODFRPLGDGHPRGRTXHODSXQWDGH la sonda se apoye en el centro de la parte más gruesa de la comida. Para un mejor rendimiento, la sonda debería ser completamente insertada en la comida. Si la sonda no es ubicada correctamente, es posible que no mida con precisión la temperatura de la parte más fría de la comida. Algunas comidas, particularmente las más pequeñas, no son adecuadas para la cocción con el uso de una sonda, debido a sus formas o tamaños. 1RGHEHUtDWRFDUHOKXHVRODJUDVDQLHOFDUWtODJR 3DUDFRFLQDUXQDYHHQWHUDLQVHUWHODVRQGDHQODSDUWH más gruesa de la pechuga. 3DUDGRUDUVLQKXHVRVLQVHUWHODVRQGDHQHOFHQWURGHO dorado. 3DUDFRFLQDUMDPyQRFRUGHURFRQKXHVRVLQVHUWHOD sonda en el centro de la articulación o del músculo más bajo y largo. 3DUDSUHSDrar cazuelas o platos tales como pastel de carne, inserte la sonda en el centro del plato. 3DUDFRFLQDUSHVFDGRLQVHUWHODVRQGDMXVWRDUULEDGHOD agalla en la zona más carnosa paralela a columna. 49-2000781 Rev. 6 17 USO DE LA ESTUFA:6RQGDGHO+RUQR*XtDGH&RFFLyQGHO+RUQR Sonda del Horno (en algunos modelos) Uso de la Sonda La sonda de temperatura sólo puede ser usada con las IXQFLRQHV%DNH+RUQHDU&RQYHFWLRQ%DNH+RUQHDUSRU &RQYHFFLyQ\&RQYHFWLRQ5RDVW'RUDUSRU&RQYHFFLyQ Para usar la sonda con precalentamiento: &RQILJXUHHOPRGRGHFRFFLyQGHVHDGRHornear, Hornear por Convección, o Dorar por ConvecciónHLQJUHVHOD temperatura de cocción deseada con las teclas numéricas. 2. Inserte la sonda en la comidaFRQVXOWHVREUHOD8ELFDFLyQ &RUUHFWDGHOD6RQGD 8QDYH]TXHHOKRUQRIXHSUHFDOHQWDGRFRORTXHODFRPLGD en el mismo y conecte la sonda en su correspondiente tomacorriente, asegurándose de que esté completamente insertada. Tenga cuidado, ya que las paredes del horno y el tomacorriente de la sonda están calientes. 4. Cuando la sonda esté conectada, la pantalla le indicará que ingrese la temperatura deseada para la comida. La temperatura interna máxima de la comida que se puede configurar es 200° F.. Para usar la sonda sin precalentamiento: ,QVHUWHODVRQGDHQODFRPLGDFRQVXOWHVREUHOD8ELFDFLyQ &RUUHFWDGHOD6RQGD 2. Coloque la comida en el horno y conecte la sonda en su correspondiente tomacorriente en el horno. 3. Presione la tecla del modo de cocción deseado Horneado Tradicional, Hornear por Convección, o Dorar por ConvecciónHLQJUHVHODWHPSHUDWXUDGH cocción deseada con las teclas numéricas. Seleccione Probe (Sonda) y luego siga las instrucciones en pantalla para ingresar la temperatura deseada para la comida. 6LVHXVDXQDVRQGDTXHQRVHDODSURYLVWDFRQHVWH producto, se podrán producir daños sobre la salida de la sonda. 8VHODVPDQLMDVGHODVRQGDDOHQFKXIDU\GHVHQFKXIDUOD misma, luego de insertar o de retirar la sonda de la carne o del tomacorriente. 3DUDHYLWDUGDxRVVREUHODVRQGDQRXVHDJDUUDGHUDVSDUD empujar el cable al retirarlo. 3DUDHYLWDUURPSHUODVRQGDDVHJ~UHVHGHTXHOD comida haya sido completamente descongelada antes de insertarla. 3DUDHYLWDUSRVLEOHVTXHPDGXUDVQRGHVHQFKXIHODVRQGD del tomacorriente del horno hasta que este último se haya enfriado. 1XQFDGHMHODVRQGDGHQWURGHOKRUQRGXUDQWHXQFLFORGH limpieza automática o de limpieza con vapor. 1RJXDUGHODVRQGDGHQWURGHOKRUQR Pautas para el Cuidado de la Sonda Guía de Cocción del Horno Cocine la comida completamente para evitar que se produzcan enfermedades a partir de la comida. Puede encontrar recomendaciones sobre temperatura mínima para cocinar de forma segura en IsItDoneYet.gov8VHXQWHUPyPHWURGHFRPLGDSDUD medir las temperaturas de la comida. Pautas de Uso de Utensilios El material, el acabado y el tamaño de los utensilios afectan el horneado. Las ollas oscuras, revestidas y opacas absorben el calor más rápidamente que las ollas claras y brillantes. Al usar ollas que absorben el calor más rápidamente, las comidas podrán resultar más doradas, crocantes y con una capa más gruesa. Si utiliza utensilios oscuros y revestidos, controle la comida antes del tiempo mínimo de cocción. Si se obtienen resultados no deseados con este tipo de utensilios, considere la posibilidad de reducir la temperatura del horno en 25°F la próxima vez. Las ollas brillantes pueden producir resultados de horneado más parejos en tortas y galletas. Las ollas de vidrio y cerámica calientan con lentitud, pero retienen bien el calor. Estos tipos de ollas funcionan bien con platos tales como tartas y postres con natilla. Las ollas con aislante de aire calientan lentamente y pueden producir fondos dorados. Mantenga los utensilios limpios para una cocción más pareja. La cerámica calienta de forma lenta y retiene bien el calor. Si es posible, se recomienda precalentar este tipo de utensilios. Se podrá requerir tiempo de cocción adicional. El utensilio usado en los modos para asar y freír con aire deberá ser de uso seguro para asar. 18 49-2000781 Rev. 6 USO DE LA ESTUFA: Guía de Cocción del Horno Guía de Cocción del Horno TIPO DE COMIDA Productos Horneados Tortas con capas, tortas rectangulares, roscas, panecillos, pan rápido en un Solo Estante Tortas con capas* en Múltiples Estantes 7RUWDVGHJUDVDSDVWHOGHiQJHO Galletas, galletitas, bizcochitos en un Solo Estante Galletas, galletitas, bizcochitos en Múltiples Estantes Panes de Levadura Bife y Cerdo Hamburguesas %LIHV\&KXOHWDV Dorados Ave Pollo entero Pechugas, patas, muslos con huesos Pechugas de pollo deshuesadas Pavo entero Pechuga de Pavo Pescado Cazuelas Comidas Congeladas a Conveniencia Pizza en un Estante Simple Pizza en Estantes Múltiples Productos con papa, patitas de pollo fritas, aperitivos en un Solo Estante Productos con papa, patitas de pollo fritas, aperitivos en Múltiples Estantes MODO(S) RECOMENDADO(S) Hornear Productos Horneados Hornear Horneado por Convección Hornear Productos Horneados Hornear Productos Horneados Horneado por Convección Leudar Hornear Productos Horneados Asar Alto Asar Alto Hornear Dorado por Convección Hornear Dorado por Convección $VDGR%DMR Hornear $VDGR%DMR Hornear Hornear Dorado por Convección Hornear Dorado por Convección $VDGR%DMR Hornear Pizza Congelada Simple Pizza Congelada Múltiple Refrigerios Congelados Simples Refrigerios Congelados Múltiples POSICIÓN(ES) DE ESTANTES RECOMENDADA 3 3 plano y 5 plano 1 4 3 plano y 5 plano 2 ext., 4 plano, 6 plano 3 o 4 3 o 4 6 plano 6 plano o 5 ext. 2 o 3 2 o 3 3 3 1 3 PLWDGGHOJURVRURPHQRV !SXOJDGD 3 o 4 4 3 y 5 4 3 y 5 SUGERENCIAS ADICIONALES 8VHXWHQVLOLRVEULOODQWHV 8VHXWHQVLOLRVEULOODQWHV$VHJ~UHVHGHTXHKD\DXQIOXMRGHDLUHDGHFXDGR 9HDODLOXVWUDFLyQ 8VHXWHQVLOLRVEULOODQWHV 8VHXWHQVLOLRVEULOODQWHV 8VHXWHQVLOLRVEULOODQWHV$VHJ~UHVHGHTXHKD\DXQIOXMRGHDLUHDGHFXDGR Cubra la masa sin mucha rigidez. 8VHODSDUWHSDUDDVDUPXHYDODFRPLGDPiVDEDMRSDUDTXHTXHGHPiV preparada y menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento que emite calor para asar. 8VHODSDUWHSDUDDVDUPXHYDODFRPLGDPiVDEDMRSDUDTXHTXHGHPiV preparada y menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento que emite calor para asar. 8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU No se requiere precalentarla. 8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU No se requiere precalentarla. 6LVHHPSDQyRFXEULyFRQVDOVDHYLWHORVPRGRV%URLO+LJK$VDU$OWR$VH del lado de la piel hacia abajo primero. Para un mejor rendimiento al asar, centre la comida debajo del elemento que emite calor para asar. Mueva la comida más abajo para que quede más preparada y menos VRDVDGD\PiVDUULEDSDUDVRDVDUGRUDUDODVDU3DUDXQPHMRUUHQGLPLHQWR al asar, centre la comida debajo del elemento que emite calor para asar. 8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU No se requiere precalentarla. 8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU No se requiere precalentarla. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Coloque la comida en el horno antes de iniciar el modo. Escalone las pizzas de izquierda a derecha, y no las coloque directamente una sobre otra. &RORTXHODFRPLGDHQHOKRUQRDQWHVGHLQLFLDUHOPRGR8VHXQXWHQVLOLR RVFXURSDUDTXHTXHGHPiVGRUDGRFURFDQWHXVHXWHQVLOLRVEULOODQWHVSDUD un menor dorado. 8VHXQXWHQVLOLRRVFXURSDUDTXHTXHGHPiVGRUDGRFURFDQWHXVH utensilios brillantes para un menor dorado. *Al hornear cuatro capas de torta a la vez, use los estantes 3 y 5. Coloque las ollas como se muestra, de modo que no quede una olla encima de la otra. Cocine la comida completamente para evitar que se produzcan enfermedades a partir de la comida. Puede encontrar recomendaciones sobre temperatura mínima para cocinar de forma segura en www.IsItDoneYet.gov. Asegúrese de usar un termómetro de comidas para medir la temperatura de las mismas. 8ELFDFLyQ7UDVHUD 8ELFDFLyQ)URQWDO Posiciones de los Estantes 49-2000781 Rev. 6 19 USO DE LA ESTUFA: Guía de Cocción del Horno Guía de Cocción del Horno Modo de Cocción para Freír con Aire $LU )U\ )UHtU FRQ $LUH HV XQ PRGR GH FRFFLyQ HVSHFLDO VLQ precalentamiento, que fue diseñado para producir comidas que en su exterior queden más crocantes que en la cocción en hornos tradicionales. Presione la tecla Air Fry (Freír con Aire), y luego ingrese la configuración de temperatura GHVHDGD \ SUHVLRQH 6WDUW ,QLFLDU /D WHPSHUDWXUD VH SXHGH configurar entre 300°F and 500°F. Pautas sobre Utensilios para Freír con Aire 8VH XWHQVLOLRV GH XVR VHJXUR SDUD DVDU DO XWLOL]DU HO PRGR $LU )U\ )UHtU FRQ $LUH 6H UHFRPLHQGD HO XVR GH XQD ROOD GH OiPLQD RVFXUD 8QD bandeja oscura promueve un mejor dorado y logra que la comida quede más crocante. · También se podrán usar canastas de horneado en el horno y rejillas de horneado. Se deberá colocar una bandeja plana sobre el estante debajo de las comidas, a fin de atrapar cualquier goteo al usar la canasta de horneado. 8WHQVLOLR SULQFLSDO UHFRPHQGDGR Consejos Generales sobre el Modo para Freír con Aire (O PRGR $LU )U\ )UHtU FRQ $LUH IXH GLVHxDGR SDUD FRFLQDU HQ un solo estante. (O PRGR $LU )U\ )UHtU FRQ $LUH IXH GLVHxDGR SDUD XQ XVR VLQ precalentamiento. · Se recomienda la posición del estante 4 para la mayoría de ODV FRPLGDV 8VH OD SRVLFLyQ GHO HVWDQWH SDUD FRPLGDV PiV gruesas. · Las comidas se podrán cocinar más rápido de lo esperado si el horno ya está caliente al colocar la comida en el mismo. · Al freír con aire comidas con salsa, se recomienda incorporar la salsa al final de la cocción. · Si la comida se dora demasiado rápido, intente colocar la misma en un estante que se encuentre en un posición más baja o en una configuración de temperatura de horno más baja. · En el caso de comidas empaquetadas, utilice las instrucciones de cocción tradicionales para horno en relación a configuración de temperatura y tiempos de cocción esperados. · No es necesario voltear o revolver la comida durante la cocción. 8ELTXH OD FRPLGD HQ XQD VROD FDSD VREUH OD EDQGHMD VLQ sobrecargar la misma. · Siempre controle la temperatura interior de la comida, a fin de confirmar que se hayan alcanzado las temperaturas mínimas seguras. Las temperaturas mínimas seguras de la comida se podrán encontrar en los paquetes y en IsItDoneYet.gov. Opciones de utensilios alternativos TIPO DE COMIDA Trozos de pescado fresco deshuesado o ave, empanados en forma de patitas, frituras crocantes, filetes Huesos frescos de alitas de pollo Huesos frescos de patas o muslos de pollo Papas fritas frescas y GHOJDGDV ò SXOJDGD Papas fritas frescas y GHOJDGDV ò SXOJDGD Comidas envasadas congeladas POSICIÓN(ES) DE ESTANTES RECOMENDADAS CONFIGURACIÓN DE TEMPERATURA RECOMENDADA (°F) TIEMPO DE COCCIÓN RECOMENDADO (MÍN.) NOTAS 8VH FRQILJXUDFLRQHV GH WHPSHUDWXUD PiV 4 375-400 15-30 EDMDV SDUD SLH]DV PiV JUDQGHV 8VH XWHQVLOLRV brillantes. 4 3 o 4 4 3 o 4 3 o 4 XVH OD SRVLFLyQ GH HVWDWH 3 para comidas más JUXHVDV 375-400 375-400 25-40 30-55 Sale las alitas o cubra las mismas con un roce en seco si usará salsa luego de la cocción o hacia el final de la cocción. 8VH FRQILJXUDFLRQHV GH WHPSHUDWXUD PiV EDMDV para piezas más grandes. 400-425 15-30 Se recomienda el uso de papel para hornear al preparar papas fritas frescas. Para frituras más crocantes, mezcle las papas fritas con almidón de maíz o harina de arroz antes de la cocción. 375-400 20-35 Se recomienda el uso de papel para hornear al preparar papas fritas frescas. Para frituras más crocantes, mezcle las papas fritas con almidón de maíz o harina de arroz antes de la cocción. 8VH ODV LQVWUXFFLRQHV GH FRFFLyQ SDUD KRUQR WUDGLFLRQDO QR SDUD )UHtU FRQ $LUH FRPR JXtD GH FRQILJXUDFLyQ GH temperatura y tiempo de cocción. Con algunas comidas, se podrá requerir un tiempo de cocción adicional diferente al tiempo recomendado en el paquete. Si el horno está caliente al iniciar la cocción, la comida se podrá cocinar más rápido que el tiempo mínimo que figura en el paquete. 20 49-2000781 Rev. 6 CUIDADO Y LIMPIEZA: Estufa - Exterior Estufa - Exterior Asegúrese de que todos los controles estén apagados y que las superficies estén frías antes de limpiar cualquier parte de la estufa. ADVERTENCIA Si se quita la estufa para efectuar una limpieza, reparaciones o cualquier otra razón, verifique que el dispositivo anti-volcaduras se coloque de manera adecuada cuando vuelva a instalarse la estufa. Si no toma esta precaución, la estufa puede volcarse y provocar lesiones. Bloqueo del Control Si así lo desea, puede desactivar los botones de toque antes de la limpieza. &RQVXOWH/RFN&RQWUROV&RQWUROHVGH%ORTXHRHQODVHFFLyQ 2YHQ&RQWUROV&RQWUROHVGHO+RUQRHQHVWHPDQXDO Limpie los derrames con un paño húmedo. También puede utilizar un limpiador de vidrios. 4XLWHVXFLHGDGHVPiVUHEHOGHVFRQDJXDWLELDMDERQRVD1R utilice abrasivos de ninguna clase. Vuelva a activar los botones de toque después de la limpieza. Panel de control 8QDEXHQDLGHDHVOLPSLDUHOSDQHOGHFRQWUROOXHJRGHFDGD uso. Limpie con un jabón suave y agua o vinagre y agua, enjuague con agua limpia y pula en seco con una tela suave. No use limpiadores abrasivos, limpiadores líquidos fuertes, almohadillas para fregar de plástico ni limpiadores de horno en el panel de control; dañarán el acabado, incluyendo el Acero Inoxidable Negro. Exterior del Horno No use limpiadores de horno, limpiadores abrasivos, limpiadores líquidos fuertes, estropajos de acero, almohadillas para fregar de plástico, ni polvos limpiadores en el interior o el exterior del horno. Limpie el mismo con agua y jabón o una solución de vinagre y agua. Enjuague con agua limpia y seque con una tela seca. Al limpiar supeficies, asegúrese de que estén a temperatura ambiente y fuera del contacto con la luz solar. Si las manchas en el borde de la ventana de la puerta son persistentes, use un limpiador abrasivo suave o una esponja con estropajo para obtener un mejor resultado. El derrame de adobo, jugos de fruta, salsas de tomate y líquidos para humedecer que contengan ácidos pueden ocasionar descoloración y se deberán limpiar de inmediato. Deje que las superficies calientes se enfríen, y luego limpie y enjuague. Superficies pintadas Las superficies pintadas incluyen los lados de la estufa y la puerta, la parte superior del panel de control y el frente del cajón. Límpielas con jabón y agua o con una solución de agua y vinagre. No utilice limpiadores de horno comerciales, polvos limpiadores, esponjillas de acero o abrasivos potentes sobre cualquier superficie pintada, incluyendo el Acero Inoxidable Negro. Acero Inoxidable excluyendo el Acero Inoxidable Negro (en algunos modelos) No use virutas de acero; éstas dañarán la superficie. /RVOLPSLDGRUHVFRQiFLGRR[iOLFRWDOHVFRPR%DU.HHSHUV )ULHQG6RIW&OHDQVHUHOLPLQDUiQHOy[LGRGHVOXVWUHV\ SHTXHxDVPDQFKDVVREUHODVXSHUILFLH8VHVyORXQOLPSLDGRU líquido libre de material abrasivo y frote en la dirección de las líneas del cepillo con una esponja suave y húmeda. Para limpiar la superficie de acero inoxidable, use agua tibia con jabón o un limpiador o pulidor para acero inoxidable. Siempre limpie la superficie en la dirección del veteado. Siga las instrucciones del limpiador para limpiar la superficie de acero inoxidable. Para realizar consultas sobre la adquisición de productos, incluyendo limpiadores o pulidores para electrodomésticos de acero inoxidable, consulte las secciones de Accesorios y Soporte al Consumidor al final de este manual. 49-2000781 Rev. 6 21 CUIDADO Y LIMPIEZA: Estufa - Interior Estufa - Interior (OLQWHULRUGHVXQXHYRKRUQRSXHGHVHUOLPSLDGRGHIRUPDPDQXDORXWLOL]DQGRORVPRGRV6WHDP&OHDQ/LPSLH]DFRQ9DSRUR 6HOI&OHDQ/LPSLH]D$XWRPiWLFD El derrame de adobo, jugos de fruta, salsas de tomate y líquidos para humedecer que contengan ácidos pueden ocasionar descoloración y se deberán limpiar de inmediato. Espere a que las superficies calientes se enfríen, y luego limpie y enjuague. Limpieza Manual No use limpiadores de horno, limpiadores líquidos fuertes, estropajos de acero, ni almohadillas para fregar en el interior del horno. Para la suciedad de la parte inferior del horno y otras superficies esmaltadas, use un abrasivo suave que FRQWHQJDiFLGRR[iOLFRWDOFRPR%DU.HHSHUV)ULHQG®, con una esponja antirayaduras. Tenga cuidado de no aplicar limpiadores abrasivos o esponjas sobre la puerta de vidrio, ya que estos rayarán el revestimiento reflectante. El interior del horno y la puerta de vidrio podrán ser limpiados con una tela suave, jabón suave y agua, o con vinagre y una solución de agua. Luego de la limpieza, enjuague con agua limpia y seque con una tela seca. Modo de Limpieza con Vapor /DILQDOLGDGGHODIXQFLyQ6WHDP&OHDQ/LPSLH]DFRQ9DSRU es usar agua para limpiar la suciedad leve de su horno en una WHPSHUDWXUDLQIHULRUDODGH6HOI&OHDQ/LPSLH]D$XWRPiWLFD 3DUDXVDUODIXQFLyQ6WHDP&OHDQ/LPSLH]DFRQ9DSRU 1. Comience con el horno a temperatura ambiente. 2. Limpie la grasa excesiva y la suciedad del horno. 3. Vierta una taza de agua en la parte inferior del horno. 4. Cierre la puerta. 3 UHVLRQHODWHFOD&OHDQ/LPSLDUVHOHFFLRQH6WHDP &OHDQ/LPSLH]DFRQ9DSRU\OXHJRSUHVLRQH6WDUW(QWHU ,QLFLDU,QJUHVDU 1RDEUDODSXHUWDGXUDQWHHOFLFOR6WHDP&OHDQ/LPSLH]DDO 9DSRUGHPLQXWRV$OILQDOL]DUHOFLFORGH6WHDP&OHDQ /LPSLH]DFRQ9DSRUDEVRUEDHODJXDUHVWDQWH\OLPSLHOD suciedad ablandada por la humedad de las paredes y la puerta del horno. Modo de Limpieza Automática Lea las Instrucciones de Seguridad del Horno con Limpieza Automática, en el comienzo de este manual, antes de usar HOPRGR6HOI&OHDQ/LPSLH]D$XWRPiWLFD(VWHPRGRXVD temperaturas muy altas para limpiar el interior del horno. Para un horno moderadamente sucio, use un ciclo de limpieza automática de 3 horas. Sólo los estantes del horno de limpieza DXWRPiWLFDQHJURV\ODVUHMLOODVSRGUiQSHUPDQHFHUHQHO horno durante el ciclo de limpieza automática. Todos los GHPiVtWHPVLQFOX\HQGRORVHVWDQWHVQLTXHODGRVSODWHDGRV GHEHUiQVHUUHWLUDGRV6LORVHVWDQWHVQLTXHODGRVSODWHDGRV se dejan dentro del horno durante un ciclo de limpieza automática, los estantes sufrirán deslustre. Si cualquier tipo de estante es dejado en el horno durante el ciclo de limpieza automática, es posible que se vuelva difícil deslizar el estante. Para acceder a instrucciones sobre cómo mejorar esto, consulte la sección de Estantes del Horno. IMPORTANTE: Las emanaciones producidas por el ciclo de autolimpieza de cualquier horno afectan la salud de algunas aves de manera notoria. Procure llevar sus aves a otra habitación bien ventilada. 3DUDXVDUODIXQFLyQ6HOI&OHDQ/LPSLH]D$XWRPiWLFD 1. Comience con el horno a temperatura ambiente. 2. Limpie la grasa excesiva y las suciedades del horno y del interior de la puerta. 3. Retire cualquier ítem que no sean los estantes y UHMLOODVGHOLPSLH]DDXWRPiWLFDQHJURVVLORGHVHD Consulte sobre la Limpieza de la Superficie de Cocción para determinar si sus rejillas pueden ser limpiadas automáticamente y para detalles importantes en relación a la colocación de las rejillas. 4. Cierre la puerta. 5. Presione la tecla Clean (Limpiar), seleccione Self Clean (Limpieza Automática) y luego presione Start/Enter (Iniciar/ Ingresar). No podrá abrir la puerta durante el ciclo de limpieza automática. La puerta permanecerá bloqueada luego del ciclo de limpieza automática hasta que el horno se enfríe y se alcance la temperatura de desbloqueo. Al finalizar el ciclo de limpieza automática, deje que el horno se enfríe, destrabe la puerta, y limpie cualquier ceniza que haya quedado en el horno. Estantes Todos los estantes se pueden lavar con agua caliente y jabón. /RVHVWDQWHVHVPDOWDGRVQREULOORVRVVHSXHGHQGHMDUHQOD cavidad durante el ciclo de limpieza automática. Es posible que resulte más difícil deslizar los estantes, especialmente luego de la limpieza automática. Coloque aceite vegetal en una tela húmeda o toalla de papel y frote sobre los extremos izquierdo y derecho. 22 49-2000781 Rev. 6 CUIDADO Y LIMPIEZA: Placa de Cocción Placa de Cocción Retiro de los Quemadores Superficiales para su Limpieza Apague todos los controles. Espere a que la placa de cocción se enfríe antes de retirar las rejillas y las partes del quemador. Al retirar las tapas y cabezas de los quemadores, recuerde su tamaño y ubicación. Vuelva a colocarlos en la misma ubicación luego de la limpieza. PRECAUCIÓN No intente retirar las tapas del quemador oval o oval dual de las cabezas de los quemadores. 7DSDGHO4XHPDGRU 5HGRQGR([WUDtEOH 7DSDGHO4XHPDGRU 5HGRQGR([WUDtEOH 7DSDGHO4XHPDGRU 5HGRQGR([WUDtEOH Cabeza del 4XHPDGRU Redondo Electrodo Quemador Redondo 7DSDGHO4XHPDGRU ([WHUQRExtraíble Cabeza del 4XHPDGRU Redondo Electrodo 4XHPDGRUGHP~OWLSOHVDQLOORV (en algunos modelos) 7DSDVGHO4XHPDGRU2YDO 'XDO1R([WUDtEOHV Quemador Oval Dual Limpieza de los Quemadores Superficiales Limpieza de las Tapas de los Quemadores Lave las tapas de los quemadores en agua caliente con jabón y enjuague con agua limpia. Puede fregar con u na base de fregado plástica para eliminar partículas de comida quemadas. Las tapas redondas de los quemadores también se pueden limpiar en un lavavajillas. Limpieza de las Cabezas de los Quemadores Limpie las cabezas de los quemadores de forma rutinaria, especialmente luego de derrames importantes, que podrían bloquear las aberturas del quemador. Retire los quemadores cuando estén fríos. Lave los mismos con agua caliente y jabón. Enjuague con agua limpia. Para eliminar las manchas más rebeldes, use un cepillo con cerda plástica. NOTA: No use lana de acero ni estropajos para limpiar las partes del quemador, ya que podrán bloquear las aberturas. Nunca lave las cabezas de los quemadores en el lavavajillas. Esto podrá hacer que se descoloren. Las hendiduras de las cabezas de los quemadores se deben mantener limpias en todo momento para obtener una llama pareja y sin obstrucción. Las partes bloqueadas o sucias de los quemadores o los electrodos no permitirán que el quemador funcione de forma correcta. Reemplazo de los Quemadores Superficiales Antes de colocar las tapas y cabezas de los quemadores y el HQVDPEOHGHODFDEH]DWDSDQXHYDPHQWHHVFXUUDHOH[FHVR de agua y luego seque las mismas totalmente. Vuelva a colocar las cabezas de los quemadores en las ubicaciones correctas, de acuerdo con sus tamaños. Asegúrese de que cada tapa quede correctamente apoyada sobre la cabeza del quemador, como se muestra a continuación. La tapa del quemador NO está correctamente colocada. La tapa del quemador NO está correctamente colocada. La tapa del quemador está correctamente colocada. PRECAUCIÓN No use la parte superior de la estufa sin que todas las partes de los quemadores y las parrillas estén en sus respectivos lugares. Cualquier derrame en o alrededor de un electrodo se deberá limpiar de forma cuidadosa. Evite golpear el electrodo con cualquier cosa dura, ya que podrá ser dañado. Electrodo El electrodo del encendedor de la chispa es expuesto cuando la cabeza del quemador es retirada. Cuando un quemador se gira a LITE, todos los quemadores hacen chispa. No intente desensamblar ni limpiar un quemador mientras otro quemador está encendido. 49-2000781 Rev. 6 23 CUIDADO Y LIMPIEZA: Placa de Cocción 3ODFDGH&RFFLyQ&RQWLQ~D Parrillas de Quemadores Limpieza Manual Las rejillas se deberán lavar con agua caliente y jabón y deberán ser enjuagadas con agua limpia. Para ablandar la comida quemada, coloque las rejillas en una solución con ¼ de taza de amoníaco hogareño durante varias horas. Luego, friegue las rejillas con un estropajo de plástico con agua caliente y jabón. Enjuague a fondo y seque. Modo Self Clean (Limpieza Automática) (en algunos modelos) Si las rejillas no cuentan con protectores de goma en la superficie inferior, podrán ser limpiadas en el horno usando el ciclo de limpieza automática. No intente limpiar las rejillas en el horno si las mismas cuentan con protectores de goma. Hacer esto destruirá los protectores de goma, afectando el funcionamiento de los quemadores. Las rejillas cubiertas de porcelana se podrán volver gradualmente ásperas si son expuestas de forma continua a las temperaturas de limpieza automática. Si su horno está equipado con estantes de limpieza automática QHJURVVHUHFRPLHQGDVHJXLUODVLQVWUXFFLRQHVSDUDOD colocación de parrillas en los estantes. Si su horno está equipado con estantes niquelados, se recomienda seguir las instrucciones para la colocación de rejillas en el fondo GHOKRUQR/RVHVWDQWHVFXELHUWRVGHQtTXHOSODWHDGRVQR deben permanecer en el horno durante el ciclo de limpieza automática. Hacer esto deslustrará los estantes. Si cualquier tipo de estante es dejado en el horno durante el ciclo de limpieza automática, es posible que se vuelva difícil deslizar el estante. Para acceder a instrucciones de lubricación, consulte la sección de Estante del Horno. NOTA: Al colocar o retirar rejillas del horno, no deslice las mismas sobre los estantes ni sobre el fondo del horno. Hacer esto podría dañar el esmalte de los estantes o el fondo del horno. Para realizar la limpieza automática de sus parrillas en los estantes de limpieza automática: 1. Inserte los estantes en las posiciones 1, 3 y 5 o en las posiciones 2 y 4. 2. De forma suave, coloque una rejilla en cada estante. Para realizar la limpieza automática de sus rejillas en el fondo del horno: 1. Retire todos los estantes del horno. 2. De forma suave, coloque una rejilla en el centro del fondo del horno con la rejilla orientada en la posición HUJXLGD$SLOHODUHMLOODVUHVWDQWHFRPRVHPXHVWUDD continuación. No coloque ni apile las rejillas en ninguna otra configuración. 8QDYH]TXHODVUHMLOODVIXHURQFRORFDGDVHQHOKRUQRXVHHO ciclo de limpieza automática siguiendo las instrucciones de la sección de Limpieza del Horno. NOTA: Tenga cuidado al retirar las parrillas del horno superior una vez que el ciclo de auto limpieza haya finalizado. Es posible que las parrillas aún estén calientes. 8QDYH]FRPSOHWDGRHOFLFORGHOLPSLH]DDXWRPiWLFDODVUHMLOODV pueden ser retiradas de forma cuidadosa. Es posible que observe un residuo blanco en las rejillas. Limpie el mismo con una esponja húmeda. Si las manchas blancas persisten, moje la esponja con una solución mitad de vinagre y mitad de agua y vuelva a limpiar las rejillas. Al reemplazar las rejillas en la superficie de cocción, asegúrese de ubicarlas de forma correcta. Las rejillas se deben poder posicionar de forma segura en la superficie de cocción. Protectores de Soportes de Rejillas (en algunos modelos) Si uno de los protectores de goma de la rejilla de la placa Protectores para Soportes de Rejillas de cocción se pierde o daña, visitando nuestro sitio web en GEAppliances.com/parts. Para insertar los nuevos protectores, simplemente coloque el extremo del protector con forma cónica en el agujero de la placa de cocción y empuje hacia abajo de forma suave, doblando el protector. Plancha Hierro Forjado Reversible: Limpie su plancha de hierro fundido reversible o del chef con un cepillo duro y agua caliente. No se recomienda el uso de jabón, y nunca se deben usar detergentes potentes, ya que eliminarán el curado. Enjuague la misma con agua caliente y séquela cuidadosamente. Luego del enjuague, presazone la plancha aplicando una capa suave de aceite de estufa sobre su superficie. Limpie el exceso de aceite con una toalla de papel. Guarde en un lugar frío y seco. Precauciones de la Plancha: Si algo se derramó debajo de la plancha, se deberá limpiar tan pronto como sea posible para evitar que sea horneado en la placa de cocción. No permita que se acumule grasa debajo de la plancha, ya que puede haber riesgo de incendio. Limpie debajo de la plancha con agua caliente y jabón, tan pronto como sea posible. No lave la plancha en el lavavajillas. No limpie la plancha en el horno de limpieza automática. 24 49-2000781 Rev. 6 CUIDADO Y LIMPIEZA:3XHUWD\HO&DMyQ6RQGDGHO+RUQR Puerta y el Cajón Limpieza de la Puerta del Horno Limpieza del Interior de la Puerta No permita que el excedente de agua entre a ningún agujero o ranuras de la puerta. Aplique detergente para lavar platos sobre cualquier VDOSLFDGXUDTXHKD\DVREUHHOYLGULRGHELGRDOKRUQHDGR8VH el filo de una navaja del lado seguro para despejarlo. Luego limpie el vidrio con una tela con jabón para eliminar cualquier residuo y seque. El área que está fuera de la junta se puede limpiar con un estropajo de plástico con jabón. No frote ni limpie la junta de la puerta; posee una resistencia extremadamente baja a la abrasión. Si observa que la junta se empieza a gastar, se deshilacha o daña de cualquier forma y si quedó fuera de la puerta, deberá reemplazar la misma. Limpieza del Exterior de la Puerta Si las manchas en el borde de la ventana de la puerta son persistentes, use un limpiador abrasivo suave o una esponja con estropajo para obtener un mejor resultado. No use este método sobre ninguna otra superficie. Superficies de Acero Inoxidable (en algunos modelos) No use virutas de acero; éstas dañarán la superficie. Para limpiar la superficie de acero inoxidable, use agua tibia con jabón o un limpiador o pulidor para acero inoxidable. Siempre limpie la superficie en la dirección del veteado. Siga las instrucciones del limpiador para limpiar la superficie de acero inoxidable. Para realizar consultas sobre la adquisición de productos, incluyendo limpiadores o pulidores para electrodomésticos de acero inoxidable, consulte las secciones de Accesorios y Soporte al Consumidor al final de este manual. Cajón de almacenamiento extraíble La mayor parte de la limpieza se puede realizar con el cajón en su lugar. Sin embargo, el cajón puede ser retirado si es QHFHVDULRFRQWLQXDUFRQODOLPSLH]D8VHDJXDFDOLHQWH\MDEyQ para limpiar a fondo. Para retirar el cajón: 1. Empuje el cajón hacia afuera hasta que se detenga. 2. Presione el liberador del riel izquierdo hacia arriba y presione el derecho hacia abajo, mientras empuja el cajón hacia adelante y lo libera. Para reemplazar el cajón: 1. Coloque el riel del cajón izquierdo alrededor de la guía del riel interior izquierdo y deslice el mismo lentamente para engancharlo. 2. Coloque el riel del cajón derecho alrededor de la guía del riel interior derecho y deslice el mismo lentamente para engancharlo. 3. Deslice el cajón totalmente hasta adentro. Sonda del Horno La sonda de temperatura se puede limpiar con agua y jabón o con una almohadilla de estropajo llena de jabón. Enfríe la sonda de temperatura antes de su limpieza. Fregue las manchas difíciles con una almohadilla de estropajo llena de jabón, enjuague y seque. Para ordenar sondas de temperatura adicionales, consulte las secciones de Accesorios y Soporte al Consumidor al final de este manual. 1RVXPHUMDODVRQGDGHWHPSHUDWXUDHQDJXD 1RJXDUGHODVRQGDGHWHPSHUDWXUDGHQWURGHOKRUQR 1XQFDGHMHODVRQGDGHWHPSHUDWXUDGHQWURGHOKRUQR durante un ciclo de limpieza automática o de limpieza con vapor. 49-2000781 Rev. 6 25 CUIDADO Y LIMPIEZA: Luz del Horno Luz del Horno (Las funciones y el aspecto podrán variar en relación a su modelo) ADVERTENCIA PELIGRO DE DESCARGA O QUEMADURAS: Antes de reemplazar la lámpara de luz del horno, desconecte la conexión eléctrica del horno del fusible principal o del panel del disyuntor. Si esto no se cumple, se podrá producir una descarga eléctrica o un incendio. PRECAUCIÓN RIESGO DE INCENDIO: La tapa de vidrio y la lámpara de luz se deberán retirar cuando estén frías. Tocar el vidrio caliente sin protección en las manos o con un trapo húmedo puede ocasionar quemaduras. Para quitar la bombilla: 1. Gire la tapa de vidrio en sentido antihorario hasta haber retirado el vidrio. Colocarse guantes de látex puede brindar un mejor agarre. 8WLOL]DQGRJXDQWHVRXQSDxRVHFRUHPXHYDODERPELOOD jalándola en línea recta. Para reemplazar la bombilla: 8WLOLFHXQDQXHYDERPELOODKDOyJHQDGHYROWLRV no exceda 50 vatios. Reemplace la lámpara de luz con el mismo tipo de lámpara que se retiró. Asegúrese al reemplazar la lámpara que sea de 120 volts o 130 volts 12GHYROWV\TXHSRVHDXQDEDVH* 8WLOL]DQGRJXDQWHVRXQSDxRVHFRUHPXHYDODERPELOODGH su paquete. No toque la bombilla con los dedos desnudos. El aceite para piel dañará la lámpara y acortará su tiempo de duración. 3. Empuje la bombilla en línea recta dentro del receptáculo hasta el tope. 4. Vuelva a colocar la tapa de vidrio. Para una mejor iluminación dentro del horno, limpie frecuentemente la cubierta de vidrio utilizando un paño húmedo. Esto debería hacerse cuando el horno está completamente frío y la luz apagada. 5. Conecte nuevamente el suministro eléctrico al horno. Receptáculo Portalámpara %RPELOODGH* Cubierta de vidrio Reemplazo de la bombilla del horno (en algunos modelos) Para quitar la tapa: Para volver a colocar la tapa: 1. Dé a la tapa de vidrio un cuarto de giro 1. Reemplace la lámpara por una para electrodoméstico de 40 en contra de las agujas del reloj hasta que las lengüetas de la tapa de vidrio limpien las ranuras de la ficha. Si usa guantes de látex tendrá un mejor agarre. 2. Retire la lámpara girando la misma en dirección contraria a las agujas del reloj. watts. Inserte la lámpara y gire la misma en dirección de las agujas del reloj, hasta que quede ajustada. 2. Coloque las lengüetas de la tapa de vidrio en las ranuras de la ficha. Dé a la tapa de vidrio un cuarto de giro en dirección de las agujas del reloj. Para una mejor iluminación dentro del horno, limpie la tapa del vidrio en forma frecuente utilizando una tela húmeda. Esto se deberá hacer cuando el horno esté completamente frío. 3. Vuelva a conectar el cable de electricidad del horno. Reemplazo de la bombilla del horno (en algunos modelos) La lámpara de luz del horno está cubierta por una tapa de vidrio extraíble que es sostenida por un cable que la cruza. Retire la puerta del horno, si lo desea, para llegar a la tapa fácilmente. Retire la puerta del horno, si lo desea, para llegar a la tapa fácilmente. Para acceder a instrucciones detalladas sobre el retiro de la puerta del horno, consulte la sección sobre Cómo Retirar la Puerta del Horno. Reemplazo de la Lámpara: 1. Desconecte el cable de electricidad a la estufa. 2. Mantenga estable la tapa de vidrio, de modo que no se caiga al ser liberada. 3. Deslice la misma cerca del borde del suspensor de la tapa, hasta que la tapa sea liberada. 1RUHWLUHQLQJ~QWRUQLOOR para retirar la tapa de vidrio. 4. Reemplace la lámpara por una para electrodomésticos de 40 watts. No toque la lámpara caliente con la mano o una WHODK~PHGD6yORUHWLUHODOiPSDUDFXDQGRHVWpIUtD 5. Mantenga la tapa de vidrio estable sobre la lámpara nueva. 7DSDGHYLGULRHQ modelos con limpieza DXWRPiWLFD~QLFDPHQWH 6. Empuje el suspensor de la tapa del cable cerca del borde, hasta que el borde del suspensor de la tapa del cable esté ubicado en el borde de la tapa de vidrio. 7. Conecte la electricidad a la estufa. %RUGH Amplio suspensor de tapa 26 49-2000781 Rev. 6 CUIDADO Y LIMPIEZA: Puerta del Horno Puerta del Horno Puerta del Horno Desmontable La puerta es muy pesada. Tenga cuidado al retirar y levantar la puerta. No levante la puerta usando la manija. Para retirar la puerta: 1. Abra la puerta totalmente. 2. Empuje los bloqueos de la bisagra hacia arriba y afuera de la estructura de la estufa, hasta la posición de desbloqueo. 3. Firmemente tome ambos lados de la puerta por la parte superior. 4. Cierre la puerta hasta que la parte superior de la misma quede a aproximadamente 6" de la estructura de la estufa. 5. Levante la puerta hacia arriba y afuera de la estufa, hasta que ambos brazos de las bisagras estén fuera de las ranuras de la estructura de la estufa. Para reemplazar la puerta: 1. Firmemente tome ambos lados de la puerta por la parte superior. 2. Con la puerta en el mismo ángulo que en la posición de retiro, apoye la abertura sobre el fondo del brazo de la bisagra izquierda en el extremo inferior de la ranura de la bisagra izquierda. La abertura en el brazo de la bisagra deberá estar totalmente apoyada en la parte inferior de la ranura. Repita el procedimiento del lado derecho. Empuje los bloqueos de las bisagras hacia arriba para desbloquearlos Empuje el bloqueo de la bisagra hacia arriba hasta que quede bloqueado %UD]R GH OD ELVDJUD Posición de retiro 3. Abra la puerta totalmente. Si la puerta no se abre completamente, las aberturas en las partes inferiores de los brazos de las bisagras no se apoyaron de forma correcta sobre el extremo inferior de la ranura. Retire la puerta de la estufa y repita el paso anterior. Abertura 4. Empuje los bloqueos de las bisagras hacia la cavidad de la estufa y hacia abajo hasta la posición de bloqueo. Apoye la abertura en el extremo inferior de la ranura de la bisagra Empuje trabas de la bisagra hacia abajo para bloquear. 5. Cierre la puerta del horno. 49-2000781 Rev. 6 27 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico ¡Ahorre tiempo y dinero! Primero revise los cuadros que aparecen en las siguientes páginas y es posible que no necesite solicitar reparaciones. Problema Mi horno nuevo no estufa como el anterior. ¿Hay DOJ~QSUREOHPDFRQ las configuraciones de temperatura? Causa Posible Su horno nuevo cuenta con un sistema de cocción diferente con relación al anterior y, por lo tanto, es posible que cocine de forma diferente. La comida no se hornea de forma apropiada La comida no asa de forma apropiada Controles del horno configurados de forma incorrecta. La posición del estante es incorrecta o el estante no está nivelado. 8VRGHXQDFDFHURODLQFRUUHFWDRGHXQDFDFHURODGH tamaño incorrecto. La temperatura del horno debe ser ajustada. Controles del horno configurados de forma incorrecta. Se usó una posición incorrecta del estante. 8WHQVLOLRGHHVWXIDLQDGHFXDGRSDUDDVDU El papel de aluminio sobre la olla para asar no fue ajustado de forma apropiada ni cortado apropiadamente para drenar la grasa. La temperatura del horno es demasiado caliente o demasiado fría El horno y/o la pantalla parecen no estar funcionando La temperatura del horno debe ser ajustada. Es posible que un fusible de su hogar se haya quemado o que el disyuntor se haya desconectado. Controles del horno configurados de forma incorrecta. Qué Hacer Durante los primeros usos, siga los tiempos y temperaturas de sus recetas atentamente y use las posiciones de los estantes recomendadas en la Guía de Cocción. Si aún piensa que su horno nuevo estufa con demasiado calor o demasiado frío, podrá ajustar el termostato usted mismo para aplicar su preferencia de cocción específica. Consulte la sección de Configuraciones. Consulte la sección Modos de Cocción. Consulte la sección Modos de Cocción y la Guía de Cocción. &RQVXOWHODVHFFLyQ8WHQVLOLRV Consulte la sección Configuraciones. Asegúrese de seleccionar el modo correcto para asar. Para acceder a sugerencias de ubicación de estantes, consulte la Guía de Cocción. 8VHXQDROODHVSHFtILFDPHQWHGLVHxDGDSDUDDVDU Si usará papel de aluminio en la olla para asar, envuelva de forma ajustada y agregue cortes conforme con aquellos en la olla para permitir que la grasa sea drenada. Consulte la sección Controles del Horno. Reemplace el fusible o reinicie el disyuntor. &RQVXOWHODVHFFLyQ8VRGHO+RUQR (OKRUQRVHHQFXHQWUDHQ6DEEDWK0RGH0RGR 6DEiWLFR Sonido de "chisporroteo" o "traqueo" ¿Por qué la estufa hace un sonido de "clic" cuando uso el horno? A veces el horno tarda más en precalentarse a la misma temperatura El reloj está apagado. Éste es el sonido de metal calentándose o enfriándose durante las funciones de cocción y limpieza. Su estufa fue diseñada para mantener un control más ajustado sobre la temperatura del horno. Es posible que escuche que los elementos de calentamiento del horno hagan sonidos de "clic" con mayor frecuencia que con hornos más antiguos para lograr mejores resultados durante los ciclos de horneado, asado, convección y limpieza automática. 8WHQVLOLRRFRPLGDHQHOKRUQR Número de estantes en el horno Verifique que el horno no esté en Sabbath Mode 0RGR6DEiWLFR&RQVXOWHODVHFFLyQ6DEEDWK0RGH 0RGR6DEiWLFR &RQVXOWHODVHFFLyQ6HWWLQJV&RQILJXUDFLRQHV Esto es normal. Esto es normal. El utensilio o la comida en el horno hará que éste tarde más en precalentarse. Retire estos artículos para reducir el tiempo de precalentamiento. Agregar más estantes al horno hará que éste tarde más en precalentarse. Retire algunos estantes. 28 49-2000781 Rev. 6 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico Problema La luz del horno no funciona El modo de limpieza automática del horno no funciona Exceso de humo durante un ciclo de limpieza El horno no limpia luego de un ciclo de limpieza Fuerte olor a "quemado" o a "aceite" desde la ventilación Humo excesivo al asar La puerta del horno no se abre o la luz LOCKED (Bloqueado) está encendida cuando desea cocinar. "TRABA DE LA PUERTA" titila en la pantalla. ³)±\XQQ~PHUR o letra" titila en la pantalla Corte de corriente, el reloj titila Controles de Bloqueo o Control La función de bloqueo está activada. El quemador no se enciende Causa Posible La lámpara está floja o presenta defectos. La temperatura del horno es demasiado caliente como para configurar la limpieza automática. Los controles del horno están configurados de forma incorrecta. Suciedad o grasa excesiva. Los controles del horno están configurados de forma incorrecta. El horno estaba demasiado sucio. Esto es normal en un horno nuevo y desaparecerá con el tiempo. La comida está demasiado cerca del quemador. La puerta del horno está bloqueada debido a que la temperatura interior del horno no descendió por debajo de la temperatura de bloqueo. El ciclo de limpieza automática fue seleccionado pero la puerta no está cerrada. Tiene un código de error de función. Corte o exceso de corriente El enchufe en la estufa no está completamente insertado en el tomacorriente eléctrico. El suministro de gas no fue conectado o encendido. Es posible que un fusible de su hogar se haya quemado o que el disyuntor se haya desconectado. Las piezas del quemador no fueron reemplazadas correctamen. Es posible que las hendiduras de los quemadores, o el puerto del encendedor redondo en el quemador oval, estén atascados. Residuos de comida en el electrodo Qué Hacer Ajuste o reemplace la lámpara. Para acceder a instrucciones sobre cómo reemplazar la lámpara, consulte la sección de Mantenimiento. Espere a que el horno se enfríe y reinicie los controles. Consulte la sección de Limpieza del Horno. Presione la tecla Cancel/Off (Cancelar/ Apagar) Abra las ventanas para liberar el humo en la habitación. Espere hasta que la luz de la función LOCKED (Bloqueado) desaparezca. Limpie el exceso de suciedad y reinicie el ciclo de limpieza. Consulte la sección de Limpieza del Horno. Limpie derrames excesivos antes de iniciar el ciclo de limpieza. Es posible que, en hornos con mucha suciedad, sea necesario usar la limpieza automática nuevamente o usarla durante un período de tiempo más prolongado. Para acelerar el proceso, configure un ciclo de limpieza automática por un mínimo de 3 horas. Consulte la sección de Limpieza del Horno. %DMHODSRVLFLyQGHOHVWDQWHFRQFRPLGD Presione la tecla Cancel/Off (Cancelar/ Apagar). Espere a que el horno se enfríe por debajo de la temperatura de bloqueo. Cierre la puerta del horno. Presione la tecla Cancel/Off (Cancelar/ Apagar) Permita que el horno se enfríe durante una hora. Vuelva a poner el horno en funcionamiento. Si el código de la función se repite, desconecte totalmente la corriente del horno durante por lo menos 30 minutos y vuelva a conectar la misma. Si el código de error de función se repite, llame al servicio técnico. Reinicie el reloj. Si el horno estuvo en uso, deberá reiniciar el mismo presionando la tecla Cancel/ Off (Cancelar/ Apagar) configurando el reloj y reiniciando cualquier función de cocción. Si aparece LOC ON en la pantalla, el control de la estufa está bloqueado. Apague esta función para usar la estufa. &RQVXOWHODIXQFLyQ/RFN&RQWURO&RQWUROGH%ORTXHRHQ la sección de Controles del Horno. Asegúrese de que el cable de electricidad esté enchufado en un tomacorriente correctamente conectado a tierra.et. Consulte las Instrucciones de Instalación provistas con su estufa. Reemplace el fusible o reinicie el disyuntor. Lea la sección Cuidado y limpieza de la estufa. Retire los quemadores o limpie los mismos. Controle que no haya comida quemada ni grasa en el área del electrodo. Lea la sección de Cuidado y Limpieza de la estufa. Suavemente pula el extremo plano del electrodo con una lima de uñas o con una lija hasta que quede brilloso. 49-2000781 Rev. 6 29 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico Problema Los quemadores superiores no queman de forma pareja Llamas de los quemadores son muy grandes o amarillas Los quemadores superficiales se iluminan pero los quemadores para hornear y asar no. Causa Posible Ensamble del quemador inapropiado. Las hendiduras al costado del quemador se podrán atascar. Promedio inadecuado de aire a gas. Es posible que los quemadores de gas del horno hayan sido apagados. Qué Hacer Asegúrese de que las tapas de los quemadores estén instaladas correctamente. Consulte Cuidado y limpieza en la sección de la estufa. Retire los quemadores para su limpieza. Consulte la sección de Cuidado y limpieza de la estufa. Si la estufa es conectada a gas Propano, contacte al técnico que instaló la estufa o que hizo la conversión. El apagado del gas del horno está ubicado en el regulador de gas cerca GHODDGKHUHQFLDGHODWXEHUtDGHJDVDODHVWXID8ELTXHODPLVPD\Gp vuelta la palanca. La puerta de vidrio del horno parece estar "teñida" o tener un color "arcoíris". El cajón no se desliza de forma pareja o se arrastra El vidrio del horno interno está cubierto con una barrera de calor que refleja este último nuevamente hacia el horno, a fin de evitar la pérdida de calor y de mantener fría la puerta externa mientras se hornea. El cajón está desalineado. El cajón está sobrecargado o la carga está des balanceada. La palanca se muestra cerrada. (038-(3$5$$%5,5 Modelos con quemador sellado (VWRHVQRUPDO%DMRFLHUWDVOXFHV\iQJXORVHVSRVLEOHTXHYLVXDOLFH esta tinta o arcoíris. Extienda totalmente el cajón y empuje el mismo totalmente hacia adentro. Consulte la sección Cuidado y limpieza de la estufa. Reduzca peso o redistribuya los contenidos de los cajones. 30 49-2000781 Rev. 6 Notas 49-2000781 Rev. 6 31 GARANTÍA LIMITADA Garantía Limitada de la Estufa a Gas GEAppliances.com Todo el servicio de garantía es provisto por nuestros Centros de Servicio de Fabricación, o un técnico autorizado de Customer Care®. Para programar una visita del servicio técnico a través de Internet, visítenos en geappliances.com/service, o llame a GE Appliances al 800.GE.CARES. Cuando llame para solicitar el servicio, tenga los números de serie y modelo disponibles. Para realizar el servicio técnico de su electrodoméstico, se podrá requerir el uso de datos del puerto de abordaje para su diagnóstico. Esto da al técnico del servicio de fábrica de GE Appliances la habilidad de diagnosticar de forma rápida cualquier problema con su electrodoméstico, y de ayudar a GE Appliances a mejorar sus productos al brindarle a GE Appliances la información sobre su electrodoméstico. Si no desea que los datos de su electrodoméstico sean enviados a GE Appliances, solicitamos que le indique a su técnico no entregar los datos a GE Appliances en el momento del servicio. Por el Período de GE Appliances reemplazará Un Año Cualquier parte de la estufa que falle debido a un defecto en los materiales o la fabricación. Durante Desde la fecha de la esta garantía limitada de un año, GE Appliances también proveerá, sin costo, todo el trabajo y el compra original servicio en el hogar para reemplazar la parte que presente defectos. Qué no cubrirá GE Appliances: 9LDMHVGHOWpFQLFRGHOVHUYLFLRDVXKRJDUSDUDHQVHxDUOH sobre cómo usar el producto. ,QVWDODFLyQHQWUHJDRPDQWHQLPLHQWRLQDGHFXDGRV ) DOODVGHOSURGXFWRHQFDVRGHDEXVRPDOXVRPRGLILFDFLyQ o uso para propósitos diferentes al original o uso comercial. 5 HHPSOD]RGHIXVLEOHVGHODFDVDRUHLQLFLRGHGLV\XQWRUHV ' DxRVRFDVLRQDGRVVREUHHOSURGXFWRSRUDFFLGHQWH incendio, inundaciones o catástrofes naturales. ' DxRVLQFLGHQWDOHVRFRQVHFXHQWHVFDXVDGRVSRUSRVLEOHV defectos sobre este producto. ' DxRVVREUHHODFDEDGRWDOHVFRPRy[LGRVREUHOD superficie, deslustres o manchas pequeñas no informadas dentro de las 48 horas luego de la entrega. ' DxRFDXVDGRGHVSXpVGHODHQWUHJD 3 URGXFWRQRDFFHVLEOHSDUDEULQGDUHOVHUYLFLRUHTXHULGR 6 ROLFLWHHOVHUYLFLRWpFQLFRSDUDUHSDUDURUHHPSOD]DUODV lámparas, excepto las lámparas LED. EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS Su única y exclusiva alternativa es la reparación del producto, como se indica en la Garantía Limitada. Las garantías implícitas, incluyendo garantías implícitas de comerciabilidad o conveniencia sobre un propósito particular, se limitan a un año o al período más corto permitido por la ley. Esta garantía limitada se extiende al comprador original y a cualquier dueño subsiguiente de productos comprados SDUDXVRKRJDUHxRGHQWURGH((886LHOSURGXFWRHVWiHQXQiUHDGRQGHQRVHHQFXHQWUDGLVSRQLEOHXQ3URYHHGRU Autorizado del Servicio Técnico de GE Appliances, usted será responsable por el costo de un viaje o se podrá requerir que traiga el producto a una ubicación del Servicio Técnico de GE Appliances autorizado para recibir el VHUYLFLR(Q$ODVNDODJDUDQWtDH[FOX\HHOFRVWRGHHQYtRROODPDGDVGHOVHUYLFLRDVXKRJDU$OJXQRVHVWDGRVQR permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía limitada le da derechos legales específicos y es posible que tenga otros derechos legales que varían entre un estado y otro. Para conocer cuáles son sus derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado. Garante: GE Appliances, a Haier company Louisville, KY 40225 Garantías Extendidas: Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales que están disponibles mientras su garantía aún está vigente. Puede acceder a la misma a través de Internet en cualquier momento en geappliances.com/extended-warranty o llamando al 800.626.2224 durante el horario comercial. Los Servicios para los GE Appliances aún estarán disponibles cuando su garantía caduque. Abroche su recibo aquí. Para acceder al servicio técnico de acuerdo con la garantía deberá contar con la prueba de la fecha original de compra. 32 49-2000781 Rev. 6 ACCESORIOS Accesorios ¿Busca Algo Más? ¡GE Appliances ofrece una variedad de accesorios para mejorar sus experiencias de cocción y mantenimiento! Para acceder a números telefónicos e información de sitios Web, consulte la página de Soporte para el Consumidor. Estos y otros productos están disponibles: Accesorios Estante Plano de Níquel Estante Plano Reforzado de Níquel Estante Plano con Limpieza Automática Estante Extensible de Níquel Estante Extensible con Limpieza Automática 2OODSDUD$VDUô´[ó´[ò´ Accesorio del Estante para Dorar Rejilla Central de la Superficie de Cocción Plancha de Aluminio No Adherente Plancha de Hierro Forjado Reversible Suministros de Limpieza Limpiadores de Acero Inoxidable CitriShine Paño de Pulido de Acero Inoxidable 5 HPRYHGRUGH*UDVD4XHPDGD 49-2000781 Rev. 6 33 SOPORTE PARA EL CONSUMIDOR Soporte para el Consumidor Sitio Web de GE Appliances ¿Desea realizar una consulta o necesita ayuda con su electrodoméstico? ¡Intente a través del Sitio Web de GE Appliances las KRUDVGHOGtDFXDOTXLHUGtDGHODxR8VWHGWDPELpQSXHGHFRPSUDUPiVHOHFWURGRPpVWLFRVPDUDYLOORVRVGH*($SSOLDQFHV\ aprovechar todos nuestros servicios de soporte a través de Internet, diseñados para su conveniencia. (Q((88GEAppliances.com Registre su Electrodoméstico £5HJLVWUHVXHOHFWURGRPpVWLFRQXHYRDWUDYpVGH,QWHUQHWVHJ~QVXFRQYHQLHQFLD8QUHJLVWURSXQWXDOGHVXSURGXFWRSHUPLWLUi una mejor comunicación y un servicio más puntual de acuerdo con los términos de su garantía, en caso de surgir la necesidad. También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con el material embalado. (Q((88GEAppliances.com/register Servicio Programado El servicio de reparación de expertos de GE Appliances está a sólo un paso de su puerta. Conéctese a través de Internet y programe VXVHUYLFLRDVXFRQYHQLHQFLDFXDOTXLHUGtDGHODxR(Q((88GEAppliances.com/service o comuníquese al 800.432.2737 durante el horario de atención comercial. Garantías Extendidas Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales que están disponibles mientras su garantía aún está vigente. La puede adquirir en cualquier momento a través de Internet. Los servicios de GE Appliances aún estarán allí cuando su garantía caduque. (Q((88GEAppliances.com/extended-warranty o comuníquese al 800.626.2224 durante el horario de atención comercial. Conectividad Remota 3DUDVROLFLWDUDVLVWHQFLDSDUDODFRQHFWLYLGDGGHUHGLQDOiPEULFDSDUDPRGHORVFRQDFFHVRUHPRWR visite nuestro sitio web en GEAppliances.com/connected-home-smart-appliances/RFRPXQtTXHVHDOHQ((88 Piezas y Accesorios Aquellos individuos calificados para realizar el servicio técnico de sus propios electrodomésticos podrán solicitar el envío de SLH]DVRDFFHVRULRVGLUHFWDPHQWHDVXVKRJDUHVVHDFHSWDQODVWDUMHWDV9,6$0DVWHU&DUG\'LVFRYHU2UGHQHKR\DWUDYpVGH ,QWHUQHWGXUDQWHODVKRUDVWRGRVORVGtDV(Q((88GEApplianceparts.com o de forma telefónica al 877.959.8688 durante el horario de atención comercial. Las instrucciones que figuran en este manual cubren los procedimientos que serán realizados por cualquier usuario. Otros servicios técnicos generalmente deben ser derivados a personal calificado del servicio. Se deberá tener cuidado, ya que una reparación indebida podrá hacer que el funcionamiento no sea seguro. Contáctenos Si no se encuentra satisfecho con el servicio que recibió de GE Appliances, comuníquese con nosotros a través de nuestro sitio Web con todos los detalles, incluyendo su número telefónico, o escriba a: (Q((88*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.< GEAppliances.com/contact 34 49-2000781 Rev. 6Adobe InDesign 19.5 (Windows) Acrobat Distiller 24.0 (Windows)