Bocker | Steelsoft
ENG CATALOGUE 2019 Italian Company Since 1956 Vision Our goal is to bring the wellbeing of all-round comfort into the lives of our customers all over the world, by satisfying Companytheir needs both at homOueragnodailnisthtoe abnridngprtohfeswsieolnlbaelinfigeldof. all-round comfort int Olimpia Splendid has introduced its air conditioning and heattihnge plriovdeusctsofonotuhre cinutsertnoamtioenrasl malalrkoetvse. r tehGerowupo,rwldh,icbhy satisfyin OS IDENTITY today owns customary more than 11 commitment troewgiasrtdesretdhepadteevnetlso,pamimensttoofoeffffierciiennnto,vtinahtneiovievraintnivteeeegadrnastdebdreosntyehswteaambtlsehfsooormlureteisoidnaesnn. dtiailnaitrhtreeaatmndenpt,rwoiftehsistsional field. Vision Mission MissionVision Mission We design and build our products with respect OS VALUES for the environment, developing intelligent, efficientO, ur goal is to bring the wellbeing of all-round comfort int innovative solutionsWweidthesgigrenaatnadesbtuhieldticosu.trhperolidvuecstsofwoituhrrceuspsteocmt ers all over the world, by satisfyin for the environment, developitnhgeinr tneelleidgsenbto,tehffaictiehnotm, e and in the and professional field. innovative solutions Iwnithngorveaattaieostnhetics. Our goal is to bring the wellbeing of all-round comfort into the lives of our customers all over the world, by satisfying their needs both at home and in the and professional field. Innovation for us is synonym of creating engineering solu- ttihoeWnmsewosittdhreecfuisntiteigndgnd-eesdaiggenn.tdeWcehbncrouelaoitgleyd,obuyroipnurtoerdgurapcttrisnorgedltyhuinecmgtuswpiotnhwith respect for the theenstrvicitreostnpmrodeuncttp,rodtoecovlse;leovperiynygeariwnetienvlelsitgiennrets,e-efficient, innovative arcshoalnudtidoevnelsopwmietnht, wgitrhetahte apuerpsotsheeotf idcesve.loping our one of a kind patents. Values Values M5i%ssio4n 50+ TIUNRNNOOVEVRAINTVIEOSTNED CALORIMETRIC REGISTERED Values for theIWnennevodivreaostniigmonnea,nnDtId,NedsbNeiugvOineldl,VoSopAuuiZInsrNtgIpOaNriinoNnOdtaEeuVblcliAitlgisZteywInOitat,NhnedEfrfeitcshipeeenctvt,alue of People GRUPPOOS1.3.2 InnovINatRi&oDn for us isCHsAyMnBoEnRSym of TcRrAeDaEtMinARgKSengineering solutions GRUPwPO OiSt1h.3.2cutting-edge technology, by INNOVAZIONE integrating them INNOVAZIONE with the most refined design. We create our products relying upon the strictest BELLEZZA ARCHITETTONICA SOSTENIBILITÀ BELLEZZA ARCHITETTONICA SOSTENIBILITÀ Design are tihnenopvialltaivres built a history msoonaludwteihooincfIhsgnwrpmnforooieowtdnrvhutta,tchwhtgtiirpetaoheronaptthod,taecDoasepltuseen;rss6ptetiohvg0hseuenerysoy,tfieiyaSdceaeassuvrr.messRESPwONlSAtBILoITÀ.eaopiiuinnngrvaeocsbutoirilmonintRrEyeSpPONeSABILITÀosaaefnaanryckdhindatnhpdaetdeenvvtaes.lloupe- of Peopl are the pillars on whicRh for the past 60 years our compan We commit to protecting the artistic and historic heritage of 4 CAMERE bui2lt40a histor512y2%0made o55f103g2+rowth a5n3d enthusiasm. our Country and we strive to achieve the same goal all over the world. We INGEGNERCIANMEELRREEPARTO crIeNBFaGRAEtTVGeTENUTpRETRArITIoDONjIEIeDNLEcVRSEtEISsPGTANIwTROThOich aBRrEeVMcEToATRmICDHIpIDlEeStIGeNly integratMeAdRCHI CALORIMETRICHE RICCEiARnLCOAeREvIMSeEVrTIyLRUIeCPHnPEOvironSUmIRPIINeRCnOERRD&tCOD,ATtOTEhGISNaEVISnIAILSNkUTNsPEOPNt*OToI a tShUoI PuRgOEGDhIOStTTToRIAuETStIISaTnENdTIrefinedRaEGeIS-TRATI sthetic. Our Made in Italy has been recognized and awarded www.olimpiasplendid.it Innovation, Design, Sustainability and the value of People are the pillars on which for the past 60 years our company built a history made of growth and enthusiasm. DintEerSnIaGtioNnally, thanks to our collaboration with prestigious We create projects Italian Designers such as www.olimpiasplendid.it Ercoli & Garlandini. wSahraicFherraarrie, Kcinogm&pMlieratnedlya ainndtegrated in every envi- ronment, thanks to a thought out and refined aesthetic. Our Made in Italy has been recognized and awarded internationally. Values 10+ DESIGN AWARDS 2 Agency Partner CasaClima - KlimaHaus SUSTAINABILITY 3 We believe that technologic progress should go hand in hand with Intnheovreastpieoctno,f Dnaetsuiraglnre, sSouurcsetsa. iOnliambpialitSypleanndidd isthaefouvnadliunge of Peopl arme etmhbeerpanildlasurpspoornterwofh: EiccohpefdoarndthRiedopmauss.t 60 years our compan built a history made of growth and enthusiasm. PEOPLE We created our company by developing technology and managerial skills, but we always built our activity on the intrinsic value of people. We invest in resources the whole Group can believe in and trust, so that our efficiency and quality are the result of our experience. 1 nity, stems from the values that inspire it. Se- never considered it an end but a way to fulfill riousness, competence, commitment, respect our abilities and our ambitions." Company and responsibility are cornerstones for growth. Speaking for myself and my family, I would also add the spirit of sacrifice. Owners are expected Mr. Roberto Saccone President Extract of the speech given to the employees Usto show even more responsibility, which is con- veyed through their duty to put themselves at during Olimpia Splendid 60th anniversary celebration. " e success of any company, or of a community, stems from the values that inspire it. Seriousness, competence, commitment, respect and responsibility are cornerstones for growth. Speaking for myself and my family, I would also add the spirit of sacrifice. Owners are expected History to show even more responsibility, which is conveyed through their duty to put themselves at the service of the company. For this reason we never considered it an end but a way to fulfill our abilities and our ambitions." Mr. Roberto Saccone President - Extract of the speech given to Founded in 1956 in Gualtieri as a family companthye, eamtptlohyeeesbdeugriinngnOliinmgpiaOSlpilmenpdiida60Stphlaennnidveirdsagryacienlesbraatiofon.- History othold as a leading manufacturer of wooden, gas and paraffin heating units. In the `80s we began Ftohuneddedeivne19lo5p6 min Geunatltioerfi oasuarfafimrsilty caoimrpcaonny, datitthioe nbeigningnirnagnOglime,pwiahSpilleendinid gtahines9a 0foosthwoled abseaclaeamdinegtmhaenusfeacctournerdoflwaorogdeesnt, gsaeslalnedrpoafrapffionrhtaeabtilneg auniritsc.oInntdhieti`8o0nsewresbiengaIntathley.deTvhelaonpmksentooftohuer fiirnsttuaiirtcioonnditaionndingthraenglea, uwnhiclehinotfhoe u90rsfiwrestbeacairmceothne- sudenciiott,niUodNnlaIeCrgOre,wsfrtoismtehll2eo0ru0ot0f peoonxrwttaeabrrldensaaoirulcruocnnodmiittpi,oaUnneyNrtshIirCnivOIetsa,,lyjfu.rsotmlaiknek2so0utor0gtho0ealison.ntuwitiaonrdansdothuerlcauonmchpoaf onuyr fitrhstriavirecso,ndjuitsiotnelirkweithoouurt egxotearnlasl. FFoor orveorv6e0rye6a0rs Oyleimaprisa SOplleinmdipd ihaasSbproluegnhtdiitds mhaades inbrItoaulygphrotduicttss omn athdeeintienrnaIttiaonlyal pmraorkdeutscwtisthoitns ctuhsteomianrtyecronmamtiitomnenatl tBmorwasaairlrdkasnetdthswe edweevixtephloorptimitnseoncvteuorfs5et0foficmcoiueannttr,ryiienscnwoovomarltdimvweiidatenm.d erennetwtaobwleasorldustiotnhs.eWde ehavveeloesptamblieshnetd o4fsuebfsfiidciaieriensti,niCnhninoav, Faratnivcee, Sapnaidn arnednewable solutions. We have established 4 subsidiaries in China, France, Spain and Brasil and we export in over 50 countries worldwide. the Group 5 DTP0927 OLIMPIA SPLENDID ITALY Headquarters & Factory plant OLIMPIA SPLENDID FRANCE S.A.R.L. commercial branch 2 OLIMPIA SPLENDID GROUP OLIMPIA SPLENDID AIR CONDITIONING (SHANGHAI) CO., LTD. commercial branch OLIMPIA SPLENDID BRASIL commercial branch OLIMPIA SPLENDID OLIMPIA SPLENDID IBERICA S.L. commercial branch OLIMPIA SPLENDID USA Inc. commercial branch A World of Customized Services Download Area All of the documentation necessary for installation and use of our machines can be found in the download area at www.olimpiasplendid.com Reserved area Do you need performance data and specifications relating to heat pumps and plant terminals? Access the reserved area for all necessary information. However, if you want additional information regarding our products, consult the "products documentation" section. Here, you will find the energy labels, templates use and installation manuals and product catalogue. 3 INDEX 07 SiOS 08 SiOS 12 AQUADUE CONTROL 15 HEAT PUMPS 18 SHERPA® AQUADUE 22 SHERPA® AQUADUE TOWER 28 SHERPA® MONOBLOC 32 SHERPA® 36 SHERPA® SHW 40 SHERPA® RANGE ACCESSORIES 45 TERMINAL UNITS SYSTEMS 50 BI2® AIR 58 BI2® WALL 62 BI2® SMART 74 BI2+® 82 BI2® NAKED 90 BI2® 4 TUBES 94 CI2® WALL 97 CMV 100 SITALI DF 100 PURE 102 SITALI SF150 103 SITALI SFE100 166 DOLCECLIMA® SILENT 10 P 168 DOLCECLIMA® SILENT 12 P 170 DOLCECLIMA® 12 HP P 172 DOLCECLIMA® AIR PRO 13 A+ 174 DOLCECLIMA® AIR PRO 14 176 DOLCECLIMA® AIR PRO 14 HP 179 AIR COOLERS 180 PELER 4E 182 PELER 4 184 PELER 5 186 PELER 6E 188 PELER 7 190 PELER 20 192 PELER CHILL 195 DEHUMIDIFIERS 196 AQUARIA SLIM 10 P 198 AQUARIA SILENT 14 200 AQUARIA 16 202 AQUARIA 16T 204 AQUARIA 22 206 AQUARIA THERMO 22 208 AQUARIA 28 210 SECCOPROF 28/38 105 UNICO 110 KIT UNICO® WI-FI 112 UNICO® AIR 114 UNICO® AIR INVERTER 116 UNICO® AIR RECESSED 118 UNICO® AIR INVERTER RECESSED 120 UNICO® SMART 122 UNICO® INVERTER 124 UNICO® PRO INVERTER 128 UNICO® TOWER INVERTER 12 HP 130 UNICO® TWIN 132 UNICO® EASY 134 UNICO® R 136 UNICO® BOILER 139 FIXED AIR CONDITIONERS 140 KIT WI-FI SPLIT 142 NEXYA® S4E INVERTER 144 NEXYA® S4 COMMERCIAL 152 NEXYA® S4 MULTISPLIT 159 PORTABLE AIR CONDITIONERS 160 DOLCECLIMA® COMPACT 8 P 162 DOLCECLIMA® COMPACT 9 P 164 DOLCECLIMA® COMPACT 10 P 4 213 HUMIDIFIERS 214 LIMPIA 2 216 LIMPIA 4 218 LIMPIA 6 220 LIMPIA PURE 222 AQUA PURE 225 AIR PURIFIES 226 AURA LI 228 AURA DI 231 AROMA DIFFUSERS 232 ASTOMI 80 234 ASTOMI 200 236 ASTOMI SOUND 239 FAN HEATERS 240 CALDO EASY 242 CALDO CIRCLE 20 244 CALDO CIRCLE 22 246 CALDO CIRCLE 22 H ION 248 OBLÒ 2.2 250 CALDOSILENT ECO 252 CALDOSILENT 255 CERAMIC FAN HEATERS 256 CALDODESIGN 258 CALDOSTILE M 260 CALDOSTILE D 262 CALDOSTILE DT 264 RADICAL TORRE METAL 266 CALDO UP T 268 CALDO CRYSTAL 271 THERMOCONVECTORS 272 CALEO 274 CALEO T / CALEO TT 277 RADIATORS 278 CALDORAD 7 278 CALDORAD 9 278 CALDORAD 9TT 278 CALDORAD 11 280 CALDORAD 7/9 DIGITAL 283 INFRARED HEATERS 284 SOLARIA EVO 286 CARBON BLACK 288 SOLARIA CARBON 291 GAS STOVES 292 STOVY INFRA INFRA TURBO THERMO 294 INFRA METANO SUPER INFRA METANO TURBO 296 SG SERIES 299 PELLET STOVES 302 MIA 2 7,5 303 MIA 2 9 304 MIA 2 11 306 ENERGY LABEL ALPHABETICAL INDEX AQUA PURE AQUADUE CONTROL AQUARIA 16 AQUARIA 16T AQUARIA 22 AQUARIA 28 AQUARIA SILENT 14 AQUARIA SLIM 10 P AQUARIA THERMO 22 ASTOMI 200 ASTOMI 80 ASTOMI SOUND AURA DI AURA LI BI2® 4 TUBES BI2® AIR BI2® NAKED BI2® SMART BI2® WALL BI2+® CALDO CIRCLE 20 CALDO CIRCLE 22 CALDO CIRCLE 22 H ION CALDO CRYSTAL CALDO EASY CALDO UP T CALDODESIGN CALDORAD 11 CALDORAD 7 CALDORAD 7/9 DIGITAL CALDORAD 9 CALDORAD 9TT CALDOSILENT CALDOSILENT ECO CALDOSTILE D CALDOSTILE DT CALDOSTILE M CALEO CALEO T / CALEO TT CARBON BLACK CI2® WALL 222 DOLCECLIMA® 12 HP P 12 DOLCECLIMA® AIR PRO 13 A+ 200 DOLCECLIMA® AIR PRO 14 202 DOLCECLIMA® AIR PRO 14 HP 204 DOLCECLIMA® COMPACT 10 P 208 DOLCECLIMA® COMPACT 8 P 198 DOLCECLIMA® COMPACT 9 P 196 DOLCECLIMA® SILENT 10 P 206 DOLCECLIMA® SILENT 12 P 234 232 INFRA METANO 236 INFRA TURBO THERMO 228 226 KIT UNICO® WI-FI KIT WI-FI SPLIT 90 50 LIMPIA 2 82 LIMPIA 4 62 LIMPIA 6 58 LIMPIA PURE 74 MIA 2 11 242 MIA 2 7,5 244 MIA 2 9 246 268 NEXYA® S4 COMMERCIAL 240 NEXYA® S4 MULTISPLIT 266 NEXYA® S4E INVERTER 256 278 OBLÒ 2.2 278 280 PELER 20 278 PELER 4 278 PELER 4E 252 PELER 5 250 PELER 6E 260 PELER 7 262 PELER CHILL 258 272 RADICAL TORRE METAL 274 286 94 170 SECCOPROF 28/38 210 172 SG SERIES 296 174 SHERPA® 32 176 SHERPA® AQUADUE 18 164 SHERPA® AQUADUE TOWER 22 160 SHERPA® MONOBLOC 28 162 SHERPA® RANGE ACCESSORIES 40 166 SHERPA® SHW 36 168 SiOS 8 SITALI DF 100 PURE 100 294 SITALI SF150 102 292 SITALI SFE100 103 SOLARIA CARBON 288 110 SOLARIA EVO 284 140 STOVY INFRA 292 SUPER INFRA METANO TURBO 294 214 216 UNICO® AIR 112 218 UNICO® AIR INVERTER 114 220 UNICO® AIR INVERTER RECESSED 118 UNICO® AIR RECESSED 116 304 UNICO® BOILER 136 302 UNICO® EASY 132 303 UNICO® INVERTER 122 UNICO® PRO INVERTER 124 144 UNICO® R 134 152 UNICO® SMART 120 142 UNICO® TOWER INVERTER 12 HP 128 UNICO® TWIN 130 248 190 182 180 184 186 188 192 264 5 6 SiOS Olimpia Splendid Integrated Systems 7 HEATING AIR TREATMENT AIR CONDITIONING INTEGRATED SYSTEMS SiOS air-water split heat pump MULTIFUNCTIONAL air-water split heat pump MULTIFUNCTIONAL with BOILER 150 L INTEGRATED air-water SPLIT heat pump air-water heat pump MONOBLOC Integrated Systems range SHERPA HEAT PUMP 8 SHW Water heater in HEAT PUMP mode INTEGRATED SYSTEMS range Bi2 TERMINAL UNIT wall Fan coil WALL INVERTER ultraslim wall AIR CONDITIONING AIR TREATMENT INVERTER, ULTRASLIM TOTAL FLAT fan coil radiator with heating panel Olimpia Splendid naked INVERTER RECESSED fan coil radiator with heating panel AQUADUE® CONTROL MANAGEMENT and CONTROL system range Sitali Decentralised CMV Units CONTROLLED MECHANICAL VENTILATION decentralised and with heat recovery APP SiOS 9 HEATING SiOS Olimpia Splendid Integrated Systems e system is composed of: · Sherpa Heat Pump · Bi2 terminal Unit · Aquadue Domotic Control · CMV decentralised Sitali · Aquadue plants management and control system FUNCTION LOW TEMP RADIATION VENTILATION HEATING COOLING DEHUMIDIFICATION AIR FILTERING SHW UP TO 75°C REMOTE SYSTEM MONITORING RECIRCULATION OF THE AIR MOULD PREVENTION App SiOS Remote control touch screen control panel HEATING, COOLING AND DHW AT 75°C ALL FROM RENEWABLE SOURCES ACS 75° 75°C DOMESTIC HOT WATER DHW AND COMFORT AT THE SAME TIME traditional heat pump 55% 45% ANTILEGIONELLA CYCLES AVOIDABLE TOUCH SCREEN USER INTERFACE Renewable share Non renewable share Sherpa AQUADUE® Tower heat pump 150 LT INTEGRATED BOILER 45% 55% 10 INTEGRATED SYSTEMS Sitali DECENTRALISED RESIDENTIAL CONTROLLED MECHANICAL VENTILATION SYSTEM FEATURES · Configuration management and control of the plant (Laptop, smartphone and tablet) · Cooling, Heating, Production and stocking of high temperature SHW up to 75°C* · Complete comfort: simultaneous air conditioning and production of DHW* · Production of high temperature DHW guaranteed independently from outdoor climatic conditions and without the need for integration · 40°C SHW supply up to 3,6 days** · Heating via radiation or ventilation · Summer air conditioning and dehumidification · deuhumidification (also combined with floor hea- ting***) · Decentralised, controlled mechanical ventilation system with heat recovery for ventilation * Only Sherpa Aquadue e Sherpa Aquadue Tower model ** Qref 2,1 kWh / day/boiler 150lt regulation EN16147, 2015 only Sherpa Aquadue Tower model *** Floor heating not included in the system AIR CONDITIONING AIR TREATMENT TERMINAL FOR ANNUAL AIR CONDITIONING WITH RADIANT PANEL Radiant technology: comparison with other systems: · An average higher surface temperature that means greater radiation capacity · Greater uniformity in surface warming and therefore a wider radiating surface · Amplification of natural convection · A reduction of water content for a faster system flow Tubular heating panel OS non-hydronics radiant systems 11 HEATING Aquadue Control Management and control system of the air-conditioning/heating installation and domestic hot water production. WHAT IS AQUADUE® CONTROL ? It is the home automation management system designed by Olimpia Splendid for highly energy-efficient residential installations. It integrates all Olimpia Splendid's hydronic systems: Bi2, the ultraslim terminals with heating panels, and Sherpa inverter heat pumps are more integrated and efficient. AQUADUE® CONTROL can autoconfigure, control, and manage all its functions: - ventilated or irradiated heating - cooling - dehumidification - hot water production AQUADUE® CONTROL integrates the energy advantages of the heat pump generators with the comfort advantages of the Bi2 terminals adding the possibility to manage each unit locally, as well as remotely. DOMOTIC CONTROL TO MAXIMIZE COMFORT - climate integration between heat pump generators and FAN COIL RADIATOR system terminals - Selection of dedicated comfort zones - Weekly programming - 3 "special programs" for diverse comfort needs - Up to 192 units under control - Remotization from smartphone / tablet using APP for iOS and Android MULTIZONE , MULTICOMFORT anks to the icon interface, the access to heat pump generators and to terminal units is immediate and extremely simple, and their management is integrated and under control.. AUTOPLAY Independently identifies system units organizing them by type and environment and also groups and renames them according to user needs. CONTROL MULTIZONE, MULTICONTROL For each group of generators or system terminals you can check and adjust: - Operation mode - Set points - Temperatures levels of the water system - Levels of ambient temperatures and climatic curves - Programs 12 INTEGRATED SYSTEMS TECHNOLOGY FEATURES Compatible with the full Olimpia Splendid hydronic range - Bi2 and Sherpa heat pumps Multiple access levels: single access levels with password ensure different editing and intervention access Multi-zone control: heat pump generators control, control of each individual system terminal or system terminal groups Management of potential back-up thermal groups or other elements, such as circulators Operating modes display and alarms Clock thermostat with weekly or daily programming Heat pump generators climate curve integration with configured comfort levels Simplified interconnection thanks to CPU board contacts Integration with BACnet module Management of up to 192 units Remote system supervision via app CPU containing Ethernet TCP/IP CPU CONTROL e CPU has two Ethernet ports for connection to a personal computer or a TCP / IP network or router / switch for remote management, including preconfigured OS application. AQUADUE TOUCH 7'' touch screen wall interface. Optional device. AIR CONDITIONING AIR TREATMENT LIVING COMFORT, MAXIMUM ENERGY SAVING With Aquadue control you can select five modes of operation with optimized algorithms with climatic heat pump curves which maximize energy savings - heating comfort - heating economy - cooling comfort - cooling economy - automatic anks to the interactive calendar these operations can be inserted In weekly and hourly programming. At the single unit system level you can supervise and configure: - Ambient Temperature Display - Set point temperature - Operating mode (heat, cold, auto) - Speed ventilation: minimum, maximum, modulated - Night Function (eliminates ventilation and maintains temperature thanks to irradiation, ensuring maximum comfort and zero noise) - Direct terminal switch off 13 HEATING 14 HEAT PUMPS 15 HEATING AIR TREATMENT AIR CONDITIONING INTEGRATED SYSTEMS SPLIT COMFORT + DHW e SHERPA Range MULTIFUNCTIONAL integrated boiler external boiler Aquadue Tower pag. 22 Sherpa Aquadue pag. 18 TRADITIONAL integrated boiler external boiler Sherpa pag. 32 - DHW 75°C - heating/cooling and DHW at the same time; it avoids interruptions in the domestic comfort supply - DHW 75°C - heating/cooling and DHW at the same time; it avoids interruptions in the domestic comfort supply - DHW 60°C - Comfort or DHW Monobloc pag. 28 Sherpa SHW - DHW 60°C - Comfort or DHW pag. 36 - DHW 65°C MONOBLOC DHW BASAMENTO 16 INTEGRATED SYSTEMS AIR CONDITIONING Compatibility accessories and boilers for heat pumps CONTROLS AND ACCESSORIES KIT Description Remote control Heating cable kit 3-way valve kit for domestic hot water Outdoor air temperature sensor kit Outdoor air temperature sensor kit DHW boiler sensor kit 1"F flow meter kit Temperature probe kit DHW boiler 200 lt standard DHW boiler 300 lt standard DHW boiler 200 lt high efficency DHW boiler 300 lt high efficency DHW boiler 300 lt high efficency and solar DHW boiler 300 lt hybrid DHW boiler 300 lt hybrid and solar Resistance for boiler 2kW Resistance for boiler 3kW Puffer inertial tank 50 lt Puffer inertial tank 100 lt Code kit B0812 B0665 B0622 B0814 B0623 B0624 B0841 B0842 01193 01194 01804 01805 01806 01807 01808 B0618 B0666 01199 01200 SHERPA X X X X X X X X X X X X X X X SHERPA AQUADUE TOWER X Included standard Included standard X X SHERPA SHERPA AQUADUE MONOBLOC X X X X Included standard Included standard X X X X X X X X X X X X X X X X X X X X SHERPA SHW x x BOILER AIR TREATMENT HEATING 17 SHERPA e multifunctional air-water split heat pump. PATENTED TECHNOLOGY e combination of an inverter air-water heat pump together with a water-water heat pump allows heating/cooling and high temperature DHW production, independently from the outside weather conditions. COP > 4 DHW 75°C Energy class: 35° 55° FEATURES DHW (Domestic Hot Water) production at a high temperature, up to 75 ° C. DHW management: a group of water-water heat pumps integrated in the indoor unit provides domestic hot water at a high temperature regardless of external weather conditions. Continuous absolute availablity of DHW: guaranteed by the redundance of the double refrigerating circuit system. Antilegionella cycles avoidable using the refrigeration cycle at high temperature. 2-stage electric heater: single or double strength activation to support the heat pump through a simple configuration of the electronic control. Each stage is activated according to the actual need of thermal power in order to optimize power consumption. Configurable points: two set points in cooling mode ree set points in heating mode (one of them for DHW): the set points are also selectable by remote contact. Weekly programmer DHW, holidays and daily with night mode. Climatic curves with outside air temperature sensor: two curves are available, one for cooling and one for heating. Climatic curves allow you to modify system water temperature supply depending on climate conditions, adapting the heat requirements of the building in order to obtain energy savings. Refrigerant gas: R410A* for the reversible circuit dedicated to air-conditioning and R134a** for the high temperature circuit dedicated to DHW production. DHW AND COMFORT AT THE SAME TIME e two interconnected refrigerator cycles allow the decoupling of the heating/cooling from the DHW production, enabling them to operate in parallel, avoiding thus interruptions in the domestic comfort supply. ACS 75° 75°C DOMESTIC HOT WATER High teZ performed through the use of electrical resistances. TOUCH SCREEN USER INTERFACE Sherpa AQUADUE® control is extremely flexible and configurable, and it allows to: - customize the response limits of the two cycles at installation - customize comfort and DHW needs at installation - optimize energy performances by managing the operation of the double refrigeration circuit. * non hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 ** non hermetically sealed equipment containing fluorinated gas with GWP equivalent 1430 18 Compatible with: CONTROL INTEGRATED SYSTEMS HEATING MODE + DHW at high temperature DHW production is guaranteed independently from the outside temperature for an optimal operation throughout the year, which is not guaranteed by traditional heat pumps. DHW Module 75°C DHW the water-water cycle used for domestic use exchanges with the air conditioning system return water. COOLING MODE + DHW at a high temperature with energy recovery e energy normally dissipated outside is recovered and used to produce DHW up to 75 ° C. DHW Module 75°C DHW 40°C COMFORT the air-water cycle is used for uninterrupted COMFORT and DHW production. Energy recovered 7°C COMFORT AIR CONDITIONING AIR TREATMENT RENEWABLE SHARE COVERAGE FOR DHW PRODUCTION WITHOUT ADDITIONAL EQUIPMENT - RES DIRECTIVE AQUADUE® technology thanks to efficient heat management guarantees, in buildings of a high energy class, the coverage share from renewable energy (Legislative Decree 28/2011) without the installation of additional devices. Traditional heat pump Sherpa AQUADUE® heat pump 55% 45% Renewable share Non renewable share 45% 55% Renewable share Non renewable share 1 Support structure 2 Primary circuit system heat exchanger 3 Expansion tank system circuit 4 Electric resistors collector 5 Primary circuit electronic circulation pump 6 3-way valve 7 Secondary circuit compressor (DHW) 8 Expansion valve circuit DHW 9 Heat exchanger circuit DHW 10 DHW circuit electronic circulation pump 11 Flow regulator 12 Gauge 13 Flow gauge 14 Automatic safety vent 15 Refrigerant connections 16 Water connections (system and external boiler) 14 13 13 4 2 3 5 11 12 6 9 8 1 14 7 10 15 16 STANDARD EQUIPMENT: - Outside temperature sensor kit - DHW boiler sensor kit 19 HEATING SHERPA AQUADUE 7 AQUADUE 11 AQUADUE 13 AQUADUE 13T AQUADUE 16 AQUADUE 16T Indoor unit Code 599510A 599506A Outdoor Unit S1 Code OS CESHH24EI OS CESHH36EI OS CESHH48EI OS CESTH48EI OS CESHH60EI OS CESTH60EI Refrigerant/water exchanger Brazed plates Brazed plates Brazed plates Brazed plates Brazed plates Brazed plates Heating capacity (a) kW 6,50 10,50 12,50 12,50 14 16 COP (a) W/W 4,12 4,14 4,12 4,12 4,11 4,11 Heating capacity (b) kW 4,30 7,20 8 8 8,50 9,20 COP (b) W/W 2,60 2,65 2,70 2,70 2,40 2,50 Heating capacity (c) kW 6,50 9,90 12,50 12,50 13,30 14 COP (c) W/W 3,40 3,14 3,21 3,21 3,10 3,10 Heating capacity (d) kW 3,80 6,20 7,20 7,20 8,50 9 COP (d) W/W 2,30 2 2,10 2,10 2,10 2,10 Cooling capacity (e) kW 7,90 11,80 12,30 12,50 13,50 15 EER (e) W/W 4,50 4,40 4 4,10 3,80 4 Cooling capacity (f) kW 5,60 8,10 10,40 10,40 11,30 12,80 EER (f) W/W 3,10 3,08 3 3 2,70 2,80 Energy efficiency class heating mode 35°/55 °C DHW circuit heating capacity (g) kW 2,15 2,15 2,15 2,15 2,15 2,15 COP (g) W/W 3,12 3,12 3,12 3,12 3,12 3,12 DHW circuit heating capacity (h) kW 1,60 1,60 1,60 1,60 1,60 1,60 COP (h) W/W 2,58 2,58 2,58 2,58 2,58 2,58 Sound pressure of indoor unit (i) dB(A) 35 35 35 35 35 35 Sound power indoor unit dB(A) 41 41 41 41 41 41 Sound power of indoor unit in heat. or cool. and DHW mode dB(A) 47 47 47 47 47 47 Sound pressure outdoor unit (l) dB(A) 54/55 56/58 60/60 60/60 60/60 60/62 Sound power outdoor unit dB(A) 64/65 66/68 70/70 70/70 70/70 70/72 Diameter refrigerant connections " 3/8-5/8 3/8-5/8 3/8-5/8 3/8-5/8 3/8-5/8 3/8-5/8 Circulator absorption DHW W 16-43 16-43 16-43 16-43 16-43 16-43 System circulator absorption W 40-130 40-130 40-130 40-130 40-130 40-130 Capacity of expansion vessel l 8 8 8 8 8 8 Power supply of indoor unit V/ph/ Hz 230/1/50 230/1/50 230/1/50 230/1/50 230/1/50 230/1/50 Maximum current absorption indoor unit (electrical heaters activated) A 18,0 18,0 31,0 31,0 31,0 31,0 Maximum current absorption indoor unit(electrical heaters deactivated) A 5,0 5,0 5,0 5,0 5,0 5,0 Additional electrical heater elements kW 1,5 + 1,5 1,5 + 1,5 3 + 3 3 + 3 3 + 3 3 + 3 Hydraulic connections " 1 1 1 1 1 1 Outdoor unit power supply V/ph/ Hz 230/1/50 230/1/50 230/1/50 400/3/50 230/1/50 400/3/50 Outdoor unit maximum absorbed current A 13,50 22 28 8,15 28 11,50 Refrigerant gas (system circuit) (m) R410A R410A R410A R410A R410A R410A Refrigerant gas charge (outdoor unit) Kg 1,95 3,20 4,00 4,00 4,00 4,30 Refrigerant gas (DHW circuit) (n) R134a R134a R134a R134a R134a R134a (a) Heating mode, inlet/outlet water temperature 30°C/35°C, outdoor air temperature 7°C d.b./6°C w.b. (b) Heating mode, inlet/outlet water temperature 30°C/35°C, outdoor air temperature -2°C d.b./-1°C w.b. (c) Heating mode, inlet/outlet water temperature 40°C/45°C, outdoor air temperature 7°C d.b./6°C w.b. (d) Heating mode, inlet/outlet water temperature 40°C/45°C, outdoor air temperature -2°C d.b./-1°C w.b. (e) Cooling mode, inlet/outlet water temperature 23°C/18°C, outdoor air temperature 35°C (f) Cooling mode, inlet/outlet water temperature 12°C/7°C, outdoor air temperature 35°C (g) Water outlet temperature 55°C/water temperature heating circuit 35°C (h) Water outlet temperature 55°C/water temperature heating circuit 12°C (i) Sound pressure values measured at a distance of 4 m in a free field (l) Sound pressure values measured at a distance of 1 m in semi-anechoic chamber (m) Equipment not hermetically sealed containing fluorinated gases with an equivalent GWP of 2088 (n) Equipment hermetically sealed containing fluorinated gases with an equivalent GWP of 1430 7 11 13 13T 16 16T cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP Cooling W7 A35 5,60 0,00 1,81 3,1 8,10 0,00 2,63 3,1 10,40 0,00 3,47 3,0 10,40 0,00 3,47 3,0 11,30 0,00 4,19 2,7 12,80 0,00 4,57 2,8 Dhw W65/W12 0,64 1,28 0,56 2,3 0,64 1,28 0,56 2,3 0,64 1,28 0,56 2,3 0,64 1,28 0,56 2,3 0,64 1,28 0,56 2,3 0,64 1,28 0,56 2,3 Cooling W7 A35 and DHW W65/W12 5,60 1,28 1,55 3,6 8,10 1,28 2,35 3,4 10,40 1,28 3,16 3,3 10,40 3,16 3,16 3,3 11,30 1,28 3,65 3,1 12,80 1,28 4,23 3,0 6,00 5,00 4,00 3,00 2,00 1,00 0,00 COOLING CAPACITY (kW) DHW CAPACITY (kW) abesl(oekcrWptrt)iicon 20 ONLY COOLING COOLING & DHW COOLING CAPACITY (kW) DHW CAPACITY (kW) abesl(oekcrWptrt)iicon COOLING + DHW WITH ENERGY RECOVERY During summer operation in cooling mode, the cycle dedicated to DHW production extracts heat from return water from the system circuit. e cooling requirements of the building is partially satisfied by the DHW cycle and the comfort refrigerating cycle must deliver less power by reducing the speed of the inverter compressor. e heat taken from the system is recovered in hot water for domestic use. e efficiency of the integrated system increases (ratio between the energy produced and the energy absorbed from the mains). INTEGRATED SYSTEMS h. min. AIR CONDITIONING LOADING TIME OF BOILERS with 15-65 °C water e patented Aquadue® double cycle allows rapid loading times of boilers, up to 40% faster than an equally capacious heat pump boiler.* Aquadue® 7 Loading time of boilers 6:41 5:29 4:17 3:05 1:53 -10 -5 0 5 10 15 20 25 Outside air temperature (C°) h. min. Aquadue® 11 Loading time of boilers 4:59 4:30 4:01 3:33 3:04 2:35 2:06 1:37 -10 -5 0 5 10 15 20 25 Outside air temperature (C°) Aquadue® 13/13T Loading time of boilers 4:59 4:30 4:01 3:33 3:04 2:35 2:06 1:37 -10 -5 0 5 10 15 20 25 Outside air temperature (C°) h. min. Aquadue® 16 Loading time of boilers 4:26 3:57 3:28 3:00 2:31 2:02 1:33 -10 -5 0 5 10 15 20 25 Outside air temperature (C°) 300 liters tank 200 liters tank 150 liters tank A B C H Weight INTERNAL UNIT AQUADUE AQUADUE AQUADUE AQUADUE AQUADUE AQUADUE 7 11 13 13T 16 16T SMALL BIG mm 500 500 500 500 500 500 mm 280 280 280 280 280 280 mm 288 288 288 288 288 288 mm 1116 1116 1116 1116 1116 1116 kg 70 70 72 72 72 72 A C B EXTERNAL UNIT S1 A B C D E F H Weight 7 11 CESHH24EI CESHH36EI MONO-FAN mm 845 946 mm 914 1030 mm 540 673 mm 363 410 mm 350 403 mm 915 1036 mm 702 810 kg 49 67 13 CESHH48EI 952 1045 634 415 404 1032 1333 95 13T 16 CESTH48EI CESHH60EI BIG 952 952 1045 1045 634 634 415 415 404 404 1032 1032 1333 1333 108 95 16T CESTH60EI 952 1045 634 415 404 1032 1333 113 h. min. AIR TREATMENT H HEATING Code B0665 - HEATING CABLE KIT Prevents the formation of ice on the bottom of the external unit in the event of prolonged operation in particularly severe conditions. 21 SHERPA Air-water split heat pump MULTIFUNCTIONAL with BOILER 150 L INTEGRATED PATENTED TECHNOLOGY e combination of an inverter air-water heat pump together with a water-water heat pump allows heating/cooling and high temperature DHW production, independently from the outside weather conditions. COP > 4 DHW 75°C Energy class: 35° 55° 55° per ACS FEATURES DHW (Domestic Hot Water) production at a high temperature, up to 75 ° C in the integrated boiler. DHW management: a group of water-water heat pumps integrated in the indoor unit provides domestic hot water at a high temperature regardless of external weather conditions. Continuous absolute availablity of DHW: guaranteed by the redundance of the double refrigerating circuit system. Antilegionella cycles avoidable using the refrigeration cycle at high temperature. 2-stage electric heater: single or double strength activation to support the heat pump through a simple configuration of the electronic control. Each stage is activated according to the actual need of thermal power in order to optimize power consumption. Configurable points: two set points in cooling mode ree set points in heating mode (one of them for DHW): the set points are also selectable by remote contact. Weekly programmer DHW, holidays and daily with night mode. Climatic curves with outside air temperature sensor: two curves are available, one for cooling and one for heating. Climatic curves allow you to modify system water temperature supply depending on climate conditions, adapting the heat requirements of the building in order to obtain energy savings. Refrigerant gas: R410A(1) for the reversible circuit dedicated to air-conditioning and R134a(2) for the high temperature circuit dedicated to DHW production. 150 l integrated high-efficiency boiler Production of mixed DHW at 40° up to 3,6 days(3) 22 DHW AND COMFORT AT THE SAME TIME e two interconnected refrigerator cycles allow the decoupling of the heating/cooling from the DHW production, enabling them to operate in parallel, avoiding thus interruptions in the domestic comfort supply. ACS 75° 75°C DOMESTIC HOT WATER High temperature DHW storage allows a reduction of the boiler volume up to 30%, to heat bathroom heater radiators and avoids highly energyconsumpting anti-legionella cycles that are normally performed through the use of electrical resistances. TOUCH SCREEN USER INTERFACE Sherpa AQUADUE® TOWER control is extremely flexible and configurable, and it allows to: - customize the response limits of the two cycles at installation - customize comfort and DHW needs at installation - optimize energy performances by managing the operation of the double refrigeration circuit. Compatible with: CONTROL INTEGRATED SYSTEMS HEATING MODE + DHW at high temperature DHW production is guaranteed independently from the outside temperature for an optimal operation throughout the year, which is not guaranteed by traditional heat pumps. COOLING MODE + DHW at a high temperature with energy recovery e energy normally dissipated outside is recovered and used to produce DHW up to 75 ° C. DHW Module 75°C 40°C DHW the water-water cycle used for domestic use exchanges with the air conditioning system return water. COMFORT the air-water cycle is used for uninterrupted COMFORT and DHW production. DHW Module 75°C DHW Energy recovery 7°C COMFORT AIR CONDITIONING AIR TREATMENT RENEWABLE SHARE COVERAGE FOR DHW PRODUCTION WITHOUT ADDITIONAL EQUIPMENT - RES DIRECTIVE AQUADUE® technology thanks to efficient heat management guarantees, in buildings of a high energy class, the coverage share from renewable energy (Legislative Decree 28/2011) without the installation of additional devices. Traditional heat pump 55% 45% Renewable share Non renewable share Sherpa AQUADUE® heat pump 45% 55% Renewable share Non renewable share 1 Support structure 2 Primary circuit system heat exchanger 3 Expansion tank system circuit 4 Electric resistors collector 5 Primary circuit electronic circulation pump 6 3-way valve 7 Circuit compressor DHW 8 Expansion valve circuit DHW 9 Heat exchanger circuit DHW 10 DHW circuit electronic circulation pump 11 Flow regulator 12 Gauge 13 Flow gauge 14 Automatic safety vent 15 Refrigerant connections 16 Water connections (system and external boiler) 17 DHW circuit technical water automatic filling 18 DHW expansion vessel 19 Cylinder for domestic hot water 20 Electric control board STANDARD EQUIPMENT: - Outside temperature sensor kit 15 16 14 12 17 6 13 2 10 99 5 8 11 18 4 20 7 3 19 1 23 HEATING SHERPA AQUADUE TOWER 7 AQUADUE TOWER 11 AQUADUE TOWER 13 AQUADUE TOWER 13T AQUADUE TOWER 16 AQUADUE TOWER 16T Indoor unit Cod. 599513A 599512A Outdoor Unit S1 Cod. OS CESHH24EI OS CESHH36EI OS CESHH48EI OS CESTH48EI OS CESHH60EI OS CESTH60EI Refrigerant/water exchanger Brazed plates Brazed plates Brazed plates Brazed plates Brazed plates Brazed plates Heating capacity (a) kW 6,50 10,50 12,50 12,50 14 16 COP (a) W/W 4,10 4,10 4,10 4,10 4,10 4,10 Heating capacity (b) kW 5 8,30 10 10 10,50 12 COP (b) W/W 3,10 3,20 3,10 3,10 2,90 2,90 Heating capacity (c) kW 6,20 9,90 11,60 11,60 13 14,60 COP (c) W/W 3,40 3,20 3,30 3,30 3,20 3 Heating capacity (d) kW 4,80 7,80 9,30 9,30 9,80 10,90 COP (d) W/W 2,50 2,30 2,20 2,20 2,30 2,20 Cooling capacity (e) kW 7,60 12,10 12,60 12,80 13,80 15,30 EER (e) W/W 4 4,40 3,50 3,50 3,10 3,20 Cooling capacity (f) kW 5,60 8,10 10,40 10,40 11,30 12,80 EER (f) W/W 3,10 3,10 3 3 2,70 2,80 Energy efficiency class heating mode 35°/55 °C DHW circuit heating capacity (g) kW 2,15 2,15 2,15 2,15 2,15 2,15 COP (g) W/W 3,12 3,12 3,12 3,12 3,12 3,12 DHW circuit heating capacity (h) kW 1,60 1,60 1,60 1,60 1,60 1,60 COP (h) W/W 2,58 2,58 2,58 2,58 2,58 2,58 Sound pressure of indoor unit (i) dB(A) 35 35 35 35 35 35 Sound power indoor unit dB(A) 41 41 41 41 41 41 Sound power of indoor unit in heat. or cool. and DHW mode dB(A) 47 47 47 47 47 47 Sound pressure outdoor unit (l) dB(A) 54/55 56/58 60/60 60/60 60/60 60/62 Sound power outdoor unit dB(A) 64/65 66/68 70/70 70/70 70/70 70/72 Diameter refrigerant connections " 3/8-5/8 3/8-5/8 3/8-5/8 3/8-5/8 3/8-5/8 3/8-5/8 Circulator absorption DHW W 16-43 16-43 16-43 16-43 16-43 16-43 System circulator absorption W 40-130 40-130 40-130 40-130 40-130 40-130 Capacity of expansion vessel l 8 8 8 8 8 8 Capacity of expansion vessel DHW l 7 7 7 7 7 7 Power supply of indoor unit V/ph/ Hz 230/1/50 230/1/50 230/1/50 230/1/50 230/1/50 230/1/50 Maximum current absorption indoor unit (electrical heaters activated) A 18,0 18,0 31,0 31,0 31,0 31,0 Maximum current absorption indoor unit(electrical heaters deactivated) A 5,0 5,0 5,0 5,0 5,0 5,0 Additional electrical heater elements kW 1,5 + 1,5 1,5 + 1,5 3 + 3 3 + 3 3 + 3 3 + 3 Hydraulic connections " 1 1 1 1 1 1 Outdoor unit power supply V/ph/ Hz 230/1/50 230/1/50 230/1/50 400/3/50 230/1/50 400/3/50 Outdoor unit maximum absorbed current A 13,5 22 28 8,15 28 11,5 Hydraulic connections DHW " 3/4 3/4 3/4 3/4 3/4 3/4 Refrigerant gas (system circuit) (m) R410A R410A R410A R410A R410A R410A Refrigerant gas charge (outdoor unit) Kg 2,10 2,75 4,45 4,00 4,45 4,20 Refrigerant gas (DHW circuit) (n) R134a R134a R134a R134a R134a R134a DHW tank capacity l 150 150 150 150 150 150 Tank interior surface Glazed steel Tank heat exchanger Steel pipe Tank insulation Hard expanded polyurethane (a) Heating mode, inlet/outlet water temperature 30°C/35°C, outdoor air temperature 7°C d.b./6°C w.b. (b) Heating mode, inlet/outlet water temperature 30°C/35°C, outdoor air temperature -2°C d.b./-1°C w.b. (c) Heating mode, inlet/outlet water temperature 40°C/45°C, outdoor air temperature 7°C d.b./6°C w.b. (d) Heating mode, inlet/outlet water temperature 40°C/45°C, outdoor air temperature -2°C d.b./-1°C w.b. (e) Cooling mode, inlet/outlet water temperature 23°C/18°C, outdoor air temperature 35°C (f) Cooling mode, inlet/outlet water temperature 12°C/7°C, outdoor air temperature 35°C (g) Water outlet temperature 55°C/water temperature heating circuit 35°C (h) Water outlet temperature 55°C/water temperature heating circuit 12°C (i) Sound pressure values measured at a distance of 4 m in a free field (l) Sound pressure values measured at a distance of 1 m in semi-anechoic chamber (m) Equipment not hermetically sealed containing fluorinated gases with an equivalent GWP of 2088 (n) Equipment hermetically sealed containing fluorinated gases with an equivalent GWP of 1430 7 11 13 13T 16 16T cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP cooling Dhw Absorpcapaci- capacity tion ty(kW) (kW) (kW) EER COP Cooling W7 5,60 0,00 1,81 3,1 8,10 0,00 2,63 3,1 10,40 0,00 3,47 3,0 10,40 0,00 3,47 3,0 11,30 0,00 4,19 2,7 12,80 0,00 4,57 2,8 A35 ACS W65/ 0,64 1,28 0,56 2,3 0,64 1,28 0,56 2,3 0,64 1,28 0,56 2,3 0,64 1,28 0,56 2,3 0,64 1,28 0,56 2,3 0,64 1,28 0,56 2,3 W12 Cooling W7 A35 e ACS 5,60 1,28 1,55 3,6 8,10 1,28 2,35 3,4 10,40 1,28 3,16 3,3 10,40 3,16 3,16 3,3 11,30 1,28 3,65 3,1 12,80 1,28 4,23 3,0 W65/W12 24 INTEGRATED SYSTEMS AIR CONDITIONING 6,00 5,00 4,00 3,00 2,00 1,00 0,00 COOLING CAPACITY (kW) DHW CAPACITY (kW) absorption electric (kW) ONLY COOLING COOLING CAPACITY (kW) DHW CAPACITY (kW) absorption electric (kW) COOLING & DHW COOLING + DHW WITH ENERGY RECOVERY During summer operation in cooling mode, the cycle dedicated to DHW production extracts heat from return water from the system circuit. e cooling requirements of the building is partially satisfied by the DHW cycle and the comfort refrigerating cycle must deliver less power by reducing the speed of the inverter compressor. e heat taken from the system is recovered in hot water for domestic use. e efficiency of the integrated system increases (ratio between the energy produced and the energy absorbed from the mains). LOADING TIME OF BOILERS With 150 litre tank, with 15-65 °C water e patented Aquadue® double cycle allows rapid loading times of boilers, up to 40% faster than an equally capacious heat pump boiler.* 7 11 13/13T 16/16T h. min. 3:14 3:00 2:45 2:31 2:16 2:02 1:48 1:33 -10 -5 0 5 10 15 20 25 Outside air temperature (C°) A B H Weight INTERNAL UNIT AQUADUE AQUADUE AQUADUE AQUADUE AQUADUE AQUADUE TOWER TOWER TOWER TOWER TOWER TOWER 7 11 13 13T 16 16T SMALL BIG mm 600 600 600 600 600 600 mm 600 600 600 600 600 600 mm 1980 1980 1980 1980 1980 1980 kg 171 171 173 173 173 173 A B 7 11 CESHH24EI CESHH36EI MONO-FAN A mm 845 946 B mm 914 1030 C mm 540 673 D mm 363 410 E mm 350 403 F mm 915 1036 H mm 702 810 Weight kg 49 67 13 CESHH48EI 952 1045 634 415 404 1032 1333 95 EXTERNAL UNIT S1 13T 16 16T CESTH48EI CESHH60EI CESTH60EI DOUBLE FAN 952 952 952 1045 1045 1045 634 634 634 415 415 415 404 404 404 1032 1032 1032 1333 1333 1333 108 95 113 AIR TREATMENT H HEATING Code B0665 - HEATING CABLE KIT Prevents the formation of ice on the bottom of the external unit in the event of prolonged operation in particularly severe conditions. * Olimpia Splendid internal tests. 25 TOUCH SCREEN INTERFACE SHERPA AQUADUE - SHERPA AQUADUE TOWER HOME PAGE e home page shows the following information: A - Date and time system B - Current Active Mode (Stand-by, cooling, heating, only DHW) C - Activated features (climate curve, DHW Turbo, DHW OFF, anti legionella, Night, ECO D - Alarms/overrides (flashing) E - Temperature values water system, active system timers, Holiday, Rating F - Temperature values DHW water boiler, active timers domestic hot water, Holiday G - Activation icons: Mode: operating mode Tset: system and domestic set point Tshow: reading of temperature sensors Timers: time programming Menu: machine functions OPERATING MODES Touching the Mode , icon, you can access the operating modes configuration page. e selection icons for all available operating modes are on this page: · Stand-by , the system is off · Cooling , the system produces cold water until it reaches the set-point (set point fixed or dynamically defined by climatic curve) · Heating the system produces hot water up to the set-point (set point fixed or dynamically defined by climatic curve) · ECO , energy savings (if climate curve active the ECO set point is not considered) · Night , the system limits the yield and noise of the outside unit · Turbo DHW, the system produces hot water using the entire power of the outdoor unit up to the limit set. SET POINT Tapping the Tset icon, you can access the configuration page of the set point. · Cooling water temperature · ECO cooling water temperature · Heating water temperature · ECO heating water temperature · Domestic hot water temperature (external boiler set point). e set points for heating and cooling are not considered by the control in the case where the climate curve mode set-point is enabled. Set point values are changed with a simple touch of the set value . TIMERS Tapping the Timers icon you can access available programs. · Timer heating/cooling · Timer DHW · Timer night · Holidays Tapping the "Timer Heat/ Cool" r " DHW Timer" or "Timer Night" icon, you can access the page where the activation bands of each timer can be visualized. 26 INTEGRATED SYSTEMS PLANT LAYOUTS SHERPA AQUADUE - SHERPA AQUADUE TOWER SHERPA AQUADUE heat pump (heating and cooling; high-temperature DHW production); fan coil terminals Bi2 SLR; example of two zone layout with simple manifold and integrated inertial storage tank for the cooling plant. DHW Aqueduct SHERPA AQUADUE heat pump (heating and cooling; high-temperature DHW production); Fan coil terminals Bi2 SLR; example of two zone layout with manifold/separator. AIR CONDITIONING AIR TREATMENT DHW Aqueduct PERFORMANCE AND ENERGY ADVANTAGES In adverse weather conditions traditional heat pumps decrease thermal output producing water at a lower temperature. Sherpa AQUADUE® as well as extending the area of operation ensures a constant heat output, in the production of Domestic Hot Water. T outdoor air Optimum area of operation of traditional heat pumps Area of operation extended - AQUADUE® technology e double refrigerator circuit allows higher DHW production temperatures thanks to the water-water circuit which are independent of outside air temperature. Heat recovery area - AQUADUE® technology in summer cooling operation the refrigeration cycle dedicated to DHW production removes heat from the comfort circuit increasing the overall efficiency of the system. 27 HEATING SHERPA Air-water heat pump MONOBLOC COP > 4 DHW 60°C Energy class: 35° 55° RENEWABLE TECHNOLOGIES Sherpa uses the heat in the air, and transfers it to system terminals in an efficient manner. For each kW of electricity consumed, Sherpa is able to produce over 4 of thermal energy. is means that 75% of energy is free, renewable and clean. OLIMPIA SPLENDID'S INVERTER DC TECHNOLOGY 100% 80% 70% COMPACT TECHNOLOGY e engineering of components has made it possible to insert a 3-way valve for the management of Domestic Hot Water. e reduced size allow installation inside a kitchen cabinet. NON INVERTER AC INVERTER DC INVERTER SAVINGS 30% SMART CONTROL e control is extremely flexible and the following interfaces can be used: 1- e programmable thermostat with easy-toread liquid crystal display. It contains the most advanced functions for controlling the various types of heat pump systems. e operating logic considers the climatic season and the heat load required and consequently adjusts the frequency of the motor on the basis of the difference between outdoor environment temperature and water flow temperature. 2- e remote control 3- Potential-free contacts 28 INTEGRATED SYSTEMS AIR CONDITIONING 1 2 4 3 1 5 FEATURES Provides DHW with temperatures up to 60 ° C Climatic curves based on outside air temperature: two for cooling and twelve for heating or it's possible to add the customized climatic curves. e climatic curves allow you to change the system temperature according with external climate conditions, adjusting the heat input to the heat requirements of the building in order to obtain energy savings. Two configurable set points in cooling, Two configurable set points in heating. Anti-freeze protection: managed by the software. Daily programmer with night mode: Night mode provides energy savings of up to 20%. Complete management of antilegionella cycles. Remote control panel with possibility of environment temperature and humidity control. Refrigerant gas R410A.* CONTROLS Programmable thermostat (included as per standard) Remote control (additional Code B0812) 1 Hydronic module (as per standard): · variable displacement pump · expansion vessel (2 or 3 litre) · automatic venting and safety valve 2 Electric control board 3 Plate heat exchanger 4 Reversible gas circuit (4-way valve) 5 Twin-Rotary Inverter DC compressor 6 External air sensor probe AIR TREATMENT HEATING * Non hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 29 SHERPA MONOBLOC 4 Outdoor Unit Cod. 01674 Refrigerant/water exchanger Brazed plates Heating capacity (a) kW 4,07 COP (a) W/W 4,15 Heating capacity (b) kW 2,80 COP (b) W/W 2,60 Heating capacity (c) kW 3,87 COP (c) W/W 3,26 Heating capacity (d) kW 2,70 COP (d) W/W 2,40 Cooling capacity (e) kW 4,93 EER (e) W/W 4,20 Cooling capacity (f) kW 3,33 EER (f) W/W 3,00 Energy efficiency class heating mode 35°/55 °C Sound pressure heating mode (g) dB(A) 42 Sound power heating mode (g) dB(A) 62 Sound pressure cooling mode (h) dB(A) 44 Sound power cooling mode (h) dB(A) 64 Capacity of expansion vessel l 2 Power supply V/ph/ Hz 230/1/50 Maximum current absorption A 9 Hydraulic connections " 1 Refrigerant gas (i) R410A Refrigerant gas charge Kg 1,195 (a) Heating mode, inlet/outlet water temperature 30°C/35°C, outdoor air temperature 7°C d.b./6°C w.b. (b) Heating mode, inlet/outlet water temperature 30°C/35°C, outdoor air temperature -4°C d.b./-2°C w.b. (c) Heating mode, inlet/outlet water temperature 40°C/45°C, outdoor air temperature 7°C d.b./6°C w.b. (d) Heating mode, inlet/outlet water temperature 40°C/45°C, outdoor air temperature -4°C d.b./-2°C w.b. (e) Cooling mode, inlet/outlet water temperature 23°C/18°C, outdoor air temperature 35°C (f) Cooling mode, inlet/outlet water temperature 12°C/7°C, outdoor air temperature 35°C (g) Heating mode, inlet/outlet water temperature 47°C/55°C, outdoor air temperature 7°C d.b./6°C w.b. (h) Cooling mode, inlet/outlet water temperature 12°C/7°C, outdoor air temperature 35°C (i) Equipment not hermetically sealed containing fluorinated gases with an equivalent GWP of 2088 MONOBLOC 6 01675 Brazed plates 5,76 4,28 3,75 2,77 5,76 3,05 3,76 2,31 7,04 3,70 4,73 3,00 42 62 44 64 2 230/1/50 11 1 R410A 1,35 MONOBLOC 8 01676 Brazed plates 7,16 3,97 4,36 2,81 7,36 3,19 4,45 2,34 7,84 3,99 5,84 2,98 44 64 45 65 2 230/1/50 14,50 1 R410A 1,81 MONOBLOC 12 01677 Brazed plates 11,86 3,95 7,83 2,85 12,91 3,03 7,43 2,31 13,54 3,66 10,24 2,96 MONOBLOC 15 01678 Brazed plates 14,46 4,09 8,98 2,81 13,96 3,23 8,98 2,34 16,04 3,85 13,04 3,00 MONOBLOC 12T 01679 Brazed plates 12,00 4,30 7,68 2,82 11,20 3,35 6,23 2,39 16,00 4,15 10,20 3,00 MONOBLOC 15T 01680 Brazed plates 15 4,20 8,49 2,75 14,50 3,30 8,40 2,39 16,00 3,81 13,00 2,91 47 67 48 68 3 230/1/50 20,70 1 R410A 2,45 48 68 49 69 3 230/1/50 22,60 1 R410A 3,385 48 68 49 69 3 400/3/50 11,10 1 R410A 2,45 48 68 49 69 3 400/3/50 11,10 1 R410A 3,385 EXTERNAL UNIT EXTERNAL UNIT A B H Peso MONOBLOC MONOBLOC MONOBLOC MONOBLOC MONOBLOC MONOBLOC MONOBLOC 4 6 8 12 15 12T 15T MONO-VENT DOUBLE VENT mm 908 908 908 908 908 908 908 mm 350 350 350 350 350 350 350 mm 821 821 821 1363 1363 1363 1363 Kg 57 61 69 104 112 116 116 Code B0622 - 3-WAY VALVE KIT FOR DOMESTIC HOT WATER. - Compact size - Two point control Code B0814 - OUTDOOR AIR SENSOR KIT (Optional) Sensor screen for measuring ambient air temperature. e sensor is necessary to enable electrical resistors activation and climatic curves. Code B0812 - REMOTE CONTROL KIT (Optional) Remote control. 30 INTEGRATED SYSTEMS AIR CONDITIONING PLANT LAYOUTS SHERPA MONOBLOC SHERPA MONOBLOC heat pump (heating and cooling; high-temperature DHW production); fan coil terminals Bi2 SLR; DHW integration with solar thermal system. SHERPA MONOBLOC heat pump (heating and cooling; high-temperature DHW production); fan coil terminals Bi2 SLR; DHW integration with solar thermal system and integrated inertial storage tank for the cooling plant. 31 AIR TREATMENT HEATING SHERPA Air-water split heat pump. COP > 4 ACS a 60°C Energy class: 35° 55° RENEWABLE TECHNOLOGIES Sherpa uses the heat in the air, and transfers it to system terminals in an efficient manner. For each kW of electricity consumed, Sherpa is able to produce over 4 of thermal energy. is means that 75% of energy is free, renewable and clean. OLIMPIA SPLENDID'S INVERTER DC TECHNOLOGY 100% 80% 70% COMPACT TECHNOLOGY e engineering of components and the reduced size allow installation inside a kitchen cabinet. NON INVERTER AC INVERTER DC INVERTER SAVINGS 30% SMART CONTROL e smart onboard control panel has been developed by Olimpia Splendid, it's extremely flexible and can be fully configured. It features all the advanced characteristics needed to manage every different kind of heat pump systems. It takes into account the climatic season, the thermal load request and adjusts consequently the operation of the motor on the basis of the difference between the temperature of the external environment and the water supply temperature. Compatible with: CONTROL 32 INTEGRATED SYSTEMS FEATURES Provides DHW with temperatures up to 60 ° C DHW Management: Sherpa can manage DHW with extreme flexibility through two management methods: water sensor inserted in the boiler or contact thermostat in the tank. Climatic curves based on the outside air temperature: two curves are available, one for cooling and one for heating. e climatic curves allow you to change the system temperature according with external climate conditions, adjusting the heat input to the heat requirements of the building in order to obtain energy savings. Two configurable set points in cooling, ree configurable set points in heating (one of which for DHW): the set points can also be selected by remote contact. 2-stage electric heater: configurable single or double stage which can be activated to support the heat pump, through verification, by electronic control, of the actual thermal capacity of the heat pump. Each stage is activated in accordance with the real need for thermal power, in order to optimize electrical consumption. Daily programmer with night mode: Night mode provides energy savings of up to 20%. Complete management of antilegionella cycles. Complete management of antilegionella cycles. Refrigerant gas R410A.* AIR CONDITIONING AIR TREATMENT 9 10b 17 10a 8 4 2 12 11 6 5 3 1 Electrical resistance 2 Circulator 3 Return water 4 BPHE Plate exchangers 5 System flow 6 Refrigerant circuit connections 7 Flow switch 8 Expansion vessel 9 Automatic air vent 10 Electrical resistance safety thermostats 11 Gauge 12 3 bar security valve * Non hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 33 HEATING SHERPA Indoor unit standard Outdoor Unit S1 Refrigerant/water exchanger Heating capacity (a) COP Heating capacity (b) COP Heating capacity (c) COP Heating capacity (d) COP Cooling capacity (e) EER Cooling capacity (f) EER Energy efficiency class heating mode 35°/55 °C Sound pressure of indoor unit (g) Sound power indoor unit Sound pressure outdoor unit (h) Sound power outdoor unit Diameter refrigerant connections Circulator absorption Capacity of expansion vessel Power supply of indoor unit Maximum current absorption indoor unit (electrical heaters activated) A Maximum current absorption indoor unit(electrical heaters deactivated) A Additional electrical heater elements kW Hydraulic connections " Outdoor unit power supply V/ph/ Hz Outdoor unit maximum absorbed current A Refrigerant gas (i) Refrigerant gas charge (outdoor unit) Kg (a) Heating mode, inlet/outlet water temperature 30°C/35°C, outdoor air temperature 7°C d.b./6°C w.b. (b) Heating mode, inlet/outlet water temperature 30°C/35°C, outdoor air temperature -2°C d.b./-1°C w.b. (c) Heating mode, inlet/outlet water temperature 40°C/45°C, outdoor air temperature 7°C d.b./6°C w.b. (d) Heating mode, inlet/outlet water temperature 40°C/45°C, outdoor air temperature -2°C d.b./-1°C w.b. (e) Cooling mode, inlet/outlet water temperature 23°C/18°C, outdoor air temperature 35°C SHERPA 7 SHERPA 11 599501A OS CESHH24EI OS-CESHH36EI Brazed plates Brazed plates 6,50 10,50 4,12 4,14 4,30 7,20 2,60 2,65 6,50 9,90 3,40 3,14 3,80 6,20 2,30 2 7,90 11,80 4,50 4,40 5,60 8,10 3,10 3,08 SHERPA 13 OS-CESHH48EI Brazed plates 12,50 4,12 8 2,70 12,50 3,21 7,20 2,10 12,30 4 10,40 3 SHERPA 13T SHERPA 16 599503A OS-CESTH48EI OS-CESHH60EI Brazed plates Brazed plates 12,50 14 4,12 4,11 8 8,50 2,70 2,40 12,50 13,30 3,21 3,10 7,20 8,50 2,10 2,10 12,50 13,50 4,10 3,80 10,40 11,30 3 2,70 35 41 54/55 64/65 3/8-5/8 40-130 8 230/1/50 14,10 1,1 1,5 + 1,5 1 230/1/50 13,5 R410A 1,95 35 41 56/58 66/68 3/8-5/8 40-130 8 230/1/50 14,10 1,1 1,5 + 1,5 1 230/1/50 22 R410A 3,2 35 41 60/60 70/70 3/8-5/8 40-130 8 230/1/50 27,20 1,1 3 + 3 1 230/1/50 28 R410A 4 35 41 60/60 70/70 3/8-5/8 40-130 8 230/1/50 27,20 1,1 3 + 3 1 400/3/50 8,15 R410A 4 35 41 60/60 70/70 3/8-5/8 40-130 8 230/1/50 27,20 1,1 3 + 3 1 230/1/50 28 R410A 4 (f) Cooling mode, inlet/outlet water temperature 12°C/7°C, outdoor air temperature 35°C (g) Sound pressure values measured at a distance of 1 m in semi-anechoic chamber (h) Sound pressure values measured at a distance of 4 m in a free field (i) Equipment not hermetically sealed containing fluorinated gases with an equivalent GWP of 2088 SHERPA 16T OS-CESTH60EI Brazed plates 16 4,11 9,20 2,50 14 3,10 9 2,10 15 4 12,80 2,80 35 41 60/62 70/72 3/8-5/8 40-130 8 230/1/50 27,20 1,1 3 + 3 1 400/3/50 11,5 R410A 4,3 A B C H standard weight INTERNAL UNIT SHERPA SHERPA SHERPA SHERPA SHERPA SHERPA 7 11 13 13T 16 16T SMALL BIG mm 500 500 500 500 500 500 mm 280 280 280 280 280 280 mm 296 296 296 296 296 296 mm 810 810 810 810 810 810 Kg 36 36 38 38 38 38 A C B EXTERNAL UNIT S1 7 11 CESHH24EI CESHH36EI MONO-VENT A mm 845 946 B mm 914 1030 C mm 540 673 D mm 363 410 E mm 350 403 F mm 915 1036 H mm 702 810 Weight kg 49 67 13 CESHH48EI 952 1045 634 415 404 1032 1333 95 13T 16 CESTH48EI CESHH60EI DOUBLE VENT 952 952 1045 1045 634 634 415 415 404 404 1032 1032 1333 1333 108 95 16T CESTH60EI 952 1045 634 415 404 1032 1333 113 H 34 PLANT LAYOUTS SHERPA SHERPA heat pump (heating and cooling; high-temperature DHW production); fan coil terminals Bi2 SLR; DHW integration with solar thermal system and inertial storage tank for the cooling plant. INTEGRATED SYSTEMS AIR CONDITIONING SHERPA heat pump (heating and cooling; high-temperature DHW production); fan coil terminals Bi2 SLR; DHW integration with solar thermal system and integrated inertial storage tank for the cooling plant. AIR TREATMENT HEATING Code B0622 - 3-WAY VALVE KIT FOR DOMESTIC HOT WATER. - Compact size - Two point control Code B0624 - DHW BOILER SENSOR KIT Sensor for measuring and direct control of water temperature in the domestic water storage tank. Code B0623 - OUTDOOR AIR SENSOR KIT Sensor screen for measuring ambient air temperature. e sensor is necessary to enable electrical resistors activation and climatic curves. Code B0665 - HEATING CABLE KIT Prevents the formation of ice on the bottom of the external unit in the case of prolonged operation in extreme conditions. 35 SHERPA SHW Heat pump water heater COP > 2,6* DHW a 65°C Energy class: 2 VERSIONS: - SHERPA SHW 200 Standard that envisions the heat pump and the electric heating element with 200 l tank - SHERPA SHW 300S With auxiliary coil for use combined with panels with 300 l tank PHOTOVOLTAIC INTEGRATION Contact for integration with photovoltaic plant, which forces switch-on and raises the machine set-point. e energy produced by the photovoltaic system is stored to lower the DHW production costs and maximise the energy saving. MANAGEMENT OF SOLAR ENERGY Compatible with the solar thermal system: the unit can work with a second energy source such as solar panels. SMART CONTROL e effective heat pump set is adjusted by a climatic curve, so that in the case of hot air withdrawn from the outside (over 25°C with water at 65°C, over 35°C with water at 55°C), high pressure alarms are prevented. e electric heating element automatically integrates the temperature of the tank at the desired set whenever the effective set is adjusted by the climatic curve. HIGH EFFICIENCY High efficiency compressor with R134a refrigerant. DHW PRODUCTION TO -10°C Production of DHW in heat pump mode with air temperature up to -10°C. * Values obtained with outdoor air temperature 7°C and relative humidity 87%, inlet water temperature 10 °C and temperature set 55°C (EN 16147). 36 INTEGRATED SYSTEMS AIR CONDITIONING FEATURES Work range in heat pump mode with air temperature from -10°C to 43 C°. Carbon steel tank with double layer vitrification. Anti-corrosion magnesium anode to ensure duration of the tank. Condenser wound externally on the boiler free from deposits and gas-water contamination. ick expanded polyurethane (PU) heat insulation. Plastic outer coating. Acoustically insulated plastic upper lid. High efficiency compressor with R134a refrigerant. High and low pressure gas safety devices. Electric heating element available in the come back-up unit (with integrated thermostat with safety device at 90°C), which ensures hot water at constant temperature also in extreme winter conditions. ON-OFF contact to start the unit from an external switch. Weekly disinfecting cycle. Possibility of managing the domestic hot water circulation or solar integration (presence of a dedicated temperature probe, flow meter inlet and command for an outdoor pump). Electronic expansion valve for prompt control. Insulation: rigid polyurethane with thickness of 45 mm. Plastic outer coating. Electronic thermostatic valve. SHERPA SHW 300S Photovoltaic integration SHERPA SHW 200 Photovoltaic integration AIR TREATMENT HEATING 37 SHERPA SHW CODE ADVANTAGES SHW 200 01809 SHW 300S 01810 golato da unTaankcrauterdvcaapaccitlyimatica, per · The actual set of the heat lpump is cont2r0o0lled by a climate curv3e00 for evata dall'estCeOPr*no (oltre i 25°C con 55°C), si posEsnaerngyoclavsserificare allarmi Minimum air temperature atico la tempMSoaeuxnrimdauptomuwareirar tedmepelrastuererbatoio tivo venga Arveergagoe ellaecttroic codnsaumllpatiocn urva preventing that the hot air taken from out2s,6ide (over 25°C with wat2e,6r at 65°C, over 35°C with water at 55°C) may cause high pressure alarms. · The tank etolecthtreicdaleshireeadtesretintitneggdb°°rw(CCaA)hteesnatuhteomacatutiac-541930lalsleytttihneg temperature is controlled boy-54f1930 the the weather curve. kW 0,56 0,56 Maximum quantity of hot water at 40°C* · Predisposition for integrationl with photovol2t3a5ic system. After enablin3g15the con impianWattoer flfowortaotevmaoxilmtuamicopoer.atinSgupressure photovoltaic inverter, the seMtpatemperature w1 ill increase to the maxim1 um set di tempeVroaltatguera viene innalzato value (according to the climVa/Wte control). 220-240 220-240 ente con la rEHeleegacttrooiculthapeuzattiiongneleemcenlitmoutaputtica) W 1200 1200 W 1870 1870 Standard air flow rate m3/h 450 450 Minimum volume of the place of installation m3 20 20 Empty weight installata vIPnircsoutielnacttiiooonn trahatilcilnkagnescsucina, nel F· LWEXasItBe IhLeIaTtYreAcoNvDeryB: EthNeEumFInkPmgIiTt Scan be 112 instIa4P5Xl1led near the kitchen, 137 inI4P5X1the te in ogni stMaanxizmaumctoemnpeuratnurae odf thisecstroeratgae room boiler-room or the garage,°Cbasically in ev4e3 ry room which has a l4a3 rge bbia elevataMeinfimfiucmietenmzpearateurne oef trhge setotriacgearoom number of waste-heat so th°Cat it has the h-1i0gher energy efficiency -e10ven asse. Exchange surface of the solar thermal coil (lower)with very low outside tempemr2atures during th- e winter. 1,20 midificazioneSt:atilc'purenssiutreàavapilaublòe essere · Hot water, cooling and dehPua midification: t6h0e unit can be placed in60the pdaifliecsatrlaa,sntaenl*LzsVaoanaealdud.metPesrmooinbfiptelaetriaenteurdrrewasietthto5o.5u°QtCdo(uoErNaa1in6r 1tde4m7o)p. erature 7°C lwaanduartneeladtrivrieythulormowidoiteym8r7s,%t,ihinnleetcwtleoatemtrhtepimnepgerraatrtuoure or10em°Ca,ngdydmehourmgiaLdriafigees .thWehreonomit producesL as well. hot tà può lavorare con una seconda · Compatible with solar energy: the unit can work with a second heat i, caldaie o altre differenti fonti source as solar panels, boilers or other different energy sources (remark: ernativa non viene fornita). the extra heat source is not provided with). ogettata è unicamente quella di · The function for which the unit has been designed is only that of heat qua calda saACnCiEtSaSrOiaR.IEQS ualsiasi altro pump for DHW production. Any other side effect (ambient cooling, umidificazionBe08, 4r1ecu1"Fpfleowromectaerlokitre di cio accessorio. I dati prestazionali te alla funzioB0n8e42 diTermispceraaltudreapmrobeenktito dehumidification, waste heat recovery) should be considered as a perk. The performance data are therefore provided only with respect to the function of water heating. mm RiprOeusatddo'oarriaaier sintetarnkae ftiono-10a°-C10°C Electronic expansion vVaallvveolfaoreaspccaunrsaiotenaedejulestttmroennicta opfeorvuenr-ahreeagtionlgazione accurata del surriscaldamento 1888 mm FAlattraecdcchoinanceacrttieolnlastbraetpwaereten cooling pfraigrtoaendsetrabnaktofoior eaacsayrmteallainpteenrance una facile manutenzione SerbTaantokioMaMdaedien iIntaItlyaly 200 200-S 200-D 300 300-S 300-D V/Ph 220-240/1/50 Hz l 228 220 217 286 278 273 Watt 1870 (+1200*) 38 Watt A 503 (+1200*) 2,23 (+5,2*) Calido Versorgung / Alimentación / Alimentação Tankvolumens / Volumen de agua / Volume da agua Kühlleistung / Potencia / Potência (1) Leistungsaufnahme / Pot. absorbida / Pot. absorvida (1) Stromaufnahme / Corr. absorbida / Corr. absorvida (1) INTEGRATED SYSTEMS AIR CONDITIONING N° TYPE OF ATTACHMENT 1. Hot water flow 2. Anode 3. Tank upper temperature probe 4. Recirculation 5. Electric heating element 6. Tank lower temperature probe 7. Solar energy flow 8. Tank temperature auxiliary probe 9. Solar energy return 10. Domestic cold water inlet 11. Condensate drain 200 - 300 1" 1"1/4 ø 10 1/2" 1"1/4 ø 10 1" ø 10 1" 1" ø 16 Model A B C D E F G H I L M N O P Q R 200 654 177 1638 1007 862 742 742 567 - 257 257 692 877 927 927 1063 300 654 177 1888 1177 1112 977 852 692 352 257 257 692 897 1087 1177 1313 SAFETY DISTANCES min 0,45 m min 1,2 m min 0,5 m min 0,5 m min 0,3 m AIR TREATMENT HEATING 39 SHERPA range accessories SHERPA / SHERPA AQUADUE / SHERPA MONOBLOC OS Code Description 01193 Standard cylinder 200 L Cylinder puffer Total Capacity Capacity heigh litres litres mm 200 - 1215 Diameter with insulation insulation mm mm 600 50 Energy Class C 67W Coil exchangers Coil surfaces Heat Pump mq Empty weight kg 1 1,5 90 C 01194 Standard cylinder 300 L 300 - 1615 600 50 1 85W 1,8 115 01804 High-efficiency HE cylinder 200 L 200 - 1215 640 70 B 1 double coil 3,0 120 51W 01805 High-efficiency HE cylinder 300 L 300 - 1615 640 01806 High-efficiency HES solar cylinder 300 L 300 - 1615 640 01807 Hybrid HY cylinder 300 L 300 80 1925 690 B 70 1 double coil 4,0 160 63W B 1 double coil 70 + 3,7 140 63W 1 solar unit 70 B 1 2,8 150 73W 01808 Hybrid HY solar cylinder 300 L 300 80 1925 690 70 B 73 1 + 1 solar unit 3,3 150 01199 Heat storage 50 L B - 50 935 400 50 - 34W - 25 01200 Heat storage 100 L B - 100 1095 500 50 - 50W - 35 B0618 Resistance for boiler 2 kW B0666 Resistance for boiler 3 kW B0617 Flange resistance kit DHW STANDARD CYLINDERS CYLINDER FOR DOMESTIC HOT WATER PRODUCTION energy class C Cylinder with 1 carbon steel coil, complete with anodic protection, internal vitrification treatment in compliance with DIN 4753-3 and EN 10025 Standards. Insulation: Rigid polyurethane with thickness of 50 mm N° TYPE OF ATTACHMENT 1. Hot water flow 200 ÷ 300 1" 2. Anode 1" 1/4 3. Thermometer-Probe 1/2" 4. Electric heating element 1" 1/2 5. Pallet attachment (blind) 1/2" 6. Cold water inlet 1" 7. Coil return 1" 8. Thermostat 1/2" 9. Coil flow 1" 10. Recirculation 1/2" 11. Hot water flow 1" 1/4 Model A B C D E F G H I J K L M N 200 500 1000 810 320 220 290 375 750 835 - 975 1215 - 150 300 500 1390 955 320 220 290 375 890 1165 - 1390 1615 - 150 40 INTEGRATED SYSTEMS HE/HES HIGH EFFICIENCY DHW CYLINDER energy class B CYLINDER FOR DOMESTIC HOT WATER PRODUCTION BY HEAT PUMP (HE) AND SOLAR PANELS (HES) Cylinder with 1 or 2 carbon steel coils with large exchange surface, complete with anodic protection and internal vitrification treatment in compliance with DIN 4753-3 and EN 10025 Standards. Insulation: Rigid polyurethane with thickness of 70 mm. HE 1 coil cylinder (large surface for heat pump) HES 2 coil cylinder (large surface for heat pump+ solar unit) AIR CONDITIONING AIR TREATMENT N° TYPE OF ATTACHMENT 1. Hot water flow 2. Anode 3. Thermometer-Probe 4. Electric heating element 5. Pallet attachment (blind) 6. Water inlet 7. Coil return 8. Probe 9. Recirculation 10. Coil flow 11. Hot water flow 200 ÷ 300 N° TYPE OF ATTACHMENT 300 1" 1. Hot water flow 1" 1/4 1" 1/4 2. Anode 1" 1/4 1/2" 3. Thermometer-Probe 1/2" 1" 1/2 4. Thermostat 1/2" 1/2" 5. Thermostat 1/2" 1" 6. Pallet attachment (blind) 1/2" 1" 7. Cold water inlet 1" 1/2" 8. Lower coil return 1" 1/2" 9. Lower coil flow 1" 1" 10. Upper coil return 1" 1" 1/4 11. Recirculation 1/2" 12. Upper coil flow 1" 13. Hot water flow 1" 14. Flange with electric heating element attachment 1" 1/2 Model A B C D E F G H I J K L M N HE 200 500 995 735 320 140 220 370 835 990 - 1070 1215 150 - HE 300 500 1390 945 340 140 220 395 1165 1310 - 1390 1615 150 - HES 300 500 1470 1035 590 315 140 220 495 650 865 1390 1470 1615 150 41 HEATING SHERPA range accessories SHERPA / SHERPA AQUADUE / SHERPA MONOBLOC HYBRID HY/HYS DHW CYLINDERS energy class B COMBINED HEAT STORAGE UNIT: CYLINDER FOR DOMESTIC HOT WATER PRODUCTION BY HEAT PUMP (HY) AND SOLAR PANELS (HYS) AND INERTIAL STORAGE FOR THE PLANT WATER Upper cylinder with 1 or 2 carbon steel coils with large exchange surface, complete with anodic protection and internal vitrification treatment in compliance with DIN 4753-3 and EN 10025 Standards. Lower storage tank for heating or cooled water, interior not treated. Insulation: Rigid polyurethane with thickness of 70 mm HY 1 coil cylinder (for heat pump + buffer tank) HYS 2 coil cylinder (for heat pump + solar unit + buffer tank) N° TYPE OF ATTACHMENT 300 N° TYPE OF ATTACHMENT 300 1. Domestic hot water flow 1" 1/4 1. Domestic hot water flow 1" 1/4 2. Anode 1" 1/4 2. Anode 1" 1/4 3. Thermometer 1/2" 3. Thermometer 1/2" 4. Probe 1" 1/2 4. EBD - Probe 1/2" 6. Probe 1/2" 5. EBD - Probe 1/2" 7. Boiler flow 1" 6. Probe 1/2" 8. Boiler return 1" 7. Boiler flow 1" 9. Electric heating element 1" 1/2 8. Boiler return 1" 10. Heating system return 1" 9. Electric heating element 1" 1/2 11. Heating system flow 1" 10. Heating system return 1" 12. Vent 1/2" 11. Heating system flow 1" 13. Domestic cold water inlet 1" 12. Vent 1/2" 14. EBD - Lower coil return 1" 1/4 13. Domestic cold water inlet 1" 15. EBD - Lower coil return 1/2" 14. EBD - Lower coil return 1" 17. Recirculation 1/2" 15. EBD - Lower coil return 1" 18. Upper coil flow 1" 1/4 16. EBD - Upper coil return 1" 19. Domestic hot water flow 1" 17. Recirculation 1" 18. Upper coil flow 1" 19. Domestic hot water flow 1" Model A B C D E F G H I J K L M N O P Q R S HY 300 550 1755 1300 875 340 160 160 340 505 675 765 940 1425 1675 1755 1925 150 - HYS 300 550 1755 1420 1035 810 340 160 160 340 505 675 755 945 1125 1280 1675 1755 1925 150 42 INTEGRATED SYSTEMS HEAT STORAGE TANKS BUFFER HEAT STORAGE TANKS Storage tank for cooled water, interior not treated. Can be used also for heating water. Insulation: Polyurethane 50 mm energy class B AIR CONDITIONING AIR TREATMENT N° TYPE OF ATTACHMENT 1. Vent 2. boiler flow 4. oiler return-heating at 50°C 5. oiler return-heating at 30°C 6. thermometer 7. probe 12. Electric heating element 13. Drain Model A B C D E F G 50 300 100 180 485 530 785 935 100 400 100 185 560 605 935 1095 50-100 1" 1" 1/4 1" 1/4 1/2" 1/2" 1/2" 1" 1/2 1/2" OPTIONAL ELECTRIC HEATING ELEMENTS Copper immersion heating element, IP 65, with internal adjustable thermostat and temperature limiter. L Cod. W V KG L MM ATT. B0618 2000 230 1,5 390 1"1/2 B0666 3000 230 1,5 390 1"1/2 FLANGE for HEATING ELEMENT Mandatory accessory for correct positioning of the electric heating elements if used for anti-legionella cycles. 43 HEATING 44 TERMINAL UNITS 45 HEATING AIR TREATMENT AIR CONDITIONING INTEGRATED SYSTEMS e Bi2 Range e ultraslim fan coil radiator: one system terminal unit for heating, air conditioning and dehumidification; all in just 12.9 cm. BI2 + was awarded the REDDOT DE- SIGN HONOURABLE MENTION 2013 award, for the seamless integration of reddot design award honourable mention 2013 technology and design. Bi2 + is the winner of the iF product design award 2013 in the Buildings category, selected by an internationally recognized panel of experts and designers. BI2 is the winner of the GOOD DESIGN AWARD 2014 . Founded in Chicago in 1950, GOOD DESIGN is the oldest and most acknowledged international competition for design excellence. Made in Italy WITH A SINGLE TERMINAL UNIT THE ANNUAL COMFORT CYCLE IS MANAGED: LOW TEMPERATURE RADIATION HEATING FAN COOLING DEHUMIDIFICATION AIR FILTRATION Olimpia Splendid participates in the EUROVENT: FCU program. e products mentioned are available at www.eurovent-certification.com THE BI2 SYSTEM e structure of the fan and the electric motor which modulates speed guarantee an extremely uniform air distribution and a homogeneity in ambient temperature. e whole range provides, depending on the models, three different modes of operation: -radiant heating + forced convection -radiant heating +natural convection -cooling with forced convection Moreover, the 4 tubes range also provides the mode of operation: -Simultaneous Cooling + Heating radiant heating + forced convection radiant heating + natural convection cooling with forced convection Simultaneous Cooling + Heating 46 INTEGRATED SYSTEMS RADIANT TECHNOLOGY Radiant+ technology, compared to other heating Systems, has a higher static capacity thanks to: - An average higher surface temperature that means greater radiation capacity - Greater uniformity in surface warming and therefore a wider radiating surface - Amplification of natural convection - A reduction of water content for a faster system flow non-hydronic radiant systems SLIM DESIGN Constant attention to design and to the harmonic integration with the architecture of the buildings, has led Olimpia Splendid to redesign the structure of terminal units, going from the 20-25 cm of depth of a traditional fan coil to only 12,9 cm. Tubular heating panel OS INVERTER SYSTEM e DC brushless motor adapts the air flow to the ambient thermal load optimizing comfort and reducing consumption, which is typical of inverter technology. At minimum fan speed total electrical absorption is only 5w. 100% 80% 70% AIR CONDITIONING SAVINGS 30% AIR TREATMENT SILENT TECHNOLOGY e high efficiency tangential fan enables higher air flow with low noise levels. At steady state silence is absolute, in fact, temperature is kept constant by the heating panel: without ventilation, air flows are 0 dB. NON INVERTER AC INVERTER DC INVERTER EASY INSTALLATION Versatile installation: except where differently specified, the Bi2 model can be installed on the wall, on the floor or on the ceiling. Wall installation. METAL FRAME e original shapes, lightness and solidity of Bi2 are aesthetic traits made possible by the painted metal frame and body and aluminum grille. Floor installation. Ceiling installation. EASY CLEAN Easy manteinance: the easy removability of air filters and access to the front fan simplify cleaning, even for recessed models. 47 HEATING CABINET 2 TUBES e Bi2 Range FAN COIL RADIATORS AC motor DC motor SLR Smart Inverter pag. 62 SL Smart AC motor FAN COIL UNITS DC motor pag. 70 SL Smart Inverter pag. 66 SLR Air Inverter floor pag. 50 installation wall installation wall ceiling floor SL Air Inverter installation wall ceiling floor pag. 54 installation wall installation wall SLR+ Inverter floor pag. 74 installation wall SLIR Naked Inverter floor pag. 82 installation wall SL+ Inverter SLI Naked Inverter installation wall floor pag. 78 ceiling floor pag. 86 a soffitto installazione parete SLW Wall Inverter pag. 58 installation high-wall consolle SLR 4 tubes pag. 90 installation wall floor e Ci2 Range FAN COIL RADIATORS AC motor DC motor AC motor FAN COIL UNITS DC motor LGW Wall Inverter pag. 94 BUILT-IN HI-WALL 4 TUBES CABINET 2 TUBES HIGH-WALL installazione high-wall 48 INTEGRATED SYSTEMS Compatibile AQUADUE Control AIR CONDITIONING Bi2 compatibility Optimum compatibility Code kit DC motor AC motor description SLR+ SL+ SLR Air SL Air SLW SLR SL SMART SMART SLI R SLI SL SMART SLR 4T Built-in Smart control kit B0659 X X Built-in inverter Smart control kit B0673 X X X X Electronic control kit for remotization B0707 X X Touch flat Built-in control DC B0828 X X X X X X X Touch flat Built-in control AC B0855 X X Touch design built-in control kit B0772 X X CONTROL PANEL Control kit for remotization 0-10 Volt* LCD wall clock thermostat remote control kit Inverter control kit for remotization B0756 B0736 B0685 X X X X X X X X B0685 B0685 B0828 B0828 X TR X TR X TR X X X X X X B0685 B0685 B0685 B0685 B0855 B0855 B0828 B0828 B0828 B0828 B0372 B0372 X X X X X X X X Basic Built-in control without thermostat B0658 X Built-in control kit B0371 X X Built-in control kit B0374 X Electronic control kit for remotization B0372 X X Electronic control kit for remotization Wall control kit Digital Wall control kit Manual 2-way group valves kit** B0375 B0151 B0152 B0205 X + B0756 X + B0756 X X Manual 2-way valve isolation kit B0204 X X + B0205 + B0205 2 way group valves with thermoelectric actuator kit B0139 / B0832 X X X X X X X AR AR X X AR AR X + B0756 X X + B0756 + B0707 X + B0756 X X + B0756 + B0707 X X X X X X (per 2) X X X X X X + + B0205 + B0205 + B0205 + B0205 + B0205 2xB0205 X X X X X X 2 way group valves with thermoelectric actuator kit B0825 X HYDRAULIC KITS 3 way group valves with thermoelectric actuator kit B0826 X 3 way group valves with thermoelectric actuator kit B0635 / B0834 X X X X X X X X X 2-way valves group kit with thermoelectric actuator and bypass branch with pressure relief valve B0641 / B0833 X X X X X X Adaptors couple kit 3/4 Eurokonus - 1/2" B0200 X X X X X X X X Adaptors couple kit 3/4 Eurokonus - 3/4" B0201 X X X X X X X X Kit 90° Eurokonus bend Spacer kit Minimum temperature thermostat kit Control connection extension kit B0203 B0501 B0336 B0459 X X X X X X X X X X X X X X + B0658 X X ELECTRICAL KITS Control connection extension kit B0632/ B0633 X X X X X Control connection extension kit B0839 X X * in case a Bi2 with a heating panel is used, it is necessary that the management system O-10V supports the heating version (OS radiant+ logic). ** in case a Bi2 with a radiant panel is used, the solenoid valves on the collector managed by the control kit of the Bi2 terminal can substitute the built-in ones. CONTROL o e manufacturer must program the addresses of the BUS remotization kits AIR TREATMENT HEATING 49 NEWBi2 Air SLR Air inverter e ventilradiatore® with Integral Design. With Multiset Control for all configurations Design by S. Ercoli & A. Garlandini Remote control supplied MULTISET CONTROL CONTROL TR (Touch Remote): model envisions touch control on the machine and a remote control unit (supplied). Furthermore, via a selection of keys, remote control is possible with an Olimpia Splendid wall control unit or home automation, through the Modbus RS485 signal protocol. CONTROL AR (Analogic Remote): model allows universal remoting to be configured for all wall-installed control units and home automation systems, through the 0-10V analogue or 4 speed digital signal protocol. *touch control on the machine and remote control disabled air MODEL QUADERNO TECNICO Bi2 AIR TERMINALI D'ISMLRPaIiArN20T0O 2.1.5 DIMEBNi2SSILORNaiIr wEitPh cOomSmIZaInOdNTRAMENTI 2.1.5.1 DIMENBSi2IOSLNRI aVirEwRiSthIOcoNmEmSaLndRAER SL code 01856 code 01772 Di seguito viene riportato il layout del ventilradiatore versione SLR e SL (Fig. 2) e una tabella riepilogativa delle dimensioni e il peso (Tab. 3). D A FEATURES Cools, Dehumidifies, Heats and Filters Terminal with integrated heating panel Essential aesthetics with intake from the lower side Metal front panel, sides in ABS Compact: thickness of just 12,9 cm max 15 cm 5 sizes available DC brushless Motor Unique front body for comfortable working Motorised, steel air supply flap Anti-intrusion grids on air intake and outlet Removable filters on air intake Remote control unit supplied (for TR control only) Installation: floor wall Available in colors: White RAL 9003 SLR air 400 01857 01773 Bi2 SLR Air inverter SLR air 600 01858 01774 SLR air 800 01859 01775 SLR air 1000 01860 01776 C B E Layout ventilradiatore versione SLR e SL Fig. 2 50 Rif. Fig. 2 200 400 600 800 1000 A B C D E Net weight 200 400 600 800 1000 mm 695 895 1095 1295 1495 mm 599 599 599 599 599 mm 679 679 679 679 679 mm 129 129 129 129 129 mm 150 150 150 150 150 kg 13,5 15,5 19,5 22,5 25,5 INTEGRATED SYSTEMS K F B H J C I D G E AIR CONDITIONING B Heat exchange coil C High Efficiency Coil D Tangential fan E Electric motor with resin-coated pack F Air supply flap and anti-intrusion supply grid G Condensation collector basin H Front body panel in electro-galvanised sheet steel I Anti-intrusion intake grid J Abs side panels K Touch control on machine (TR version) AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) (b) Water pressure loss (50°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply Max capacity static heating (50°C) Max capacity static heating (70°C) Water content heating panel (E) kW (E) kW lt/h (E) kPa (E) kW lt/h (E) kPa kW lt/h kPa l bar inches m3/h m3/h (E) W (E) W (E) dB(A) (E) dB(A) dB(A) V/ph/Hz kW kW l 200 0,82 0,64 142 13,1 1,05 84 10,9 1,77 152 10,9 0,47 10 Eurocone 3/4 100 160 5 11 38 52 34 230/1/50 0,37 0,59 0,19 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (f) Sound pressure measured at 1,5 m Bi2 SLR Air inverter 400 600 800 1,74 2,54 3,29 1,25 1,94 2,54 302 446 573 8,2 19 18,7 2,31 3,12 4,10 185 249 329 6,8 15,8 15,5 3,88 5,21 6,88 334 448 592 7,0 14,3 12,7 0,8 1,13 1,46 10 10 10 Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 170 180 370 320 460 575 6 7 8 19 20 24 39 41 42 53 53 54 36 37 35 230/1/50 230/1/50 230/1/50 0,42 0,50 0,62 0,71 0,84 1,04 0,27 0,35 0,43 1000 3,78 2,98 655 18,2 4,67 374 15,1 7,83 673 12,5 1,8 10 Eurocone 3/4 420 650 9 27 42 54 38 230/1/50 0,77 1,28 0,5 51 HEATING ACCESSORIES SLR Air inverter Accessories control TR CODE DESCRIPTION COMPATIBILITY STANDARD e TR (Touch Remote) command envisions a touch control on the machine and B0736 REMOTO A TOUCH A TELE- DOMOTICA PARETE OS BORDO COMANDO a remote control unit (supplied). Furthermore, via a selection of keys, remote con- trol is possible with an Olimpia Splendid wall control unit or home automation, CONTROL through the Modbus RS485 signal protocol. My Home by ON BOARD CONTROL REMOTE CONTROL B0736 LCD wall clock thermostat remote control kit. Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. Addressing for Bticino INDRZ management and AQUADUE Control Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome CONTROL Accessories control AR REMOTO A PARETE 0-10V/4 vel DOMOTICA CODE STANDARD DESCRIPTION e AR (Analogic Remote) model allows the universal remoting to be configured for all wall-installed-controls and the home automation systems, through the 0-10V analogue or 4 speed digital signal protocol. COMPATIBILITY ON BOARD CONTROL 52 INTEGRATED SYSTEMS HYDRAULIC KITS AIR CONDITIONING CODE B0832 DESCRIPTION 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a valve with thermoelectric actuator and holder, the first allows for the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses. is kit is mandatory in version SLR except in the case of using a 3-way valve kit or in the presence of a collector with thermoelectric heads. B0834 3-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a three-way diverter valve with thermoelectric actuator, and a holder. e first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses; the by-pass keeps water circulating in the system. is kit is an alternative to the 2-way solenoid valve kit (required in version SLR). B0205 Manual 2-way group valves kit. Consisting of a valve and a holder, the first allows the cabinet to be manually excluded from the system, while the holder allows the balancing of system load losses. B0204 B0501 B0200 B0201 B0203 B0839 Manual 2-way valve isolation kit. Avoids condensation during the cooling operation (already included in the other thermoelectric hydraulic kits). Spacer kit (No. 1 unit) 3/4 Eurokonus. Available for multilayer pipes d. 20 mm. (which do not allow adequate bending radii), no. 1 or 2 kit. for machine according to the type of installation. Adaptors couple kit. Allows you to transform the Bi2 3/4 `' Eurocone connection into a standard 1/2 "(B0200) or 3/4 `' (B0201) gas thread connection. Kit 90° Eurokonus bend. Facilitates the connection in case of hydraulic connections with walled pipes Control connection extension kit. Power and motor sensor electric connection cable for installations where connection positions are rotated (from Left to Right). B0853 B0852 Feet kit for smart Bi2 air. Kit of two aesthetic feet for coverage of any floor pipes. Available in white. Floor fixing bracket kit Bi2 air Kit support brackets and mounting the floor of the terminal (applications front windows or on non-bearing walls). It also has the function of aesthetic kit (color off white). B0847 (200) B0848 (400) B0849 (600) B0850 (800) B0851 (1000) Back panel in painted sheet (for front glass applications). ELECTRICAL KITS AIR TREATMENT RECESSED KIT HEATING 53 Bi2 Air SL Air inverter e fan coil with Integral Design. With Multiset Control for all configurations Design by S. Ercoli & A. Garlandini Remote control supplied MULTISET CONTROL CONTROL TR (Touch Remote): model envisions touch control on the machine and a remote control unit (supplied). Furthermore, via a selection of keys, remote control is possible with an Olimpia Splendid wall control unit or home automation, through the Modbus RS485 signal protocol. CONTROL AR (Analogic Remote): model allows universal remoting to be configured for all wall-installed control units and home automation systems, through the 0-10V analogue or 4 speed digital signal protocol. *touch control on the machine and remote control disabled air MODEL Bi2 SL air with command TR 2.1.5 DIMEBNi2SSILOaNir IwEithPcoOmSmIaZnIdOANR AMENTI 2.1.5.1 DIMENSIONI VERSIONE SLR E SL QUADERNO TECNICO Bi2 AIR TERMINALI D'ISMLPaIirA2N0T0O code 01851 code 01767 Di seguito viene riportato il layout del ventilradiatore versione SLR e SL (Fig. 2) e una tabella riepilogativa delle dimensioni e il peso (Tab. 3). D A FEATURES Cools, Dehumidifies, Heats and Filters Essential aesthetics with intake from the lower side Metal front panel, sides in ABS Compact: thickness of just 12,9 cm, max 15 cm 5 sizes available DC brushless Motor Unique front body for comfortable working Motorised, steel air supply flap Anti-intrusion grids on air intake and outlet Removable filters on air intake Remote control unit supplied (for TR control only) Installation: floor wall cieling* Available in colors: White RAL 9003 SL air 400 01852 01768 Bi2 SL Air inverter SL air 600 01853 01769 SL air 800 01854 01770 SL air 1000 01855 01771 C B E Layout * Needed ceiling ventilradiatore versione SLR e SL mounting kit and feet kit 54 Rif. Fig. 2 200 400 600 Fig. 2 800 1000 A B C D E Net weight 200 400 600 800 1000 mm 695 895 1095 1295 1495 mm 599 599 599 599 599 mm 679 679 679 679 679 mm 129 129 129 129 129 mm 150 150 150 150 150 kg 11,5 13,0 15,5 18,5 21,5 INTEGRATED SYSTEMS E J B G I H C F D B Heat exchange coil C Tangential fan D Electric motor with resin-coated pack E Air supply flap and anti-intrusion supply grid F Condensation collector basin G Front body panel in electro-galvanised sheet steel H Anti-intrusion intake grid I Abs side panels J Touch control on machine (TR version) AIR CONDITIONING AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) (b) Water pressure loss (50°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply (E) kW (E) kW lt/h (E) kPa (E) kW lt/h (E) kPa kW lt/h kPa l bar inches m3/h m3/h (E) W (E) W (E) dB(A) (E) dB(A) dB(A) V/ph/Hz 200 0,82 0,64 142 13,1 1,05 84 10,9 1,77 152 10,9 0,47 10 Eurocone 3/4 100 160 5 11 38 52 34 230/1/50 Bi2 SL Air inverter 400 600 800 1,74 2,54 3,29 1,25 1,94 2,54 302 446 573 8,2 19 18,7 2,31 3,12 4,10 185 249 329 6,8 15,8 15,5 3,88 5,21 6,88 334 448 592 7,0 14,3 12,7 0,8 1,13 1,46 10 10 10 Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 170 180 370 320 460 575 6 7 8 19 20 24 39 41 42 53 53 54 36 37 35 230/1/50 230/1/50 230/1/50 1000 3,78 2,98 655 18,2 4,67 374 15,1 7,83 673 12,5 1,8 10 Eurocone 3/4 420 650 9 27 42 54 38 230/1/50 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (f) Sound pressure measured at 1,5 m 55 HEATING ACCESSORIES Bi2 Air Accessories control TR CODE DESCRIPTION COMPATIBILITY STANDARD e TR (Touch Remote) command envisions a touch control on the machine and B0736 REMOTO A TOUCH A TELE- DOMOTICA PARETE OS BORDO COMANDO a remote control unit (supplied). Furthermore, via a selection of keys, remote con- trol is possible with an Olimpia Splendid wall control unit or home automation, CONTROL through the Modbus RS485 signal protocol. My Home by ON BOARD CONTROL REMOTE CONTROL B0736 LCD wall clock thermostat remote control kit. Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. Addressing for Bticino INDRZ management and AQUADUE Control Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome CONTROL Accessories control AR REMOTO A PARETE 0-10V/4 vel DOMOTICA CODE STANDARD DESCRIPTION e AR (Analogic Remote) model allows the universal remoting to be configured for all wall-installed-controls and the home automation systems, through the 0-10V analogue or 4 speed digital signal protocol. COMPATIBILITY B0151 B0152 ON BOARD CONTROL B0151 OUT OF STOCK Wall control kit with thermostat, summer/winter selector and speed switch. Wall thermostat with room sensor, On-Off switch, three-speed fan and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. It has two 230VAC hot water and cold water solenoid outlets and an inlet water temperature sensor. REMOTE CONTROL B0152 Recessed control kit LCD with ambient sensor and thermostat, summer/winter selector and speed switch.Electronic recessed thermostat with ambient sensor, On-Off switch, fan speed selector (min, med, max and auto), ambient temperature, minimum water sensor mode and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. 56 INTEGRATED SYSTEMS HYDRAULIC KITS AIR CONDITIONING CODE B0832 DESCRIPTION 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a valve with thermoelectric actuator and holder, the first allows for the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses. is kit is mandatory in version SLR except in the case of using a 3-way valve kit or in the presence of a collector with thermoelectric heads. B0834 3-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a three-way diverter valve with thermoelectric actuator, and a holder. e first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses; the by-pass keeps water circulating in the system. is kit is an alternative to the 2-way solenoid valve kit (required in version SLR). B0205 Manual 2-way group valves kit. Consisting of a valve and a holder, the first allows the cabinet to be manually excluded from the system, while the holder allows the balancing of system load losses. B0204 B0501 B0200 B0201 B0203 B0839 Manual 2-way valve isolation kit. Avoids condensation during the cooling operation (already included in the other thermoelectric hydraulic kits). Spacer kit (No. 1 unit) 3/4 Eurokonus. Available for multilayer pipes d. 20 mm. (which do not allow adequate bending radii), no. 1 or 2 kit. for machine according to the type of installation. Adaptors couple kit. Allows you to transform the Bi2 3/4 `' Eurocone connection into a standard 1/2 "(B0200) or 3/4 `' (B0201) gas thread connection. Kit 90° Eurokonus bend. Facilitates the connection in case of hydraulic connections with walled pipes Control connection extension kit. Power and motor sensor electric connection cable for installations where connection positions are rotated (from Left to Right). B0853 B0852 Feet kit for smart Bi2 air. Kit of two aesthetic feet for coverage of any floor pipes. Available in white. Floor fixing bracket kit Bi2 air Kit support brackets and mounting the floor of the terminal (applications front windows or on non-bearing walls). It also has the function of aesthetic kit (color off white). B0847 (200) B0848 (400) B0849 (600) B0850 (800) B0851 (1000) Back panel in painted sheet (for front glass applications). B0520 (200) Bi2 ceiling installation kit (Excluding versions SLR) B0521 (400) B0522 (600) B0523 (800) B0524 (1000) ELECTRICAL KITS AIR TREATMENT RECESSED KIT HEATING 57 Bi2 wall SLW inverter Hydronic, reversible and ultraslim high-wall fan coil. With Multiset Control for all configurations. BI2 wall is the winner of the GOOD DESIGN AWARD. Founded in Chicago in 1950, GOOD DESIGN is the oldest and most acknowledged international competition for design excellence. * Design by S. Ercoli & A. Garlandini Remote control supplied MULTISET CONTROL CONTROL TR (Touch Remote): model envisions touch control on the machine and a remote control unit (supplied). Furthermore, via a selection of keys, remote control is possible with an Olimpia Splendid wall control unit or home automation, through the Modbus RS485 signal protocol. CONTROL AR (Analogic Remote): model allows universal remoting to be configured for all wall-installed control units and home automation systems, through the 0-10V analogue or 4 speed digital signal protocol. *touch control on the machine and remote control disabled MODEL Bi2 Wall with 2-way valve and TR command Bi2 Wall with 3-way valve and TR command Bi2 Wall with 2-way valve and AR command Bi2 Wall with 3-way valve and AR command As per standard: valve unit with thermo-electric actuator with 4 wires and holder A D B C 58 FEATURES Cools, Dehumidifies, Heats and Filters 3 sizes available Touch controls on the machine (TR control) DC brushless Motor Fitted with large motorised flap Total flat aesthetic Adjustable environment thermostat Functioning mode selection (cooling, heating, ventilation only, automatic, dehumidification) Ventilation program selection (min, med, max) Timer Remote control unit supplied (for TR control only) Strong metal body Installation: consolle high-wall Available in colors: White RAL 9003 Bi2 Wall SLW inverter SLW 400 SLW 600 SLW 800 code 01784 01785 01786 code 01787 01788 01789 code 01875 01876 01877 code 01878 01879 01880 A mm B mm C mm D mm Weight kg SLW 400 906 380 129 150 13 SLW 600 1106 380 129 150 14,5 SLW 800 1306 380 129 150 16 INTEGRATED SYSTEMS Display Hydraulic connections Display Hydraulic connections Bi2 Wall is the first hydronic terminal that can be installed as a split or as a console, by simply rotating the display on installation. Depending on the installation configuration, the digits of the display are rotated with a combination of keys on the command located on the machine. In the split configuration, the water attachments are positioned on the right and the display is positioned on the left. In the console configuration, the water attachments are positioned on the left and the display is positioned on the right. Fitted with large motorised flap AIR CONDITIONING AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) (b) Water pressure loss (50°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply (E) kW (E) kW lt/h (E) kPa (E) kW lt/h (E) kPa kW lt/h kPa l bar inches m3/h m3/h (E) W (E) W (E) dB(A) (E) dB(A) dB(A) V/ph/Hz SLW 400 1,01 0,91 174 8,91 1,55 133 7,1 2,70 232 10,4 0,3 8 Eurocone 3/4 155 290 7 19 43 57 39 230/1/50 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (f) Sound pressure measured at 1,5 m Bi2 Wall SLW inverter SLW 600 1,23 1,15 214 7,89 2,16 185 2,5 3,79 326 4,8 0,4 8 Eurocone 3/4 250 400 8 23 43 58 40 230/1/50 SLW 800 1,82 1,47 313 11,0 2,85 245 8,8 4,93 424 13,7 0,5 8 Eurocone 3/4 255 430 9 27 43 58 40 230/1/50 59 HEATING ACCESSORIES SLW Accessories control TR CODE DESCRIPTION COMPATIBILITY STANDARD e TR (Touch Remote) command envisions a touch control on the machine and B0736 DOMOTICA REMOTO A PARETE OS TOUCH A BORDO TELECOMANDO a remote control unit (supplied). Furthermore, via a selection of keys, remote con- trol is possible with an Olimpia Splendid wall control unit or home automation, CONTROL through the Modbus RS485 signal protocol. My Home by ON BOARD CONTROL REMOTE CONTROL B0736 LCD wall clock thermostat remote control kit. Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. Addressing for Bticino INDRZ management and AQUADUE Control Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome CONTROL Accessories control AR REMOTO A PARETE 0-10V/4 vel DOMOTICA CODE STANDARD DESCRIPTION e AR (Analogic Remote) model allows the universal remoting to be configured for all wall-installed-controls and the home automation systems, through the 0-10V analogue or 4 speed digital signal protocol. COMPATIBILITY B0151 B0152 ON BOARD CONTROL B0151 OUT OF STOCK Wall control kit with thermostat, summer/winter selector and speed switch. Wall thermostat with room sensor, On-Off switch, three-speed fan and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. It has two 230VAC hot water and cold water solenoid outlets and an inlet water temperature sensor. REMOTE CONTROL B0152 Recessed control kit LCD with ambient sensor and thermostat, summer/winter selector and speed switch.Electronic recessed thermostat with ambient sensor, On-Off switch, fan speed selector (min, med, max and auto), ambient temperature, minimum water sensor mode and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. 60 INTEGRATED SYSTEMS AIR CONDITIONING FAMILY FEELING Bi2 Air - Bi2 Wall La nuova generazione di ventilradiatori, BI2 wall is the winner of the GOOD DESIGN la rivoluzione della semplicità AWARD. Founded in Chicago in 1950, GOOD DESIGN is the oldest and most acknowledged international competition for design excellence. As well as being ultraslim, the design of the Bi2 Air and Bi2 Wall models has been developed with a view to creating products that have a family feeling with each other. at is, having close linked visual and elements and Il terminale d'impianshatpoe, incohrdeer torinisstacll tahelmdinao,nerraoofmf, rorealssocina, different rooms, while maintaining common aesthetics. deumidifica e filtra Furthermore, both machines can mount the same control as per standard (TR Touch Remote Control or AR Analogue Remote Control). Design by S.Ercoli & A.Garlandini Design by S. Ercoli & A. Garlandini VENTILCONVETTORE A PARETE IDRONICO REVERSIBILE ULTRASLIM ULTRASLIM DESIGN MULTISET CONTROL MADE IN ITALY RREEVVERSIIBBLIELE INSTALLAZTIONE A PARETHEIAGLHTAW(HALIGLH WALL) OOARPLAORWETWE ABLALSS(CAO(CNOSNOSLOLEL)LE) LLAANNUUOLOAVVARAIGVGEOENNLEUERRZAAIZOZINIOOENNDEEEDLDILIVAVESENENTMTIIPLLLRRIACADIDTIIÀAATTOORREE®® LA RIVOLUZIONE DELLA SEMPLICITÀ DESIGN INTEGRALE® DESEIUGLNTRINATSELGIMRALE® E ULTRASLIM MULTISET CMOUNLTTRIOSELT CONTROL RADIANT TECHRANDOILAONGTY® TECHNOLOGY® MADE INMITAADLEY IN ITALY AIR TREATMENT HEATING 61 Bi2 smart SLR smart inverter Total flat inverter fan coil radiator. No unsightly grill, total and perfect integration with the environment. BI2 is the winner of the GOOD DESIGN AWARD 2014. Founded in Chicago in 1950, GOOD DESIGN is the oldest and most acknowledged international competition for design excellence. Design by S. Ercoli & A. Garlandini FEATURES Cools, Dehumidifies, Heats and Filters Terminal with integrated heating panel Compact: thickness of just 12,9 cm Range consists of 5 power models DC brushless Motor Smart sides Total Flat Aesthetic with integrated vacuum system installation: floor wall Available in colors: White Ral 9010 MODEL White A 62 B C BI2 Smart with heating panel (SLR Smart Inverter) SLR smart 200 SLR smart 400 SLR smart 600 SLR smart 800 SLR smart 1000 cod. 01629 01630 01631 01632 01633 200 400 600 800 1000 D A mm 759 959 1159 1359 1559 B mm 579 579 579 579 579 C mm 659 659 659 659 659 D mm 129 129 129 129 129 E mm 150 150 150 150 150 Weight kg 13,5 15,5 19,5 22,5 25,5 E INTEGRATED SYSTEMS B Valve with thermoelectric actuator (accessory kit) C Tubular heating panel D High Efficiency Coil E Water temperature sensor F High efficiency tangential fan G Condensation collector basin H DC brushless inverter motor I Electronic controls (accessory kit) I B C D G F E H AIR CONDITIONING AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) (b) Water pressure loss (50°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply Max capacity static heating (50°C) Max capacity static heating (70°C) Water content heating panel (E) kW (E) kW lt/h (E) kPa (E) kW lt/h (E) kPa kW lt/h kPa l bar inches m3/h m3/h (E) W (E) W (E) dB(A) (E) dB(A) dB(A) V/ph/Hz kW kW l 200 0,82 0,64 142 13,1 1,05 84 10,9 1,77 152 10,9 0,47 10 Eurocone 3/4 100 160 5 11 38 52 34 230/1/50 0,37 0,59 0,3 BI2 SLR smart inverter 400 600 800 1,74 2,54 3,29 1,25 1,94 2,54 302 446 573 8,2 19 18,7 2,31 3,12 4,10 185 249 329 6,8 15,8 15,5 3,88 5,21 6,88 334 448 592 7,0 14,3 12,7 0,8 1,13 1,46 10 10 10 Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 170 180 370 320 460 575 6 7 8 19 20 24 39 41 42 53 53 54 36 37 35 230/1/50 230/1/50 230/1/50 0,42 0,50 0,62 0,71 0,84 1,04 0,5 0,6 0,7 1000 3,78 2,98 655 18,2 4,67 374 15,1 7,83 673 12,5 1,8 10 Eurocone 3/4 420 650 9 27 42 54 38 230/1/50 0,77 1,28 0,9 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (f) Sound pressure measured at 1,5 m 63 HEATING ACCESSORIES SLR smart inverter ON BOARD CONTROL CODE B0673 DESCRIPTION Built-in electronic autonomous control kit. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor connection, and two 230VAC outlets for the control of 2 solenoid valves. COMPATIBILITY B0828 NEW Touch flat design built-in control kit. Back-lit display with desired temperature visualization, real-touch switches, mode of operation and fan speed selection. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor contact connection, a 230VAC outlet for the solenoid valve control. Remote control provided. Can be remote controlled via a combination of keys for connection with Modbus RS485 protocol. Command pre-configured on the machine (cannot be ordered separately). B0736 CONTROL My Home by B0685 OUT OF STOCK Bi2 inverter control kit for remotization. e main operating parameters, set point and ambient temperature are transmit- ted from the remote control B0736 to all connected fan coils on the network, enabling a seamless operation. It has a 230VAC outlet for the control of a solenoid valve, two clean contacts for the control of a chiller or a boiler, and a presence inlet. Operation in MODBUSprotocol, RS485. B0736 CONTROL My Home by B0756 Control kit for remotization for the management and control through analogic inlet O-10V or contacts. It has a 230VAC outlet for the control of one solenoid valve and a water sensor inlet with minimum temperature sensor function (in the contact mode) REMOTE CONTROL B0736 LCD wall clock thermostat remote control kit. Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. B0828 B0685 CONTROL Addressing for Bticino INDRZ management and AQUADUE Control Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome 64 INTEGRATED SYSTEMS AIR CONDITIONING HYDRAULIC KITS CODE B0139 B0832 B0641 B0833 DESCRIPTION 2 way group valves with thermoelectric actuator kit. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a valve with thermoelectric actuator and holder, the first allows for the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses. is kit is mandatory in version SLR except in the case of using a 3-way valve kit or in the presence of a collector with thermoelectric heads. 2-way valves group kit with thermoelectric actuator and bypass branch with pressure relief valve. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch and by-pass branch with pressure-relief valve. e kit consists of a valve with thermoelectric actuator, a holder and a bypass with a pressure relief valve, the first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses while the by-pass maintains the system balanced even with cabinet excluded. is kit is an alternative to the 2-way solenoid valve kit. (Required in SLR version) B0635 B0834 B0205 B0204 3-way group valves kit with thermoelectric actuator. 3-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a three-way diverter valve with thermoelectric actuator, and a holder. e first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses; the by-pass keeps water circulating in the system. is kit is an alternative to the 2-way solenoid valve kit (required in version SLR). e valve unit kits with thermoelectric actuator are recommended for the following command kits to activate chiller and boiler: B0659 - B0673 - B0707 - B0774 - B0772 - B0828 - B0756 Manual 2-way group valves kit. Consisting of a valve and a holder, the first allows the cabinet to be manually excluded from the system, while the holder allows the balancing of system load losses. Also allowed when solenoid valves on the collector are managed by the control kit of terminal Bi2. Manual 2-way valve isolation kit. Avoids condensation during the cooling operation (already included in the other thermoelectric hydraulic kits). B0501 B0200 B0201 Spacer kit (No. 1 unit) 3/4 Eurokonus. Available for multilayer pipes d. 20 mm. (which do not allow adequate bending radii), no. 1 or 2 kit. for machine according to the type of installation. Adaptors couple kit. Allows you to transform the Bi2 3/4 `' Eurocone connection into a standard 1/2 "(B0200) or 3/4 `' (B0201) gas thread connection. B0203 kit 90° Eurokonus bend. Facilitates the connection in case of hydraulic connections with walled pipes B0632 (200) Control connection extension kit. (400) Power and motor sensor electric connection cable for installations where connection positions are rotated (600) (from Left to Right) . B0633 (800) (1000) B0682 Feet kit for smart Bi2. Kit of two aesthetic feet for coverage of any floor pipes. Available in white. B0683 B0677 (200) B0678 (400) B0679 (600) B0680 (800) B0681 (1000) Floor fixing bracket kit Bi2 smart. Kit support brackets and mounting the floor of the terminal (applications front windows or on non-bearing walls). It also has the function of aesthetic kit (color off white). Back panel in painted sheet (For front glass applications). AIR TREATMENT ELECTRICAL KITS AESTHETICAL KITS HEATING 65 Bi2 smart SL smart inverter Total flat inverter fan coil radiator. No unsightly grill: total and perfect integration with the building. Design by S. Ercoli & A. Garlandini BI2 is the winner of the GOOD DESIGN AWARD 2014. Founded in Chicago in 1950, GOOD DESIGN is the oldest and most acknowledged international competition for design excellence. FEATURES Cools, Dehumidifies, Heats and Filters Compact: thickness of just 12,9 cm Range consists of 5 power models DC brushless Motor Smart sides Total Flat Aesthetic with integrated vacuum system installation: floor wall cieling* Available in colors: White RAL 9010 MODEL White A * Front basin kit and feet kit are necessary 66 B C BI2 smart without heating panel (SL Smart Inverter) SL smart inverter 200 SL smart inverter 400 SL smart inverter 600 SL smart inverter 800 SL smart inverter 1000 cod. 01634 01635 01636 01637 01638 200 400 600 800 1000 D A mm 759 959 1159 1359 1559 B mm 579 579 579 579 579 C mm 659 659 659 659 659 D mm 129 129 129 129 129 E mm 150 150 150 150 150 Weight kg 11,5 13 15,5 18,5 21,5 E INTEGRATED SYSTEMS B Valve with thermoelectric actuator (accessory kit) C High Efficiency Coil D Water temperature sensor E High efficiency tangential fan F Condensation collector basin G DC brushless inverter motor H Electronic controls (accessory kit) B C F E H D G AIR CONDITIONING AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) (b) Water pressure loss (50°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply (E) kW (E) kW lt/h (E) kPa (E) kW lt/h (E) kPa kW lt/h kPa l bar inches m3/h m3/h (E) W (E) W (E) dB(A) (E) dB(A) dB(A) V/ph/Hz 200 0,82 0,64 142 13,1 1,05 84 10,9 1,77 152 10,9 0,47 10 Eurocone 3/4 100 160 5 11 38 52 34 230/1/50 BI2 SL smart inverter 400 600 800 1,74 2,54 3,29 1,25 1,94 2,54 302 446 573 8,2 19 18,7 2,31 3,12 4,10 185 249 329 6,8 15,8 15,5 3,88 5,21 6,88 334 448 592 7,0 14,3 12,7 0,8 1,13 1,46 10 10 10 Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 170 180 370 320 460 575 6 7 8 19 20 24 39 41 42 53 53 54 36 37 35 230/1/50 230/1/50 230/1/50 1000 3,78 2,98 655 18,2 4,67 374 15,1 7,83 673 12,5 1,8 10 Eurocone 3/4 420 650 9 27 42 54 38 230/1/50 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (f) Sound pressure measured at 1,5 m 67 HEATING ACCESSORIES SL smart inverter ON BOARD CONTROL CODE B0673 DESCRIPTION Built-in electronic autonomous control kit. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor connection, and two 230VAC outlets for the control of 2 solenoid valves. COMPATIBILITY B0828 NEW B0685 OUT OF STOCK Touch flat design built-in control kit. Back-lit display with desired temperature visualization, real-touch switches, mode of operation and fan speed selection. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor contact connection, a 230VAC outlet for the solenoid valve control. Remote control provided. Can be remote controlled via a combination of keys for connection with Modbus RS485 protocol. Command pre-configured on the machine (cannot be ordered separately). B0736 CONTROL My Home by Bi2 inverter control kit for remotization. e main operating parameters, set point and ambient temperature are transmit- ted from the remote control B0736 to all connected fan coils on the network, enabling a seamless operation. It has a 230VAC outlet for the control of a solenoid valve, two clean contacts for the control of a chiller or a boiler, and a presence inlet. Operation in MODBUSprotocol, RS485. B0736 CONTROL My Home by B0756 Control kit for remotization for the management and control through analogic inlet O-10V or contacts. It has a 230VAC outlet for the control of one solenoid valve and a water sensor inlet with minimum temperature sensor function (in the contact mode) B0151 B0152 REMOTE CONTROL B0151 OUT OF STOCK Wall control kit with thermostat, summer/winter selector and speed switch. Wall thermostat with room sensor, On-Off switch, three-speed fan and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. It has two 230VAC hot water and cold water solenoid outlets and an inlet water temperature sensor. B0756 B0152 Recessed control kit LCD with ambient sensor and thermostat, summer/winter selector and speed switch.Electronic recessed thermostat with ambient sensor, On-Off switch, fan speed selector (min, med, max and auto), ambient temperature, minimum water sensor mode and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. B0756 B0736 LCD wall clock thermostat remote control kit Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. B0828 B0685 CONTROL Addressing for Bticino INDRZ management and AQUADUE Control Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome 68 INTEGRATED SYSTEMS AIR CONDITIONING HYDRAULIC KITS CODE B0139 B0832 B0641 B0833 B0635 B0834 B0205 B0204 DESCRIPTION 2 way group valves with thermoelectric actuator kit. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a valve with thermoelectric actuator and holder, the first allows for the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses. is kit is mandatory in version SLR except in the case of using a 3-way valve kit or in the presence of a collector with thermoelectric heads. 2-way valves group kit with thermoelectric actuator and bypass branch with pressure relief valve. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch and by-pass branch with pressure-relief valve. e kit consists of a valve with thermoelectric actuator, a holder and a bypass with a pressure relief valve, the first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses while the by-pass maintains the system balanced even with cabinet excluded. is kit is an alternative to the 2-way solenoid valve kit. (Required in SLR version) 3-way group valves kit with thermoelectric actuator. 3-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a three-way diverter valve with thermoelectric actuator, and a holder. e first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses; the by-pass keeps water circulating in the system. is kit is an alternative to the 2-way solenoid valve kit (required in version SLR). e valve unit kits with thermoelectric actuator are recommended for the following command kits to activate chiller and boiler: B0659 - B0673 - B0707 - B0774 - B0772 - B0828 - B0756 Manual 2-way group valves kit. Consisting of a valve and a holder, the first allows the cabinet to be manually excluded from the system, while the holder allows the balancing of system load losses. Also allowed when solenoid valves on the collector are managed by the control kit of terminal Bi2. Manual 2-way valve isolation kit. Avoids condensation during the cooling operation (already included in the other thermoelectric hydraulic kits). B0501 B0200 B0201 B0203 Spacer kit (No. 1 unit) 3/4 Eurokonus. Available for multilayer pipes d. 20 mm. (which do not allow adequate bending radii), no. 1 or 2 kit. for machine according to the type of installation. Adaptors couple kit. Allows you to transform the Bi2 3/4 `' Eurocone connection into a standard 1/2 "(B0200) or 3/4 `' (B0201) gas thread connection. Kit 90° Eurokonus bend. Facilitates the connection in case of hydraulic connections with walled pipes B0632 (200) (400) (600) B0633 (800) (1000) B0682 Control connection extension kit. Power and motor sensor electric connection cable for installations where connection positions are rotated (from Left to Right) . Feet kit for smart Bi2. Kit of two aesthetic feet for coverage of any floor pipes. Available in white. B0683 B0677 (200) B0678 (400) B0679 (600) B0680 (800) B0681 (1000) B0520 (200) B0521 (400) B0522 (600) B0523 (800) B0524 (1000) Floor fixing bracket kit Bi2 smart. Kit support brackets and mounting the floor of the terminal (applications front windows or on non-bearing walls). It also has the function of aesthetic kit (color off white). Back panel in painted sheet (For front glass applications). Bi2 ceiling installation kit (Excluding versions SLR and SLI) AIR TREATMENT ELECTRICAL KITS AESTHETICAL KITS HEATING 69 Bi2 smart SL smart Total flat fan coil radiator. No unsightly grill: total and perfect integration with the building. Design by S. Ercoli & A. Garlandini FEATURES Cools, Dehumidifies, Heats and Filters Compact: thickness of just 12,9 cm Range consists of 5 power models AC Motor Smart sides Total Flat Aesthetic with integrated vacuum system installation: floor wall cieling* Available in colors: White RAL 9010 BI2 is the winner of the GOOD DESIGN AWARD 2014. Founded in Chicago in 1950, GOOD DESIGN is the oldest and most acknowledged international competition for design excellence. MODEL White cod. A B C SL smart 200 01409 Bi2 smart without heating panel (SL smart) SL smart 400 SL smart 600 SL smart 800 01410 01411 01412 SL smart 1000 01413 D A B C D E Weight 200 400 600 800 1000 mm 759 959 1159 1359 1559 mm 579 579 579 579 579 mm 659 659 659 659 659 mm 129 129 129 129 129 mm 150 150 150 150 150 kg 11,5 13 15,5 18,5 21,5 E * Front basin kit and feet kit are necessary 70 INTEGRATED SYSTEMS B Valve with thermoelectric actuator (accessory kit) C High Efficiency Coil D Water temperature sensor E High efficiency tangential fan F Condensation collector basin G Electronic controls (accessory kit) G B D C F E AIR CONDITIONING AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) (b) Water pressure loss (50°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply (E) kW (E) kW lt/h (E) kPa (E) kW lt/h (E) kPa kW lt/h kPa l bar inches m3/h m3/h (E) W (E) W (E) dB(A) (E) dB(A) dB(A) V/ph/Hz 200 0,81 0,63 142 13,1 1,05 84 12,2 1,77 152 10,9 0,47 10 Eurocone 3/4 100 160 6 17 38 52 34 230/1/50 400 1,73 1,24 302 8,2 2,31 185 6,8 3,88 334 7,0 0,8 10 Eurocone 3/4 170 320 9 28 39 53 36 230/1/50 Bi2 SL smart 600 2,53 1,96 446 19 3,12 249 15,8 5,21 448 14,3 1,13 10 Eurocone 3/4 180 460 9 35 41 53 37 230/1/50 800 3,27 2,52 573 18,7 4,10 329 15,5 6,88 592 12,7 1,46 10 Eurocone 3/4 370 575 17 38 39 54 35 230/1/50 1000 3,77 2,97 655 18,2 4,67 374 15,1 7,83 673 12,5 1,8 10 Eurocone 3/4 420 650 19 43 42 54 38 230/1/50 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (f) Sound pressure measured at 1,5 m 71 HEATING ACCESSORIES SL smart ON BOARD CONTROL CODE B0659 B0371 OUT OF STOCK DESCRIPTION Built-in electronic control kit. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor connection, and two 230VAC outlets for the control of 2 valves. Built-in electronic control kit. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor contact connection, a 230VAC outlet for the solenoid valve control, and contacts to enable the boiler or chiller. COMPATIBILITY CONTROL B0855 NEW B0772 OUT OF STOCK Touch flat design built-in control kit. Back-lit display with desired temperature visualization, real-touch switches, mode of operation and fan speed selection. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor contact connection, a 230VAC outlet for the solenoid valve control. Remote control provided. Can be remote controlled via a combination of keys for connection with Modbus RS485 protocol. Command pre-configured on the machine (cannot be ordered separately). Touch design built-in control kit. Back-lit display with desired temperature visualization, real-touch switches, mode of operation and fan speed selection. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor contact connection, a 230VAC outlet for the solenoid valve control. Remote control provided. B0736 CONTROL My Home by CONTROL B0658 OUT OF STOCK B0372 OUT OF STOCK Built-in electronic autonomous control kit without thermostat. Built-in control with speed selection and ventilation. It has a 230VAC outlet at for the control of a solenoid valve. It is fitted for connection of an enabling contact or outdoor thermostat (Minimum contact flow: 2A-250Vac). B0336 Electronic control kit for remotization. e main operating parameters, set point and ambient temperature are transmitted from the remote control B0373 or B0736 to all connected fan coils on the network, enabling a seamless operation. It has a 230VAC outlet for the control of a solenoid valve, two clean contacts for the control of a chiller or a boiler, and a presence inlet. Operation in MODBUSprotocol, RS485. B0736 CONTROL My Home by REMOTE CONTROL B0707 B0151 OUT OF STOCK B0152 B0736 Addressing for Bticino INDRZ management and AQUADUE Control 72 Electronic control kit for remotization for 5 speed Fan (selectable between 5 available) and 2 solenoid valves. Fan control kit with motor feedback with speed gauge generator. No need to configure controls depending on the size of the fan coil. Electronic remote board solenoid valves actuating contacts. From same control B0151 or B0152 you can control up to 10 terminals equipped with Bi2 B0707. Wall control kit with thermostat, summer/winter selector and speed switch. Wall thermostat with room sensor, On-Off switch, three-speed fan and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. It has two 230VAC hot water and cold water solenoid outlets and an inlet water temperature sensor. Recessed control kit LCD with ambient sensor and thermostat, summer/winter selector and speed switch.Electronic recessed thermostat with ambient sensor, On-Off switch, fan speed selector (min, med, max and auto), ambient temperature, minimum water sensor mode and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. LCD wall clock thermostat remote control kit. Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome B0151 B0152 B0707 B0707 B0855 B0372 CONTROL INTEGRATED SYSTEMS AIR CONDITIONING HYDRAULIC KITS CODE B0139 B0832 B0641 B0833 B0635 B0834 B0205 B0204 B0501 B0200 B0201 B0203 B0336 B0459 DESCRIPTION 2 way group valves with thermoelectric actuator kit. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a valve with thermoelectric actuator and holder, the first allows for the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses. is kit is mandatory in version SLR except in the case of using a 3-way valve kit or in the presence of a collector with thermoelectric heads. 2-way valves group kit with thermoelectric actuator and bypass branch with pressure relief valve. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch and by-pass branch with pressure-relief valve. e kit consists of a valve with thermoelectric actuator, a holder and a bypass with a pressure relief valve, the first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses while the by-pass maintains the system balanced even with cabinet excluded. is kit is an alternative to the 2-way solenoid valve kit. (Required in SLR version) 3-way group valves kit with thermoelectric actuator. 3-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a three-way diverter valve with thermoelectric actuator, and a holder. e first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses; the by-pass keeps water circulating in the system. is kit is an alternative to the 2-way solenoid valve kit (required in version SLR). e valve unit kits with thermoelectric actuator are recommended for the following command kits to activate chiller and boiler: B0659 - B0673 - B0707 - B0774 - B0772 - B0828 - B0756 Manual 2-way group valves kit. Consisting of a valve and a holder, the first allows the cabinet to be manually excluded from the system, while the holder allows the balancing of system load losses. Also allowed when solenoid valves on the collector are managed by the control kit of terminal Bi2. Manual 2-way valve isolation kit. Avoids condensation during the cooling operation (already included in the other thermoelectric hydraulic kits). Spacer kit (No. 1 unit) 3/4 Eurokonus. Available for multilayer pipes d. 20 mm. (which do not allow adequate bending radii), no. 1 or 2 kit. for machine according to the type of installation. Adaptors couple kit. Allows you to transform the Bi2 3/4 `' Eurocone connection into a standard 1/2 "(B0200) or 3/4 `' (B0201) gas thread connection. Kit 90° Eurokonus bend. Facilitates the connection in case of hydraulic connections with walled pipes Minimum temperature thermostat kit. Only compatible with B0658. Control connection extension kit. Power and motor sensor electric connection cable for installations where connection positions are rotated (from Left to Right) . AIR TREATMENT ELECTRICAL KITS AESTHETICAL KITS B0682 Feet kit for smart Bi2. Kit of two aesthetic feet for coverage of any floor pipes. Available in white. B0683 B0677 (200) B0678 (400) B0679 (600) B0680 (800) B0681 (1000) B0520 (200) B0521 (400) B0522 (600) B0523 (800) B0524 (1000) Floor fixing bracket kit Bi2 smart. Kit support brackets and mounting the floor of the terminal (applications front windows or on non-bearing walls). It also has the function of aesthetic kit (color off white). Back panel in painted sheet (For front glass applications). Bi2 ceiling installation kit (Excluding versions SLR and SLI) HEATING 73 Bi2 plus SLR+ inverter Inverter fan coil radiator. Design by Dario Tanfoglio Bi2 + is the winner of the iF product design award 2013 in the Buildings category, selected by an internationally recognized panel of experts and designers. reddot design award honourable mention 2013 BI2 + was awarded the REDDOT DESIGN HONOURABLE MENTION 2013 award, for the seamless integration of technology and design. FEATURES Cools, Dehumidifies, Heats and Filters Terminal with integrated heating panel Compact: thickness of just 12,9 cm Range consists of 5 power models DC brushless Motor installation: floor wall Available in colors: White RAL 9010 * * Color choice: options available at specific client request, terms of delivery and minimum lots to be agreed. MODEL White BI2+ with heating panel (SLR+) SLR+200 SLR+400 SLR+600 SLR+800 SLR+1000 cod. 01609 01610 01611 01612 01613 A D B C A B C D Weight SLR+ 200 400 600 800 1000 mm 697 897 1097 1297 1497 mm 579 579 579 579 579 mm 659 659 659 659 659 mm 129 129 129 129 129 kg 15 17 21 24 28 74 INTEGRATED SYSTEMS B Valve with thermoelectric actuator (accessory kit) C Tubular heating panel D High Efficiency Coil E Water temperature sensor F High efficiency tangential fan G DC brushless inverter motor H Electronic controls (accessory kit) I Condensation collector basin C B D I F H E G AIR CONDITIONING AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) (b) Water pressure loss (50°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply Max capacity static heating (50°C) Max capacity static heating (70°C) Water content heating panel (E) kW (E) kW lt/h (E) kPa (E) kW lt/h (E) kPa kW lt/h kPa l bar inches m3/h m3/h (E) W (E) W (E) dB(A) (E) dB(A) dB(A) V/ph/Hz kW kW l 200 0,82 0,64 142 13,1 1,05 84 10,9 1,77 152 10,9 0,47 10 Eurocone 3/4 100 160 5 11 38 52 34 230/1/50 0,37 0,59 0,3 BI2+ SLR inverter 400 600 800 1,74 2,54 3,29 1,25 1,94 2,54 302 446 573 8,2 19 18,7 2,31 3,12 4,10 185 249 329 6,8 15,8 15,5 3,88 5,21 6,88 334 448 592 7,0 14,3 12,7 0,8 1,13 1,46 10 10 10 Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 170 180 370 320 460 575 6 7 8 19 20 24 39 41 42 53 53 54 36 37 35 230/1/50 230/1/50 230/1/50 0,42 0,50 0,62 0,71 0,84 1,04 0,5 0,6 0,7 1000 3,78 2,98 655 18,2 4,67 374 15,1 7,83 673 12,5 1,8 10 Eurocone 3/4 420 650 9 27 42 54 38 230/1/50 0,77 1,28 0,9 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (g) Sound pressure measured at 1,5 m 75 HEATING ACCESSORIES SLR+ inverter CODE B0673 DESCRIPTION Built-in electronic autonomous control kit. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor connection, and two 230VAC outlets for the control of 2 solenoid valves. COMPATIBILITY ON BOARD CONTROL B0828 Touch flat design built-in control kit. Back-lit display with desired temperature visualization, real-touch switches, mode of operation and fan speed selection. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor contact connection, a 230VAC outlet for the solenoid valve control. Remote control provided. Can be remote controlled via a combination of keys for connection with Modbus RS485 protocol. Command pre-configured on the machine (cannot be ordered separately). B0736 CONTROL My Home by B0685 OUT OF STOCK Bi2 inverter control kit for remotization. e main operating parameters, set point and ambient temperature are transmit- ted from the remote control B0736 to all connected fan coils on the network, enabling a seamless operation. It has a 230VAC outlet for the control of a solenoid valve, two clean contacts for the control of a chiller or a boiler, and a presence inlet. Operation in MODBUSprotocol, RS485. B0736 CONTROL My Home by B0756 Control kit for remotization for the management and control through analogic inlet O-10V or contacts. It has a 230VAC outlet for the control of one solenoid valve and a water sensor inlet with minimum temperature sensor function (in the contact mode) REMOTE CONTROL B0736 Addressing for Bticino INDRZ management and AQUADUE Control LCD wall clock thermostat remote control kit. Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. B0828 B0685 CONTROL Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome 76 INTEGRATED SYSTEMS AIR CONDITIONING HYDRAULIC KITS CODE B0139 B0832 B0641 B0833 B0635 B0834 B0205 B0204 B0501 DESCRIPTION 2 way group valves with thermoelectric actuator kit. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a valve with thermoelectric actuator and holder, the first allows for the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses. is kit is mandatory in version SLR except in the case of using a 3-way valve kit or in the presence of a collector with thermoelectric heads. 2-way valves group kit with thermoelectric actuator and bypass branch with pressure relief valve. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch and by-pass branch with pressure-relief valve. e kit consists of a valve with thermoelectric actuator, a holder and a bypass with a pressure relief valve, the first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses while the by-pass maintains the system balanced even with cabinet excluded. is kit is an alternative to the 2-way solenoid valve kit. (Required in SLR version) 3-way group valves kit with thermoelectric actuator. 3-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a three-way diverter valve with thermoelectric actuator, and a holder. e first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses; the by-pass keeps water circulating in the system. is kit is an alternative to the 2-way solenoid valve kit (required in version SLR). e valve unit kits with thermoelectric actuator are recommended for the following command kits to activate chiller and boiler: B0659 - B0673 - B0707 - B0774 - B0772 - B0828 - B0756 Manual 2-way group valves kit. Consisting of a valve and a holder, the first allows the cabinet to be manually excluded from the system, while the holder allows the balancing of system load losses. Also allowed when solenoid valves on the collector are managed by the control kit of terminal Bi2. Manual 2-way valve isolation kit. Avoids condensation during the cooling operation (already included in the other thermoelectric hydraulic kits). Spacer kit (No. 1 unit) 3/4 Eurokonus. Available for multilayer pipes d. 20 mm. (which do not allow adequate bending radii), no. 1 or 2 kit. for machine according to the type of installation. B0200 B0201 Adaptors couple kit. Allows you to transform the Bi2 3/4 `' Eurocone connection into a standard 1/2 "(B0200) or 3/4 `' (B0201) gas thread connection. B0203 Kit 90° Eurokonus bend. Facilitates the connection in case of hydraulic connections with walled pipes B0632 (200) (400) (600) B0633 (800) (1000) Control connection extension kit. Power and motor sensor electric connection cable for installations where connection positions are rotated (from Left to Right). B0157 Feet kit Kit of two aesthetic feet for coverage of any floor pipes. Available in white. B0193 Floor fixing bracket kit. Terminal support and floor fixing bracket kit (front glass applications or on non-bearing walls). To be used in combination with kit B0157. B0171 (200) B0173 (400) B0175 (600) B0177 (800) B0179 (1000) Back panel in painted sheet (for front glass applications). AIR TREATMENT ELECTRICAL KITS AESTHETICAL KITS HEATING 77 Bi2 plus SL+ inverter e inverter fan coil radiator. Design by Dario Tanfoglio FEATURES Cools, Dehumidifies, Heats and Filters Compact: thickness of just 12,9 cm Range consists of 5 power models DC brushless Motor installation: floor wall cieling* Available in colors: White RAL 9010 Bi2 + is the winner of the iF product design award 2013 in the Buildings category, selected by an internationally recognized panel of experts and designers. * * Color choice: options available at specific client request, terms of delivery and minimum lots to be agreed. reddot design award honourable mention 2013 BI2 + was awarded the REDDOT DESIGN HONOURABLE MENTION 2013 award, for the seamless integration of technology and design. MODEL White SL+200 cod. 01619 BI2+ whitout heating panel (SL+) SL+400 SL+600 SL+800 01620 01621 01622 SL+1000 01623 A D B C A B C D Weight SL+ 200 400 600 800 1000 mm 697 897 1097 1297 1497 mm 579 579 579 579 579 mm 659 659 659 659 659 mm 129 129 129 129 129 kg 13 15 17 20 24 * Front basin kit and feet kit are necessary 78 INTEGRATED SYSTEMS B Valve with thermoelectric actuator (accessory kit) C High Efficiency Coil D Water temperature sensor E High efficiency tangential fan F DC brushless inverter motor G Electronic controls (accessory kit) H Condensation collector basin B C H E G D F AIR CONDITIONING AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) (b) Water pressure loss (50°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply (E) kW (E) kW lt/h (E) kPa (E) kW lt/h (E) kPa kW lt/h kPa l bar inches m3/h m3/h (E) W (E) W (E) dB(A) (E) dB(A) dB(A) V/ph/Hz 200 0,82 0,64 142 13,1 1,05 84 10,9 1,77 152 10,9 0,47 10 Eurocone 3/4 100 160 5 11 38 52 34 230/1/50 BI2+ SL inverter 400 600 800 1,74 2,54 3,29 1,25 1,94 2,54 302 446 573 8,2 19 18,7 2,31 3,12 4,10 185 249 329 6,8 15,8 15,5 3,88 5,21 6,88 334 448 592 7,0 14,3 12,7 0,8 1,13 1,46 10 10 10 Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 170 180 370 320 460 575 6 7 8 19 20 24 39 41 42 53 53 54 36 37 35 230/1/50 230/1/50 230/1/50 1000 3,78 2,98 655 18,2 4,67 374 15,1 7,83 673 12,5 1,8 10 Eurocone 3/4 420 650 9 27 42 54 38 230/1/50 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (f) Sound pressure measured at 1,5 m 79 HEATING ACCESSORIES SL+ inverter ON BOARD CONTROL CODE B0673 DESCRIPTION Built-in electronic autonomous control kit. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor connection, and two 230VAC outlets for the control of 2 solenoid valves. COMPATIBILITY B0828 B0685 OUT OF STOCK Touch flat design built-in control kit. Back-lit display with desired temperature visualization, real-touch switches, mode of operation and fan speed selection. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor contact connection, a 230VAC outlet for the solenoid valve control. Remote control provided. Can be remote controlled via a combination of keys for connection with Modbus RS485 protocol. Command pre-configured on the machine (cannot be ordered separately). B0736 CONTROL My Home by Bi2 inverter control kit for remotization. e main operating parameters, set point and ambient temperature are transmit- ted from the remote control B0736 to all connected fan coils on the network, enabling a seamless operation. It has a 230VAC outlet for the control of a solenoid valve, two clean contacts for the control of a chiller or a boiler, and a presence inlet. Operation in MODBUSprotocol, RS485. B0736 CONTROL My Home by B0756 Control kit for remotization for the management and control through analogic inlet O-10V or contacts. It has a 230VAC outlet for the control of one solenoid valve and a water sensor inlet with minimum temperature sensor function (in the contact mode) REMOTE CONTROL B0151 OUT OF STOCK Wall control kit with thermostat, summer/winter selector and speed switch. Wall thermostat with room sensor, On-Off switch, three-speed fan and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. It has two 230VAC hot water and cold water solenoid outlets and an inlet water temperature sensor. B0756 B0152 B0736 Addressing for Bticino INDRZ management and AQUADUE Control Recessed control kit LCD with ambient sensor and thermostat, summer/winter selector and speed switch.Electronic recessed thermostat with ambient sensor, On-Off switch, fan speed selector (min, med, max and auto), ambient temperature, minimum water sensor mode and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. B0756 LCD wall clock thermostat remote control kit. Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. B0685 CONTROL Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome 80 INTEGRATED SYSTEMS AIR CONDITIONING HYDRAULIC KITS CODE B0139 B0832 B0641 B0833 B0635 B0834 B0205 B0204 B0501 DESCRIPTION 2 way group valves with thermoelectric actuator kit. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a valve with thermoelectric actuator and holder, the first allows for the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses. is kit is mandatory in version SLR except in the case of using a 3-way valve kit or in the presence of a collector with thermoelectric heads. 2-way valves group kit with thermoelectric actuator and bypass branch with pressure relief valve. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch and by-pass branch with pressure-relief valve. e kit consists of a valve with thermoelectric actuator, a holder and a bypass with a pressure relief valve, the first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses while the by-pass maintains the system balanced even with cabinet excluded. is kit is an alternative to the 2-way solenoid valve kit. (Required in SLR version) 3-way group valves kit with thermoelectric actuator. 3-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a three-way diverter valve with thermoelectric actuator, and a holder. e first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses; the by-pass keeps water circulating in the system. is kit is an alternative to the 2-way solenoid valve kit (required in version SLR). e valve unit kits with thermoelectric actuator are recommended for the following command kits to activate chiller and boiler: B0659 - B0673 - B0707 - B0774 - B0772 - B0828 - B0756 Manual 2-way group valves kit. Consisting of a valve and a holder, the first allows the cabinet to be manually excluded from the system, while the holder allows the balancing of system load losses. Also allowed when solenoid valves on the collector are managed by the control kit of terminal Bi2. Manual 2-way valve isolation kit. Avoids condensation during the cooling operation (already included in the other thermoelectric hydraulic kits). Spacer kit (No. 1 unit) 3/4 Eurokonus. Available for multilayer pipes d. 20 mm. (which do not allow adequate bending radii), no. 1 or 2 kit. for machine according to the type of installation. B0200 B0201 Adaptors couple kit. Allows you to transform the Bi2 3/4 `' Eurocone connection into a standard 1/2 "(B0200) or 3/4 `' (B0201) gas thread connection. B0203 Kit 90° Eurokonus bend. Facilitates the connection in case of hydraulic connections with walled pipes B0632 (200) (400) (600) B0633 (800) (1000) B0157 Control connection extension kit. Power and motor sensor electric connection cable for installations where connection positions are rotated (from Left to Right). Feet kit Kit of two aesthetic feet for coverage of any floor pipes. Available in white. B0193 Floor fixing bracket kit. Terminal support and floor fixing bracket kit (front glass applications or on non-bearing walls). To be used in combination with kit B0157. B0171 (200) B0173 (400) B0175 (600) B0177 (800) B0179 (1000) B0520 (200) B0521 (400) B0522 (600) B0523 (800) B0524 (1000) Back panel in painted sheet (for front glass applications). Bi2 ceiling installation kit (Excluding versions SLR and SLI) AIR TREATMENT ELECTRICAL KITS AESTHETICAL KITS HEATING 81 Bi2 naked SLIR inverter e first recessed inverter fan coil radiator with heating panel. MODEL Recessed heating* Heating panel kit formwork for recess * formwork and front heating panel are necessary A C B C A B C B A B 82 FEATURES Cools, Dehumidifies, Heats and Filters Recessed version with heating panel Compact: recessed wall thickness of just 142 mm Range consists of 5 power models Recess with formwork DC brushless Motor Ultra slim aesthetic panel Only available with left hydraulic connections. installation: wall Available in colors: White RAL 9010 BI2 with heating panel. (SLIR Inverter) SLIR200 SLIR400 SLIR600 SLIR800 SLIR1000 CODE 01639 01640 01641 01642 01643 CODE B0731 B0732 B0733 B0734 B0735 CODE B0568 B0569 B0570 B0571 B0572 SLIR inverter VERSION A B C Weight SLIR 200 SLIR 400 SLIR 600 SLIR 800 SLIR 1000 mm 525 725 925 1125 1325 mm 576 576 576 576 576 mm 126 126 126 126 126 kg 9 12 15 18 21 A Recessed Kit A B C 200 400 600 800 1000 mm 713 913 1113 1313 1513 mm 725 725 725 725 725 mm 142 142 142 142 142 Front panel A B 200 400 600 800 1000 mm 772,5 972,5 1172,5 1372,5 1572,5 mm 754 754 754 754 754 INTEGRATED SYSTEMS AIR CONDITIONING Back detail of heating front panel partitioned by SLIR version Recessed with aesthetic panel sheet (SLI version and SLIR heating) AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) (b) Water pressure loss (50°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply Max capacity static heating (50°C) Max capacity static heating (70°C) Water content heating panel Bi2 SLIR inverter 200 400 600 800 1000 (E) kW 0,82 1,74 2,54 3,29 3,78 (E) kW 0,64 1,25 1,94 2,54 2,98 lt/h 142 302 446 573 655 (E) kPa 13,1 8,2 19 18,7 18,2 (E) kW 1,05 2,31 3,12 4,10 4,67 lt/h 84 185 249 329 374 (E) kPa 10,9 6,8 15,8 15,5 15,1 kW 1,77 3,88 5,21 6,88 7,83 lt/h 152 334 448 592 673 kPa 10,9 7,0 14,3 12,7 12,5 l 0,47 0,8 1,13 1,46 1,8 bar 10 10 10 10 10 inches Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 m3/h 100 170 180 370 420 m3/h 160 320 460 575 650 (E) W 5 6 7 8 9 (E) W 11 19 20 24 27 (E) dB(A) 38 39 41 42 42 (E) dB(A) 52 53 53 54 54 dB(A) 34 36 37 35 38 V/ph/Hz 230/1/50 230/1/50 230/1/50 230/1/50 230/1/50 kW 0,37 0,42 0,50 0,62 0,77 kW 0,59 0,71 0,84 1,04 1,28 l 0,5 0,6 0,7 0,9 1,0 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (f) Sound pressure measured at 1,5 m 83 HEATING ACCESSORIES SLIR inverter ON BOARD CONTROL CODE B0828 NEW B0685 OUT OF STOCK DESCRIPTION Touch flat design built-in control kit. Back-lit display with desired temperature visualization, real-touch switches, mode of operation and fan speed selection. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor contact connection, a 230VAC outlet for the solenoid valve control. Remote control provided. For ceiling installation in combination with B0736. Can be remote controlled via a combination of keys for connection with Modbus RS485 protocol. Command pre-configured on the machine (cannot be ordered separately). Bi2 inverter control kit for remotization. e main operating parameters, set point and ambient temperature are transmit- ted from the remote control B0736 to all connected fan coils on the network, enabling a seamless operation. It has a 230VAC outlet for the control of a solenoid valve, two clean contacts for the control of a chiller or a boiler, and a presence inlet. Operation in MODBUSprotocol, RS485. COMPATIBILITY B0736 CONTROL My Home by B0736 CONTROL My Home by B0756 Control kit for remotization for the management and control through analogic inlet O-10V or contacts. It has a 230VAC outlet for the control of one solenoid valve and a water sensor inlet with minimum temperature sensor function (in the contact mode) REMOTE CONTROL B0736 LCD wall clock thermostat remote control kit Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. B0828 B0685 CONTROL Addressing for Bticino INDRZ management and AQUADUE Control Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome 84 INTEGRATED SYSTEMS HYDRAULIC KITS AIR CONDITIONING CODE B0139 B0832 B0635 B0834 B0205 B0204 B0200 B0201 B0203 DESCRIPTION 2 way group valves with thermoelectric actuator kit. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a valve with thermoelectric actuator and holder, the first allows for the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses. is kit is mandatory in version SLR except in the case of using a 3-way valve kit or in the presence of a collector with thermoelectric heads. 3-way group valves kit with thermoelectric actuator. 3-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a three-way diverter valve with thermoelectric actuator, and a holder. e first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses; the by-pass keeps water circulating in the system. is kit is an alternative to the 2-way solenoid valve kit (required in version SLR). e valve unit kits with thermoelectric actuator are recommended for the following command kits to activate chiller and boiler: B0659 - B0673 - B0707 - B0774 - B0772 - B0828 - B0756 Manual 2-way group valves kit. Consisting of a valve and a holder, the first allows the cabinet to be manually excluded from the system, while the holder allows the balancing of system load losses. Also allowed when solenoid valves on the collector are managed by the control kit of terminal Bi2. Manual 2-way valve isolation kit. Avoids condensation during the cooling operation (already included in the other thermoelectric hydraulic kits). Adaptors couple kit. Allows you to transform the Bi2 3/4 `' Eurocone connection into a standard 1/2 "(B0200) or 3/4 `' (B0201) gas thread connection. Kit 90° Eurokonus bend. Facilitates the connection in case of hydraulic connections with walled pipes Formwork for recess with closing panel: Structure for recessed installation. For vertical installation B0568 (200), B0569 (400), B0570 (600), B0571 (800), B0572 (1000) Recessed closing heating panel for recessed structure. * For vertical installation B0731 (200), B0732 (400), B0733 (600), B0734 (800), B0735 (1000) RECESSED KIT AIR TREATMENT HEATING * Necessary accessory kit. 85 Bi2 naked SLI inverter Recessed inverter fan coil unit. MODEL Recessed A C A B A B 86 FEATURES Cools, Dehumidifies, Heats and Filters Recessed version Compact: recessed wall thickness of just 142 mm Range consists of 5 power models Recess with formwork DC brushless Motor Ultra slim aesthetic panel installation: floor wall Available in colors: White cieling CODE C B SLI200 01513 BI2 SLI without heating panel. (SLI Inverter) SLI400 SLI600 SLI800 01514 01515 01516 SLI1000 01517 SLI 2 tubes recessed VERSION A mm B mm C mm Weight kg SLI 200 SLI 400 SLI 600 SLI 800 SLI 1000 525 725 925 1125 1325 576 576 576 576 576 126 126 126 126 126 7 9,5 11 14 17 C B A Recessed Kit A B C 200 400 600 800 1000 mm 713 913 1113 1313 1513 mm 725 725 725 725 725 mm 142 142 142 142 142 Front panel A B 200 400 600 800 1000 mm 772,5 972,5 1172,5 1372,5 1572,5 mm 754 754 754 754 754 INTEGRATED SYSTEMS WALL-INSTALLATION ONLY WITH CLOSURE PANEL Accessories: - Recess kit: structure for recessed installation - RAL 9010 white closure panel colore Bianco RAL 9010 WALL-INSTALLATION Accessories: - Intake kit - Plenum at 90° (grids and panel not supplied) FALSE-CEILING INSTALLATION Accessories: - Intake kit - Telescopic plenum/ Plenum at 90° - Supply/intake grid AIR CONDITIONING AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) (b) Water pressure loss (50°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply Bi2 SLI inverter 200 400 600 800 1000 (E) kW 0,82 1,74 2,54 3,29 3,78 (E) kW 0,64 1,25 1,94 2,54 2,98 lt/h 142 302 446 573 655 (E) kPa 13,1 8,2 19 18,7 18,2 (E) kW 1,05 2,31 3,12 4,10 4,67 lt/h 84 185 249 329 374 (E) kPa 10,9 6,8 15,8 15,5 15,1 kW 1,77 3,88 5,21 6,88 7,83 lt/h 152 334 448 592 673 kPa 10,9 7,0 14,3 12,7 12,5 l 0,47 0,8 1,13 1,46 1,8 bar 10 10 10 10 10 inches Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 Eurocone 3/4 m3/h 100 170 180 370 420 m3/h 160 320 460 575 650 (E) W 5 6 7 8 9 (E) W 11 19 20 24 27 (E) dB(A) 38 39 41 42 42 (E) dB(A) 52 53 53 54 54 dB(A) 34 36 37 35 38 V/ph/Hz 230/1/50 230/1/50 230/1/50 230/1/50 230/1/50 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (f) Sound pressure measured at 1,5 m 87 HEATING ACCESSORIES SLI inverter ON BOARD CONTROL CODE B0828 NEW B0685 OUT OF STOCK DESCRIPTION Touch flat design built-in control kit. Back-lit display with desired temperature visualization, real-touch switches, mode of operation and fan speed selection. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor contact connection, a 230VAC outlet for the solenoid valve control. Remote control provided. For ceiling installation in combination with B0736. Can be remote controlled via a combination of keys for connection with Modbus RS485 protocol. Command pre-configured on the machine (cannot be ordered separately). Bi2 inverter control kit for remotization. e main operating parameters, set point and ambient temperature are transmit- ted from the remote control B0736 to all connected fan coils on the network, enabling a seamless operation. It has a 230VAC outlet for the control of a solenoid valve, two clean contacts for the control of a chiller or a boiler, and a presence inlet. Operation in MODBUSprotocol, RS485. COMPATIBILITY B0736 CONTROL My Home by B0736 CONTROL My Home by B0756 Control kit for remotization for the management and control through analogic inlet O-10V or contacts. It has a 230VAC outlet for the control of one solenoid valve and a water sensor inlet with minimum temperature sensor function (in the contact mode) B0151 B0152 REMOTE CONTROL B0151 OUT OF STOCK Wall control kit with thermostat, summer/winter selector and speed switch. Wall thermostat with room sensor, On-Off switch, three-speed fan and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. It has two 230VAC hot water and cold water solenoid outlets and an inlet water temperature sensor. B0756 B0152 Recessed control kit LCD with ambient sensor and thermostat, summer/winter selector and speed switch.Electronic recessed thermostat with ambient sensor, On-Off switch, fan speed selector (min, med, max and auto), ambient temperature, minimum water sensor mode and summer/winter selector. Temperature range setting from 5 ° C to 30 ° C. 230 V supply. B0756 B0736 LCD wall clock thermostat remote control kit Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. B0828 B0685 CONTROL Addressing for Bticino INDRZ management and AQUADUE Control Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome 88 INTEGRATED SYSTEMS AIR CONDITIONING HYDRAULIC KITS CODE B0139 B0832 B0641 B0833 B0635 B0834 B0205 B0204 B0501 B0200 B0201 DESCRIPTION 2 way group valves with thermoelectric actuator kit. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a valve with thermoelectric actuator and holder, the first allows for the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses. is kit is mandatory in version SLR except in the case of using a 3-way valve kit or in the presence of a collector with thermoelectric heads. 2-way valves group kit with thermoelectric actuator and bypass branch with pressure relief valve. 2-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch and by-pass branch with pressure-relief valve. e kit consists of a valve with thermoelectric actuator, a holder and a bypass with a pressure relief valve, the first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses while the by-pass maintains the system balanced even with cabinet excluded. is kit is an alternative to the 2-way solenoid valve kit. (Required in SLR version) 3-way group valves kit with thermoelectric actuator. 3-way valves unit kit with 4-wire thermoelectric actuator and end run micro switch. Consists of a three-way diverter valve with thermoelectric actuator, and a holder. e first allows the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses; the by-pass keeps water circulating in the system. is kit is an alternative to the 2-way solenoid valve kit (required in version SLR). e valve unit kits with thermoelectric actuator are recommended for the following command kits to activate chiller and boiler: B0659 - B0673 - B0707 - B0774 - B0772 - B0828 - B0756 Manual 2-way group valves kit. Consisting of a valve and a holder, the first allows the cabinet to be manually excluded from the system, while the holder allows the balancing of system load losses. Manual 2-way valve isolation kit. Avoids condensation during the cooling operation (already included in the other thermoelectric hydraulic kits). Spacer kit (No. 1 unit) 3/4 Eurokonus. Available for multilayer pipes d. 20 mm. (which do not allow adequate bending radii), no. 1 or 2 kit. for machine according to the type of installation. Adaptors couple kit. Allows you to transform the Bi2 3/4 `' Eurocone connection into a standard 1/2 "(B0200) or 3/4 `' (B0201) gas thread connection. B0203 B0632 (200) (400) (600) B0633 (800) (1000) Kit 90° Eurokonus bend. Facilitates the connection in case of hydraulic connections with walled pipes Control connection extension kit. Power and motor sensor electric connection cable for installations where connection positions are rotated (from Left to Right). Ceiling recessed kit: air discharge grid with wing profile. B0550 (200), B0551 (400), B0552 (600), B0553 (800), B0554 (1000) Ceiling recessed kit: air suction grid with wing profile. OUT OF STOCK B0559 (200), B0560 (400), B0561 (600), B0562 (800), B0563 (1000) Ceiling recessed kit: air discharge grid with wing profile.* B0815 (200), B0816 (400), B0817 (600), B0818 (800), B0819 (1000) Ceiling recessed kit: air suction grid with wing profile.* B0820 (200), B0821 (400), B0822 (600), B0823 (800), B0824 (1000) Suction kit for false ceiling or plasterboard trapdoor. Channels the air drawn from the suction grille to the cabinet. B0194 (200), B0195 (400), B0196 (600), B0197 (800), B0198 (1000) Upper telescopic discharge plenum kit. Channels the air from the cabinet to the discharge grille. B0160 (200), B0161 (400), B0162 (600), B0163 (800), B0164 (1000) Recessed kit with closing panel: Structure for recessed installation. For vertical installation (combine with closing panel) B0568 (200), B0569 (400), B0570 (600), B0571 (800), B0572 (1000) AIR TREATMENT ELECTRICAL KITS RECESSED KIT HEATING Closing panel for recessed structure. For vertical installation (combine with recessed structure kit) B0578 (200), B0579 (400), B0580 (600), B0581 (800), B0582 (1000) 90° insulated discharge plenum kit. Channels the air from the cabinet to the discharge grille. (non compatible with recessed structure). B0165 (200), B0166 (400), B0167 (600), B0168 (800), B0169 (1000) * ceiling recessed kit while stocks last; hereafter ceiling recessed kits with codes from B0550 to B0554 and from B0559 to B0563 will be valid. 89 Bi2 4tubes* SLR 4T Fan coil radiator for heating and cooling at the same time. FEATURES Cools, Dehumidifies, Heats and Filters Simultaneous Cooling + Heating Double HE Coil AC Motor Version with heating panel Compact: recessed wall thickness of just 12,9 cm Range consists of 5 power models Easy maintenance: the easy removability of air filters and access to the front fan simplify cleaning installation: floor wall Available in colors: White RAL 9010 MODEL SLR 4 tubes A 150 codice 01711 D B C BI2 SLR 4 tubes with heating panel. 250 350 500 650 01712 01713 01714 01715 A B C D nWeetigwhetight 21500 42500 63050 8500 1605000 mm 697 897 1097 1297 1497 mm 639 639 639 639 639 mm 719 719 719 719 719 mm 129 129 129 129 129 kg 22 27 32 36 41 * product available only on request 90 INTEGRATED SYSTEMS B Valve with thermoelectric actuator (accessory kit) C Tubular heating panel D High Efficiency Coil E Water temperature sensor F High efficiency tangential fan G DC brushless inverter motor H Electronic controls (accessory kit) I Condensation collector basin C B D I F H E G AIR CONDITIONING AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (65°C) (b) Water flow rate (65°C) (b) Water pressure loss (65°C) (b) Heating capacity (70°C) (c) Water flow rate (70°C) (c) Water pressure loss (70°C) (c) Battery water cooling capacity Battery water Heating capacity Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply Max capacity static heating (50°C) Max capacity static heating (70°C) Water content heating panel (E) kW (E) kW lt/h (E) kPa (E) kW lt/h (E) kPa (E) kW lt/h (E) kPa l bar pollici m3/h m3/h (E) W (E) W (E) dB(A) (E) dB(A) dB(A) V/ph/Hz kW kW l 150 0,57 0,48 100,3 7,3 0,60 50,1 0,3 0,71 59,7 0,3 0,47 0,16 10 3/4" EK 65 115 8 16 40 54 48 230/1/50 0,37 0,59 0,3 250 1,19 0,93 208,6 3,9 1,13 95,5 0,7 1,29 109,6 0,8 0,8 0,27 10 3/4" EK 115 190 10 19 40 54 48 230/1/50 0,42 0,71 0,5 BI2 SLR 4 TUBES 350 1,72 1,43 300,2 9,2 1,53 129,4 0,4 1,75 148,1 0,5 1,13 0,38 10 3/4" EK 175 295 13 25 40 54 48 230/1/50 0,50 0,84 0,6 500 2,22 1,76 387,6 8,8 1,94 164,3 0,6 2,26 191,4 0,9 1,46 0,49 10 3/4" EK 235 380 16 30 43 57 51 230/1/50 0,62 1,04 0,7 Performance at maximum ventilation speed (a) Water temperature in battery inlet 7°C, water temperature in battery outlet 12°C, ambient air temperature 27°C b.s. and 19°C b.u. (b) Water temperature in battery inlet 50°C, water flow in cooling + panel, inlet ambient air temperature 20°C (c) Water temperature in battery inlet 70°C, water temperature in battery outlet 60°C, ambient air temperature inlet 20°C (d) Air flow measured with clean filters (E) Eurovent certificate (f) Sound pressure measured at 1,5 m 650 2,56 2,08 447,0 8,6 2,35 199,1 0,9 2,57 217,9 1,2 1,8 0,60 10 3/4" EK 250 420 17 35 44 57 51 230/1/50 0,77 1,28 0,9 91 HEATING ACCESSORIES SLR 4T CODE B0659 DESCRIPTION Built-in electronic control kit. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor connection, and two 230VAC outlets for the control of 2 valves. COMPATIBILITY ON BOARD CONTROL B0374 OUT OF STOCK Built-in electronic control For SLR 4 pipes, SL 4 pipes versions. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor connection, and two 230V outlets for the control of 2 valves. B0855 NEW B0375 OUT OF STOCK Touch flat design built-in control kit. Back-lit display with desired temperature visualization, real-touch switches, mode of operation and fan speed selection. Control with adjustable thermostat, fan speed selection (summer, winter, automatic) and ventilation program (minimum, maximum, night, modulated) and minimum water sensor function. It has an inlet for the presence sensor contact connection, a 230VAC outlet for the solenoid valve control. Remote control provided. For ceiling installation in combination with B0736. Can be remote controlled via a combination of keys for connection with Modbus RS485 protocol. Command pre-configured on the machine (cannot be ordered separately). Electronic control kit for remotization e main operating parameters, set point and ambient temperature are tran- smitted from remote controls B0736 to all fan coils connected on the network, enabling a seamless operation. It has two 230 V outlets for the control of two solenoid valves and two contacts for the control of a presence sensor. Operation in MODBUS, RS485. B0736 B0736 CONTROL CONTROL B0736 LCD wall clock thermostat remote control kit Programmable wall LCD thermostat control for MODBUS connection, RS485. Ability to control up to 30 units. Desired temperature selection, operation mode, fan speed, manual/programmable thermostat. Room sensor inserted in control. Backlit LCD. Presence contact input. e control is equipped with a 230/12VAC double insulation power transformer and a buffer battery. Wall installation with center to center distance compatible with standard recessed mounting box 503. B0855 B0375 CONTROL REMOTE CONTROL Addressing for Bticino INDRZ management and AQUADUE Control Mandatory factory addressing of the remote control kits in the case of remote management via Modbus connection with AQUADUE Control or Bticino MYHome 92 INTEGRATED SYSTEMS HYDRAULIC KITS AIR CONDITIONING CODE B0825 B0826 B0205 x2 B0204 x2 B0200 B0201 B0203 DESCRIPTION 2-way group valves with thermoelectric actuator kit (for 4 tubes model). Consists of a valve with thermoelectric actuator and holder, the first allows for the control of terminal thermal emissions intercepting water passage; the holder allows the balancing of system load losses. is kit is mandatory in version SLR except in the case of using a 3-way valve kit or in the presence of a collector with thermoelectric heads. 3-way group valves kit with thermoelectric actuator (for 4 tubes model). Consists of two three-way diverter valves with thermoelectric actuators, and two holders. ey allow the control of terminal thermal emissions intercepting water passage; the holders allow the balancing of system load losses; the by-pass keeps water circulating in the system. is kit is an alternative to the 2-way solenoid valve kit. Manual 2-way group valves kit. Consisting of a valve and a holder, the first allows the cabinet to be manually excluded from the system, while the holder allows the balancing of system load losses. Manual 2-way valve isolation kit. Avoids condensation during the cooling operation (already included in the other thermoelectric hydraulic kits). Adaptors couple kit. Allows you to transform the Bi2 3/4 `' Eurocone connection into a standard 1/2 "(B0200) or 3/4 `' (B0201) gas thread connection. kit 90° Eurokonus bend. Facilitates the connection in case of hydraulic connections with walled pipes B0459 Control connection extension kit. Power and motor sensor electric connection cable for installations where connection positions are rotated (from Left to Right). B0157 Feet kit Kit of two aesthetic feet for coverage of any floor pipes. Available in white. B0193 Floor fixing bracket kit. Terminal support and floor fixing bracket kit (front glass applications or on non-bearing walls). To be used in combination with kit B0157. B0181 (150) B0183 (250) B0185 (350) B0187 (500) B0189 (650) Back panel in painted sheet (for front glass applications). ELECTRICAL KITS AIR TREATMENT AESTHETICAL KITS HEATING 93 NEWCi2 Wall High-wall fan coil. remote control unit supplied Minimum Sound Pressure: 38 dB(A) FEATURES Conditions, Dehumidifies, Heats and Filters Available in two sizes DC brushless motor Fitted with large motorised flap Installation facilitated via flexible connection ree-way solenoid valve supplied Remote control supplied Remote control wall fixing bracket Plastic body Easy maintenance through the removable front panel Installation: high-wall MODEL Ci2 Wall with 3-way valves A Ci2 Wall LGW inverter LGW 1200 DC LGW 1400 DC code 99353 99354 B C A B C net weight LGW 1200 DC LGW 1400 DC mm 915 1072 mm 290 315 mm 230 230 kg 12,7 12,7 94 INTEGRATED SYSTEMS Easy maintenance through the removable front panel. 1 Step Swing 2 3 4 e motorised flap ensures that the direction of the air corresponds with the mode selected. Ci2 Wall Accessories CODE DESCRIPTION B0856 WALL-COMMAND FOR Ci2 WALL - LCD screen - Mode control - Fan speed control - Temp. Setting AIR CONDITIONING AIR TREATMENT MODEL Total cooling capacity (a) Sensible cooling capacity (a) Water flow rate (a) Water pressure loss (a) Heating capacity (50°C) (b) Water flow rate (50°C) Water pressure loss (50°C) Maximum operating pressure Water connections Air flow min (d) Air flow max (d) Absorbed power min Absorbed power max Sound power min Lw Sound power max Lw Sound pressure (f) Electrical supply kW kW lt/h kPa kW lt/h kPa bar inch m3/h m3/h W W dB (A) dB (A) dB (A) V/ph/Hz 1200 DC 2,70 2,15 467 31,6 2,94 467 32,7 16 3/4" F 400 492 10 13 39 44 38 220-240/1/50 Ci2 wall LGW inverter 1400 DC 3,81 3,18 659 56,8 4,30 659 51,9 16 3/4" F 590 825 15 34 47 57 51 220-240/1/50 (a) Cooling mode in standard conditions: air temperature 27°C d.b. 19°C w.b., water inlet temperature 7°C, water outlet temperature 12°C (b) Heating mode in conditions of use 1: air temperature 20°C d.b., 15 °C w.b. max, water inlet temperature 50°C, water flow rate equal to that of standard condition cooling (c) Heating mode in standard conditions: air temperature 20°C d.b., 15°C w.b. max, water inlet temperature 45°C, water outlet temperature 40°C (d) Sound pressure level at 1.5 m distance, valid for closed environments with volume equal to 100 m3 with reverberation time of 0.5 s and floor/ceiling installation, sound emission on 1/4 of sphere (E) Eurovent certificate data (f) Air flow rate measured with clean filters 95 HEATING 96 CONTROLLED MECHANICAL VENTILATION 97 HEATING AIR TREATMENT AIR CONDITIONING INTEGRATED SYSTEMS CONTROLLED MECHANICAL VENTILATION Decentralised residential controlled mechanical ventilation system RECIRCULATION OF THE AIR MOULD PREVENTION HUMIDITY PREVENTION ENERGY SAVING CLEAN AIR WITH MAXIMUM ENERGY SAVING SILENTLY RANGE CMV DECENTRALISED SITALI DF100 PURE CMV dual cross-flow, with heat recovery for automatic exchange and purification of the air SITALI SFE100 CMV extraction only SITALI SF150 CMV flow alternated with heat recovery SITALI SF150 CMV flow alternated with heat recovery 98 INTEGRATED SYSTEMS AIR CONDITIONING Sitali DF 100 Pure Dual cross-flow, de-centralised Controlled Mechanical Ventilation with heat recovery, for automatic ventilation and purification of the air. Allows transfer of the heat of the air from the indoor rooms to the cold air introduced from outdoors, purifying the air introduced with the presence of the F7 anti-pollen filter. Sitali SF 150 Decentralised, alternating single flow Controlled Mechanical Ventilation with heat recovery, which allows transfer of the heat of the air from the indoor rooms to the cold air introduced from outdoors. Several units can be synchronised with maximum acoustic comfort. e complete system requires cable connection. Sitali SFE 100 Decentralised, continuous single flow Controlled Mechanical Ventilation (extraction only), for replacing stale air in the humid environments. FEATURES: - e Decentralised CMV units do not have to be connected to any internal air distribution network. - Energy saving: the pre-heated external air, which is introduced into the indoor environments via the Sitali DF100 Pure and Sitali SF150 units, limits the necessity to solicit the heating system. - e CMV units are fitted with EC brushless motorisation, with significantly reduced energy consumption. - Indoor Air Quality: an appropriately dimensioned mechanical ventilation system guarantees the constant quality of the indoor air for the wellbeing and health of the occupants and the building. - Periodic maintenance of the filters mounted on the Sitali DF100 Pure and Sitali SF150 units helps to maintain the indoor air healthier. CODE DESCRIPTION 99360 SITALI DF100 PURE Cmv dual crossflow, with heat recovery B0854 KIT Sitali DF100 Kit for the replacement of f7 and g4 filters CODE DESCRIPTION 99431 SITALI SF150 Cmv flow alternated with heat recovery CODE DESCRIPTION 99422 SITALI SFE100 Cmv extraction only B0837 KIT SITALI SFE100 Pipe B0838 KIT SITALI SFE100 Grid AIR TREATMENT HEATING QUALITY OF THE AIR An appropriately dimensioned mechanical ventilation system guarantees the constant quality of the indoor air for the well-being and heath if the occupants and the building. Periodic maintenance of the anti-dust filter mounted on the Sitali SF150 units helps to maintain the indoor air healthier. ENERGY SAVING e Sitali SFE100/SF150 units are fitted with EC brushless motorisation, with significantly reduced energy consumption. rough the pre-heated outdoor air that is introduced into the indoor environments, the Sitali SF150 unit, limits the need to solicit the heating system. SILENT SYSTEM e units can be synchronised with each other in maximum acoustic comfort and are optimised for continuous 24/24h operation. 99 SITALI DF100 Pure SITALIDF100PURE Cod.99360 Dual cross-flow, de-centralised Controlled Mechanical Ventilation with heat recovery for automatic exchange and purification of the air. FEATURES Energy class: EC Brushless Motor Enthalpic cross-flow heat exchanger, composite material F7 anti-pollen filter in introduction, for purification G4 filter in extraction Control on the machine and remote control unit Filters replacement LED signal Night time/hyperventilation function SILENT FUNCTION Only 18,6 dB (A) Optimised for continuous 24/24h operation COMPACT TECHNOLOGY Compact unit with reduced clearance and consequent easy transport, installation and maintenance. FILTERS F7 AND G4 e machine is fitted with the F7 anti-pollen filter in introduction mode and G4 filter in extraction F7 ANTI-POLLEN FILTER FOR PURIFICATION OF INDOOR AIR e indoor air is filtered by the special F7 filter, which can stop fine dusts such as PM10 and PM2.5, pollens and other pollutants harmful to health. e special F7 anti-pollen filter stops up to 90% of 0.4 particles with dimensions six times finer than PM2.5. PROTECTION FROM: MOULD POLLEN HUMIDITY FINE DUSTS 100 INTEGRATED SYSTEMS AIR CONDITIONING ile ile ile di collegamento 135 mm Incluso Incluso Non disponibile Interno, cavi di collegamento 785 x 320 x 135 mm 330 Prezzo 667,00 699,00 899,00 1349,00 500 15,57 40,00 osti di trasporto. Prezzi in euro IVA esclusa. Kit optional Ø100 mm 120 330 TECHNICAL DATA Product code Hole diameter mm Energy class Flow rate adjustment Air flow rate m3/h Sound pressure db(A) Sound power (according to UNI 3744:2010) Max. thermal Filters (introduction/extraction) Heat exchanger Power supply voltage Absorbed current max Input power W Mq treated Weight EXTERNAL GRIDS Sitali DF100 Pure is supplied with a standard Ø100 mm ducting kit, for easy and quick installation, with flexible vents that can be installed from inside the building. Control on the machine SITALI DF100 Pure 99360 100 A 4 speed 31/22/17/10 36,6/29,7/23,8/18,6 44,6/37,7/31,8/26,6 86% F7 / G4 Enthalpic cross-flow 230V - 50Hz - 1pH 0,68 A 16,5/9/6,5/4,6 25m² 6,5 Kg Remote control unit as per standard Code B0854 - Sitali DF100 Pure, F7 and G4 filters kit Kit for replacing F7 and G4 filters (present as per standard in the machine) 1 2 OPERATING LAYOUT e stale air coming from closed rooms is expelled outdoors. e fresh air enters from outdoors and passes through the special F7 filter, where it is purified from smog, dusts, pollens and pollutants present in the outdoor air. e heat exchanger heats the clean air entering, recovering up to 86% of the heat contained in the stale air heated by the plants. AIR TREATMENT HEATING e stale air, full of humidity and CO2, is withdrawn from the indoor environment and made to flow through the heat exchanger, where it transfers its heat to the fresh air entering. 101 SITALI SF 150 Alternate single flow decentralised Controlled Mechanical Ventilation with heat recovery SITALI SF 150 Cod. 99431 FEATURES Temperature probe that adjusts the air flow inversion times to maintain the indoor comfort level Energy class: EC brushless motor Integrated humidity sensor Easy maintenance, indoor magnetic release Infra-red remote control with LCD Double filter on the inner/outer side of the exchanger Multicolour LED indicator 5 ventilation speeds available Magnetic wall support for remote control SILENT FUNCTION e most silent: only 10 -dB (A) Optimised for continuous 24/24h operation. Telescopic pipe adaptable to the thickness of the wall Anti-dust filter, easy to remove and washable External grid 218 Regenerative heat exchanger with washable ceramic pack 77,5 158 300÷570 102 INTELLIGENT FUNCTION anks to the presence of the temperature detection probe, the air flow inversion time is self-adjusted to allow the best comfort indoors. MAGNETIC FUNCTION Quick release via magnets for easy maintenance without the need for specialised staff. Magnetic release to facilitate maintenance operations Front cover in top quality ABS remote control unit as per standard Flow direction Method Filter reset Comfort/efficiency key Filter reset key Ventilation speed Timer Ventilation speed key Flow direction key Boost key Ventilating unit TWO METHODS Comfort: best acoustic comfort for use during the night Efficency: best efficiency at maximum power TECHNICAL DATA Product code Hole diameter mm Energy class Flow rate aria m3/h Sound pressure db(A)* absorption W Termal efficency max Environment temperature °C max IP protection rating Weight kg SF 150 99431 160 A 60 / 50 / 40 / 30 / 20 29 / 24 / 20 / 14 / 10 6 / 4,5 / 3,5 / 2,5 / 2 82% -20°C +50°C IPX4 5,5 220-240 V ~ 50-60Hz aeraulic performance measured according to ISO 5801 at 230V 50Hz, density of the air 1.2 Kg/m3 - data measured in accredited TÜV Rheinland laboratory * sound pressure level at 3m in free field INTEGRATED SYSTEMS SITALI SFE 100 Continuous single flow decentralised Controlled Mechanical Ventilation SITALI SFE 100 Cod. 99422 FEATURES Top quality ABS structure High-efficiency aerodynamic fan EC brushless motor with thermal protection Integrated humidity sensor Elegant deign with minimalist lines Front cover; easy to remove for cleaning, without the use of tools Aerodynamic deflectors Very low energy consumption 4 ventilation speeds available AIR CONDITIONING SILENT FUNCTION e most silent: only 11 dB (A) Optimised for continuous 24/24h operation. VENTILATION Decentralised CMV unit with continuous single flow, Ø100 mm, with very low energy consumption, for replacing stale air in the humid environments with maximum acoustic comfort. Ideal for preventing problems of condensate and mould, which inevitably damage the structure and compromise the health of the occupants. HUMIDITY DETECTION e unit is fitted with a humidity detection sensor, adjustable from 50% to 95% R.H. and a timer; this can be adjusted from 0 to approx. 30 minutes. e unit operates continuously at the minimum speed selected, which increases automatically to the average speed when the R.H. percentage exceeds the threshold set. AIR TREATMENT HEATING ø 99 164 116 70 4C6 TECHNICAL DATA Product code Hole diameter mm Flow rate m3/h Consumption W Sound pressure db(A)* Environment temperature °C max IP protection rating Weight kg SFE 100 99422 100 (110 with telecopic tube) 83 / 47 / 29 / 21 2,5 / 1,7 / 1,2 / 1 26 / 23 / 13 / 11 50 IPX4 0,6 220-240 V ~ 50-60Hz aeraulic performance measured according to ISO 5801 at 230V 50Hz, density of the air 1.2 Kg/m3 - data measured in accredited TÜV Rheinland laboratory * sound pressure level at 3m in free field 103 104 UNICO 105 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS THE UNICO RANGE e air conditioner without outdoor unit, patented and designed by Olimpia Splendid in 1998. Unico, born with 15 years of experience. Unico is the winner of GOOD DESIGN AWARD. Founded in Chicago in 1950, GOOD DESIGN is the oldest internationally recognized competition for design excellence. A complete range of solutions with no architectural impact. MADE IN ITALY UNICO has been made in Italy by Olimpia Splendid since 1998, a warranty or quality and experience.* * Consolle model excluded OLIMPIA SPLENDID GRID TECHNOLOGY e external grilles, designed by Olimpia Splendid maximize the tradeoff between air flow and coil protection, ensuring the highest heat exchange coefficient and durability. Grids are also free of mechanical and electrical devices thereby reducing the risk of faults and system malfunction to zero. 27 dB SILENT TECHNOLOGY With the latest generation sound absorbing and anti-vibration materials UNICO is a machine that ensures the lowest noise levels in its category . Noise is reduced down to 27 db.* * AIR version 106 HYDRONIC SYSTEMS SAVINGS 30% AIR CONDITIONING 16 cm SLIM DESIGN Olimpia Splendid patented technology allows to build in a single unit what is traditionally divided in two: the compressor placed outside and the fan placed in the room to be cooled. Today all of UNICO*'s technology can be found a thickness of only 16 cm. * ickness refers to the AIR version. -30% INVERTER SYSTEM Olimpia Splendid's variable speed compressor and inverter control ensure a constant adaptation of the cooling capacity to the ambient thermal load. Hence, up to 30%* of energy can be saved. (*) Only inverter products 100% 80% 70% NON INVERTER AC INVERTER DC INVERTER x2 TWIN TECHNOLOGY Patented technology that makes double room air conditioning possible without outdoor unit. You can use the two units (Master and Wall) together or separate, both in heating and cooling. (*) only for Unico Twin and Unico Boiler units. AIR TREATMENT HEATING 107 bottom wall top wall THE UNICO RANGE MONO RECESSED UNICO AIR AC motor pag. 112 UNICO SMART e UNICO R pag. 120-134 UNICO AIR INVERTER pag. 114 DC motor UNICO INVERTER pag. 122 UNICO PRO INVERTER pag. 124 bottom wall bottom wall bottom wall bottom wall top wall top wall top wall top wall UNICO AIR pag. 116 UNICO AIR INVERTER pag. 118 top wall parete alto bottom wall parete basso UNICO EASY pag. 132 UNICO TWIN floor pag. 130 UNICO BOILER pag. 136 CONSOLLE MULTI TOWER UNICO TOWER pag. 128 floor INSTALLATION NOTE By maintaining the same center to center distance of inlet and outlet holes, every model in the Unico range can easily substitute previously installed ones. 108 HYDRONIC SYSTEMS AIR CONDITIONING ACCESSORIES CODE B1015 KIT UNICO Wi-Fi DESCRIPTION Additional kit compatible on the entire Unico range (see compatibility table) B1014 B1012 B0776 SERIAL INTERFACE FOR UNICO Interface for receiving wireless commands (desired temperature, fan speed, air flap operation and air circulation operation) or by contact (cooling or heating mode operation, fan speed). Presence contact input or Sleep mode. Alarm output in case of malfunction. Compatible with all models (excluding Unico Twin, Boiler, Easy SF). WIRELESS WALL CONTROL FOR UNICO Wall controller with battery power, for sending wireless commands (desired temperature, fan speed, air deflector function.) Compatible with all models (excluding Unico Twin, Boiler, Easy SF). CLOSING PANEL FOR RECESSED STRUCTURE Designed to completely camouflage the product in the building's architecture, only compatible with UNICO AIR models. B0775 RECESSED FORMWORK KIT Provided for quick installation and already prepared with holes for the product's installation, only compatible with UNICO AIR models. B0565 INSTALLATION KIT FOR 200mm HOLES Installation kit for Unico (installation template 1: 1 scale, support bracket, universal PP sheets, internal torque flanges Ø 200 mm, pair of external folding grid Ø 200 mm, torque caps). (Not compatible with Unico Easy) B0564 INSTALLATION KIT Internal torque flanges Ø 160 mm, pair of external folding grid Ø 160 mm, torque caps. B0620 B0753 HEATING CABLE UNICO KIT Heating cable, prevents the formation of ice in the condensation dispersal basin. 200 mm RAIN COVER KIT Rain cover kit to be installed on the outside wall to protect the holes (for installations in extreme weather conditions). Designed for ø 200 mm grid. AIR TREATMENT HEATING 109 WI-FI UNICO® KIT WI-FI UNICO Casa 01 - 24°c + M CLOUD Bluetooth KIT UNICO WI-FI Code B1015 Additional kit compatible on the entire Unico range (see compatibility table) EASY INSTALLATION First installation facilitated via Bluetooth connection; this allows to save time and makes installation independent from the Wi-Fi. DUAL MANAGEMENT Possibility of managing the terminal in both bluetooth mode and in Wi-Fi mode. Bluetooth is recommended especially for the homes where there is no Wi-Fi network. (second homes for example). CLOUD Remote connection (away from home) via Cloud (3G or 4G smartphone network). e connection with Cloud does not require configuration of the router. DOWNLOAD OUR APP OLIMPIA SPLENDID UNICO e new Olimpia Splendid application to control and set your Unico locally or in remote mode. Available for Download on Apple Store and Google Play 110 HYDRONIC SYSTEMS AIR CONDITIONING Indietro 9 41 AM Lunedì 100% Modifica LMMG V S D Annulla 0:00 3:00 6:00 9:00 12:00 15:00 18:00 21:00 24:00 Fascia 1 Fascia 1 9 41 AM Modifica Lunedì 100% Salva ON 13:00 OFF 15:00 Fascia 2 ON 15:00 AUTO OFF 21:00 TEMP 24° ON 18:00 OFF 23:00 - - Fascia 2 AUTO 24° TEMP. COPIA PROGRAMMAZIONE ON 18:00 OFF 23:00 AUTO - - TEMP. FEATURES KIT UNICO WIFI (B1015): - Simple installation, to be performed only by qualified staff APP UNICO WIFI: - Available for iPhone, iPad, iPod with IOS 9.0 Operating System or later versions - Available for Android smartphones with Android 4.4 Operating System or later versions - Possibility of managing air conditioners via Wi-Fi and bluetooth - Management of air conditions also when away from home - Free access to the app without any identification needed - e password associated to the specific kit is required to add the air conditioner to the app. - Association of the air conditioner to the app via Bluetooth connection - All modes can be set: Heating, Cooling, Dehumidification, ventilation only, automatic - "Special" functions can be set: Vertical swing - Environment temperature display - Weekly timer with 2 time periods. Programming with different time, method and set point for each period for every day - Machine alarms display on the home-page of the individual air conditioner and recording in the log - Available in Italian, English, French, Spanish and German Special functions: - Verification of the strength of the Wi-Fi signal detected by the board - Service: for display/modification of the machine variables and parameters - Guide: direct access to Help in language set - Presence contact management: air conditioner disabled if the contact is opened and re-enabled on closure. - e air conditioners installed are linked to the individual app on the telephone: if the telephone is changed, all the air conditioners must be re-installed Casa 01 - 24°c + A Casa 01 - 19°c + A Casa 01 M Temperatura ambiente: 21°C Casa 01 M Temperatura ambiente: 21°C Casa 01 AUTO M Temperatura ambiente: 21°C Air conditioning Function Heating Function Dehumidification Function Ventilation Only Function AUTO Automatic Function AIR TREATMENT HEATING MODELS COMPATIBILITY TABLE Unico Smart 10 SF/HP Unico Smart 12 SF/HP Unico Inverter 9 SF/HP Unico Inverter 12 SF/HP Unico Pro Inverter 12 HP A+ Unico Pro Inverter 14 HP Unico Air 8 SF/HP Unico Air Inverter 8 SF/HP Unico Air Inverter 10 HP KIT UNICO WI-FI x x x x x x x x x Unico Air recessed 8 SF/HP Unico Air Inverter recessed 8 SF/HP Unico Air Inverter recessed 10 HP Unico R Unico Tower Inverter 12 HP Unico Easy SF/HP Unico Twin Unico Boiler KIT UNICO WI-FI x x x x x - 111 UNICO® AIR e thinnest and quietest air-conditioner without outdoor unit ever. UNICO AIR 8 SF Cod. 01503 UNICO AIR 8 HP Cod. 01504 Unico Air is the winner of GOOD DESIGN AWARD. Founded in Chicago in 1950, GOOD DESIGN is the oldest internationally recognized competition for design excellence. Design by Sara Ferrari REDUCED GRIDS Ø 16 CM FEATURES Capacity: 1.8 kW Available in versions: SF (Cooling only) - HP (Heat Pump) Double Class Refrigerant gas R410A** Installation versatility: top or bottom wall Easy installation: Unico can be installed from the inside in a few minutes Wireless wall control (Optional) Large flap for homogeneous air diffusion in the room Multifunction remote control 24 hour Timer FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. SILENT SYSTEM Up to 10% quieter at minimum speed. Sound pressure only 27 dB (A) * SLIM DESIGN All Unico's technology in just 16 cm thickness. PURE SYSTEM 2 A multi filtering system that combines an electrostatic filter(which eliminates small particles such as smoke, dust, pollen and pet hair, helping to prevent allergic reactions) with an activated carbon filter ( which eliminates bad odors and inactivates any harmful gas). A B UNICO AIR C A B C Weight kg HEAT PUMP mm 978 164 491 37 Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. * Measurement in semi anechoic chamber at a distance of 2m away fan only ** Hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 112 HYDRONIC SYSTEMS AIR CONDITIONING Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) kW kW P rated kW P rated kW PEER kW A PCOP kW A EERd COPd PTO PSB QDD kWh/h QDD kWh/h V-F-Hz V kW A kW A kW A l/h m³/h m³/h m³/h m³/h m³/h mm m / ° mm mm Kg Kg dB(A) LWA dB(A) Type GWP kgCO2 eq. kg MPa UNICO AIR 8 SF 01503 1,8 0,7 3,1 2,6 - 14,0 0,5 0,7 230-1-50 198 / 264 0,6 215/180/150 380 3 1 162 8 / ±80° 978 x 491 x 164 1060 x 595 x 250 37 41 27-38 53 IP 20 R410A 2088 0,48 3,70 3 x 1,5 UNICO AIR 8 HP 01504 1,8 1,7 0,7 3,1 0,5 2,5 2,6 3,1 14,0 0,5 0,7 0,5 230-1-50 198 / 264 0,6 215/180/150 215/180/150 380 380 3 1 162 8 / ±80° 978 x 491 x 164 1060 x 595 x 250 37 41 27-38 53 IP 20 R410A 2088 0,48 3,70 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 AIR TREATMENT HEATING 113 UNICO® AIR inverter e thinnest and quietest air-conditioner whitout outdoor unit. Today, inverter. UNICO AIR INVERTER 8 SF Cod. 01601 UNICO AIR INVERTER 8 HP Cod. 01600 UNICO AIR INVERTER 10 HP Cod. 01802 Unico AIR Inverter® is the winner of GOOD DESIGN AWARD 2016. Founded in Chicago in 1950, GOOD DESIGN is the oldest internationally recognized competition for design excellence. FEATURES Two capacity versions Max: 2,16 kW and 2,75 kW Available in versions: SF (Cooling only) - HP (Heat Pump) Double class Refrigerant gas R410A** Installation versatility: top or bottom wall Easy installation: Unico can be installed from the inside in a few minutes Wireless wall control (Optional) Large flap for homogeneous air diffusion in the room Multifunction remote control 24 hour Timer Design by Sara Ferrari REDUCED GRIDS Ø 16 CM FUNCTIONS Economy mode: allows energy saving by automatically optimizing the machine's performance Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. OLIMPIA SPLENDID'S INVERTER SYSTEM 100% 80% 70% SILENT SYSTEM Up to 10% quieter at minimum speed. Sound pressure only 27 dB (A) * SLIM DESIGN All Unico technology in just 16 cm thickness. NON INVERTER AC INVERTER DC INVERTER A SAVINGS 30% HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. B PURE SYSTEM 2 A multi filtering system that combines an electrostatic filter (which eliminates small particles such as smoke, dust, pollen and pet hair, helping to prevent allergic reactions) with an activated carbon filter ( which eliminates bad odors and inactivates any harmful gas). UNICO AIR INVERTER C A B C Weight kg mm 978 160 491 37 * Measurement in semi anechoic chamber at a distance of 2m away fan only ** Hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 114 HYDRONIC SYSTEMS AIR CONDITIONING Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) UNICO AIR INVERTER 8 SF kW kW P rated kW P rated kW PEER kW A PCOP kW A EERd COPd 01601 1,2/2,16 1,8 0,7 3,1 2,6 - - PTO 12,0 PSB 0,5 QDD kWh/h 0,7 QDD kWh/h - V-F-Hz 230-1-50 V 198 / 264 kW 0,4-0,76 A 1,8-4,1 kW - A - kW - A - l/h 0,6 m³/h 235/180/150 m³/h - m³/h - m³/h 380 / 190 m³/h - 3 2 mm 162 - m / ° 8 / ±80° mm 978 x 491 x 164 mm 1060 x 595 x 250 Kg 37 Kg 41 dB(A) 27-38 LWA dB(A) 53 IP 20 Type R410A GWP kgCO2 eq. 2088 kg 0,37 MPa 4,20 3 x 1,5 UNICO AIR INVERTER 8 HP 01600 1,2/2,16 1,1/2,04 1,8 1,7 0,7 3,1 0,5 2,5 2,6 3,1 12,0 0,5 0,7 0,5 230-1-50 198 / 264 0,4-0,76 1,8-4,1 0,3-0,75 1,5-3,65 0,6 235/180/150 235/180/150 380 / 190 380 / 190 3 2 162 8 / ±80° 978 x 491 x 164 1060 x 595 x 250 37 41 27-38 53 IP 20 R410A 2088 0,37 4,20 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 UNICO AIR INVERTER 10 HP 01802 1,2/2,75 1,1/2,40 2,3 2,0 0,9 3,9 0,6 2,9 2,6 3,1 12,0 0,5 0,9 0,6 230-1-50 198 / 264 0,4-0,91 1,8-4,1 0,3-0,79 1,5-3,65 0,8 235/180/150 190/170/150 380 / 190 380 / 190 3 2 162 8 / ±80° 978 x 500 x 164 1060 x 595 x 250 39 43 27-38 54 IP20 R410A 2088 0,36 4,20 3 x 1,5 AIR TREATMENT HEATING 115 UNICO® AIR recessed e recessed air-conditioner without outdoor unit. UNICO AIR 8 SF Cod. 01503 UNICO AIR 8 HP Cod. 01504 RECESSED PANEL Cod. B0776 FORMWORK KIT FOR RECESSED Cod. B0775 Design by Sara Ferrari REDUCED GRIDS Ø 16 CM FEATURES Capacity: 1,8 kW Available in versions: SF (Cooling only) - HP (Heat Pump) Double class Refrigerant gas R410A** Installation versatility: top or bottom wall Easy installation: Unico can be installed from the inside in a few minutes Wireless wall control (Optional) Large flap for homogeneous air diffusion in the room Multifunction remote control 24 hour Timer FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. SILENT SYSTEM Up to 10% quieter at minimum speed. Sound pressure only 27 dB (A) * HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. PURE SYSTEM 2 A multi filtering system that combines an electrostatic filter(which eliminates small particles such as smoke, dust, pollen and pet hair, helping to prevent allergic reactions) with an activated carbon filter ( which eliminates bad odors and inactivates any harmful gas). SLIM DESIGN All Unico's technology in just 16 cm inside thickness and just 9mm thickness of the outside frame. A B RECESSED PANEL A B C mm 1173 9 754 A B C C FORMWORK RECESSED A B C mm 1114 171 725 * Measurement in semi anechoic chamber at a distance of 2m away fan only ** Hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 116 HYDRONIC SYSTEMS AIR CONDITIONING Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling External air flow rate in heating Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) kW kW P rated kW P rated kW PEER kW A PCOP kW A EERd COPd PTO PSB QDD kWh/h QDD kWh/h V-F-Hz V kW A kW A kW A l/h m³/h m³/h m³/h m³/h m³/h mm m / ° mm mm Kg Kg dB(A) LWA dB(A) Type GWP kgCO2 eq. kg MPa UNICO AIR 8 SF 01503 1,8 0,7 3,1 2,6 - 14,0 0,5 0,7 230-1-50 198 / 264 0,6 215/180/150 380 3 1 162 8 / ±80° 978 x 491 x 164 1060 x 595 x 250 37 41 27-38 53 IP 20 R410A 2088 0,48 3,70 3 x 1,5 UNICO AIR 8 HP 01504 1,8 1,7 0,7 3,1 0,5 2,5 2,6 3,1 14,00,5 0,7 0,5 230-1-50 198 / 264 0,6 215/180/150 215/180/150 380 380 3 1 162 8 / ±80° 978 x 491 x 164 1060 x 595 x 250 37 41 27-38 53 IP 20 R410A 2088 0,48 3,70 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 AIR TREATMENT HEATING 117 UNICO® AIR inverter recessed e recessed air-conditioner without outdoor unit. Today, inverter. UNICO AIR INVERTER 8 SF UNICO AIR INVERTER 8 HP UNICO AIR INVERTER 10 HP RECESSED PANEL FORMWORK KIT FOR RECESSED Cod. 01601 Cod. 01600 Cod. 01802 Cod. B0776 Cod. B0775 FEATURES Two capacity versions Max: 2,16 kW and 2,75 kW Available in versions: SF (Cooling only) - HP (Heat Pump) Double class Refrigerant gas R410A** Installation versatility: top or bottom wall Easy installation: Unico can be installed from the inside in a few minutes Wireless wall control (Optional) Large flap for homogeneous air diffusion in the room Multifunction remote control 24 hour Timer Design by Sara Ferrari REDUCED GRIDS Ø 16 CM FUNCTIONS Economy mode: allows energy saving by automatically optimizing the machine's performance Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. OLIMPIA SPLENDID'S INVERTER SYSTEM 100% 80% 70% HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. PURE SYSTEM 2 A multi filtering system that combines an electrostatic filter(which eliminates small particles such as smoke, dust, pollen and pet hair, helping to prevent allergic reactions) with an activated carbon filter ( which eliminates bad odors and inactivates any harmful gas). SAVINGS 30% NON INVERTER AC INVERTER DC INVERTER A C SILENT SYSTEM Up to 10% quieter at minimum speed. Sound pressure only 27 dB (A) * B RECESSED PANEL A B C mm 1173 9 754 SLIM DESIGN All Unico's technology in just 16 cm inside thickness and just 9mm thickness of the outside frame. A B FORMWORK RECESSED A B C mm 1114 171 725 C * Measurement in semi anechoic chamber at a distance of 2m away fan only ** Hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 118 HYDRONIC SYSTEMS AIR CONDITIONING Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) kW kW P rated kW P rated kW PEER kW A PCOP kW A EERd COPd UNICO AIR INVERTER 8 SF 01601 1,2/2,16 1,8 0,7 3,1 2,6 - - PTO 12,0 PSB 0,5 QDD kWh/h 0,7 QDD kWh/h - V-F-Hz 230-1-50 V 198 / 264 kW 0,4-0,76 A 1,8-4,1 kW - A - kW - A - l/h 0,6 m³/h 235/180/150 m³/h - m³/h - m³/h 380 m³/h - 3 1 mm 162 - m / ° 8 / ±80° mm 978 x 491 x 164 mm 1060 x 595 x 250 Kg 37 Kg 41 dB(A) 27-38 LWA dB(A) 53 IP 20 Type R410A GWP kgCO2 eq. 2088 kg 0,48 MPa 3,70 3 x 1,5 UNICO AIR INVERTER 8 HP 01600 1,2/2,16 1,1/2,04 1,8 1,7 0,7 3,1 0,5 2,5 2,6 3,1 12,0 0,5 0,7 0,5 230-1-50 198 / 264 0,4-0,76 1,8-4,1 0,3-0,75 1,5-3,65 0,6 235/180/150 235/180/150 380 380 3 1 162 8 / ±80° 978 x 491 x 164 1060 x 595 x 250 37 41 27-38 53 IP 20 R410A 2088 0,48 3,70 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 UNICO AIR INVERTER 10 HP 01802 1,2/2,75 1,1/2,40 2,3 2,0 0,9 3,9 0,6 2,9 2,6 3,1 12,0 0,5 0,9 0,6 230-1-50 198 / 264 0,4-0,91 1,8-4,1 0,3-0,79 1,5-3,65 0,8 235/180/150 190/170/150 380 / 190 380 / 190 3 2 162 8 / ±80° 978 x 500 x 164 1060 x 595 x 250 39 43 27-38 54 IP20 R410A 2088 0,36 4,20 3 x 1,5 AIR TREATMENT HEATING 119 UNICO® SMART Up to 2,7 kW capacity. Designed for the air-conditioning of large spaces. UNICO SMART 10 SF Cod. 01491 UNICO SMART 10 HP Cod. 01492 UNICO SMART 12 SF Cod. 01493 UNICO SMART 12 HP Cod. 01494 Design by King e Miranda FEATURES Two capacity versions: 2,3 kW - 2,7 kW Available in versions: SF (Cooling only) - HP (Heat Pump) Double class Refrigerant gas R410A* Installation versatility: top or bottom wall Easy installation: Unico can be installed from the inside in a few minutes Wireless wall control (Optional) Multifunction remote control 24 hour Timer FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. (only in HP version) PURE SYSTEM 2 A multi filtering system that combines an electrostatic filter(which eliminates small particles such as smoke, dust, pollen and pet hair, helping to prevent allergic reactions) with an activated carbon filter ( which eliminates bad odors and inactivates any harmful gas). SUPER COLD In version number 12 Unico Smart's cooling capacity can reach up to 2.7 kW. A B UNICO SMART A B C Weight kg mm 902 230 516 40 C * Hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 120 HYDRONIC SYSTEMS AIR CONDITIONING Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) P rated P rated PEER PCOP EERd COPd PTO PSB QDD QDD LWA GWP kW kW kW kW kW A kW A kWh/h kWh/h V-F-Hz V kW A kW A kW A l/h m³/h m³/h m³/h m³/h m³/h mm m / ° mm mm Kg Kg dB(A) dB(A) Type kgCO2 eq. kg MPa UNICO SMART 10 SF 01491 2,3 0,9 3,7 2,6 - 14,0 0,5 0,9 230-1-50 198 / 264 0,9 490 / 430 / 360 520 / 350 3 3 162 / 202 8 / ±80° 902 x 516 x 229 980 x 610 x 350 40 44 33-41 56 IP 20 R410A 2088 0,48 3,6 3 x 1,5 UNICO SMART 10 HP 01492 2,3 2,3 0,9 3,7 0,7 3,0 2,6 3,1 14,0 0,5 0,9 0,7 230-1-50 198 / 264 1,1 490 / 430 / 360 410 / 350 / 270 520 / 350 520 / 350 3 3 162 / 202 8 / ±80° 902 x 516 x 229 980 x 610 x 350 40 44 33-41 56 IP 20 R410A 2088 0,54 3,6 3 x 1,5 UNICO SMART 12 SF 01493 2,7 1,0 4,3 2,6 - 14,0 0,5 1,0 230-1-50 198 / 264 0,9 490 / 430 / 360 520 / 350 3 3 162 / 202 8 / ±80° 902 x 516 x 229 980 x 610 x 350 40 44 33-42 57 IP 20 R410A 2088 0,65 3,6 3 x 1,5 UNICO SMART 12 HP 01494 2,7 2,5 1,0 4,3 0,8 3,3 2,6 3,1 14,0 0,5 1,0 0,80 230-1-50 198 / 264 1,1 490 / 430 / 360 450 / 400 / 330 500 / 340 500 / 340 3 3 162 / 202 8 / ±80° 902 x 516 x 229 980 x 610 x 350 40 44 33-42 57 IP 20 R410A 2088 0,55 3,6 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 AIR TREATMENT HEATING 121 UNICO® inverter e first air-conditioner without outdoor unit with inverter technology. UNICO INVERTER 9 SF Cod. 01068 UNICO INVERTER 9 HP Cod. 01060 UNICO INVERTER 12 SF Cod. 01067 UNICO INVERTER 12 HP Cod. 01052 UNICO INVERTER 13 A+ HP Cod. 01716 Design by King e Miranda FEATURES Two capacity versions Max: 2,16 kW and 2,75 kW Available in versions: SF (Cooling only) - HP (Heat Pump) Double class Refrigerant gas R410A* Installation versatility: top or bottom wall Easy installation: Unico can be installed from the inside in a few minutes Wireless wall control (Optional) Large flap for homogeneous air diffusion in the room Multifunction remote control 24 hour Timer FUNCTIONS Economy mode: allows energy saving by automatically optimizing the machine's performance Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. INVERTER SYSTEM anks to inverter technology, Unico saves up to 30% of energy as compared with motors with traditional technology. 100% 80% 70% NON INVERTER AC INVERTER DC INVERTER A HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. PURE SYSTEM 2 A multi filtering system that combines an electrostatic filter(which eliminates small particles such as smoke, dust, pollen and pet hair, helping to prevent allergic reactions) with an activated carbon filter ( which eliminates bad odors and inactivates any harmful gas). B DUAL INVERTER MODE (D.I.M.) e DIM technological heart is located in an innovative control algorithm to optimize the efficiency when the unit works at 70% of its ambient thermal demand e algorithm allows to satisfy the real thermal demand on the 70% of the total working hours with a reduced consumption of 25% of our traditional UNICO INVERTER.** Cooling Nominal capacity hours 14.00 SAVINGS 30% THERMAL LOAD (kW) C UNICO INVERTER A B C Weight kg mm 902 230 506 39 * Hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 ** Internal laboratory tests on traditional Olimpia Splendid range 122 hours 10.00 DAY TIME hours 18.00 HYDRONIC SYSTEMS AIR CONDITIONING OUT OF STOCK OUT OF STOCK OUT OF STOCK Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) P rated P rated PEER PCOP EERd COPd PTO PSB QDD QDD LWA GWP kW kW kW kW kW A kW A kWh/h kWh/h V-F-Hz V kW A kW A kW A l/h m³/h m³/h m³/h m³/h m³/h mm m / ° mm mm Kg Kg dB(A) dB(A) Type kgCO2 eq. kg MPa UNICO INVERTER 9 SF 01068 1,4 / 2,75 2,3 0,9 3,9 2,7 - 12,0 0,5 0,9 230-1-50 198 / 264 0,46-1,30 2,1-5,8 1,0 490 / 430 / 360 520/350 3 6 202* 8 / ±80° 902 x 506 x 229 980 x 610 x 350 39 43 33-42 57 IP 20 R410A 2088 0,57 3,6 3 x 1,5 UNICO INVERTER 9 HP 01060 1,4 / 2,75 1,4 / 2,9 2,3 2,4 0,9 3,9 0,8 3,4 2,7 3,2 12,0 0,5 0,9 0,8 230-1-50 198 / 264 0,46-1,30 2,1-5,8 0,42-1,2 1,9-5,3 1,0 490 / 430 / 360 490 / 430 / 360 520/350 520 / 350 3 6 202* 8 / ±80° 902 x 506 x 229 980 x 610 x 350 39 43 33-42 57 IP 20 R410A 2088 0,57 3,6 3 x 1,5 UNICO INVERTER 12 SF 01067 1,8 / 3,25 2,7 1,0 4,6 2,7 - 12,0 0,5 1,0 230-1-50 198 / 264 0,58-1,40 2,7-6,4 1,1 490 / 430 / 360 520/350 3 6 202* 8 / ±80° 902 x 506 x 229 980 x 610 x 350 39 43 33-43 58 IP 20 R410A 2088 0,57 3,6 3 x 1,5 UNICO INVERTER 12 HP 01052 1,8 / 3,25 1,8 / 3,25 2,7 2,7 1,0 4,6 0,8 3,8 2,7 3,2 12,0 0,5 1,0 0,8 230-1-50 198 / 264 0,58-1,40 2,7-6,4 0,53-1,30 2,4-5,9 1,1 490 / 430 / 360 490 / 430 / 360 500/340 500 / 340 3 6 202* 8 / ±80° 902 x 506 x 229 980 x 610 x 350 40 43 33-43 58 IP 20 R410A 2088 0,58 3,6 3 x 1,5 UNICO INVERTER 13 A+ HP 01716 1,8 / 3,15 1,8 / 3,05 2,0 2,7 0,6 2,8 0,8 3,8 3,1 3,2 12 0,5 0,9 0,8 230-1-50 198 / 264 2,4-6,1 0,53-1,30 2,4-5,9 1,1 490 / 430 / 360 490 / 430 / 360 500/340 500/340 3 1 202 8 / ±80° 902 x 506 x 229 980 x 610 x 350 39 42 33-43 58 IP 20 R410A 2088 0,50 3,6 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 AIR TREATMENT HEATING 123 NEWUNICO® PRO inverter 12 HP A+ e most efficient ever air conditioner without external unit. UNICO PRO INVERTER 12 HP A+ Cod. 01866 Design by Matteo un & Antonio Rodriguez CLOUD Bluetooth Two methods of connection and all the security of the cloud by Olimpia Splendid FEATURES Max capacity: 3,4 kW Available in versions: HP (Heat Pump) Class Refrigerant gas R410A* Installation versatility: top or bottom wall Easy installation: Unico can be installed from the inside in a few minutes Wireless wall control (Optional) Large flap for homogeneous air diffusion in the room Backlight display with on-board touch controls Multifunctional remote control with LCD STANDARD display 24 hour Timer FUNCTIONS Economy mode: allows energy saving by automatically optimizing the machine's performance Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Silent Mode: New function to set the machine at minimum noise level. NEW INVERTER PRO Olimpia Splendid Powerful, versatile and efficient thanks to a wide range of frequencies available and electronic management of the expansion valve SILENT MODE All the silence you want using the "silent mode" function. A true "orchestra conductor" who skilfully conducts or co-ordinates the inverter compressor (INVERTER PRO) and the ventilated sections (V PRO) for maximum acoustic comfort up to - 10dB(A)**. All of this enclosed in a beautiful body and lined with state-of-theart sound-absorbing material. FULL INVERTER DC FAN All of the fan are inverter DC and u e a new urface de ign (V PRO). ey are de igned to guarantee reduced con umption and ilence in all condition of u e. HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. HIGH EFFICIENCY TECHNOLOGY Class A+ in cooling. DESIGNED AND MADE IN ITALY Designed by Matteo un & Antonio Rodriguez to perfectly fit every domestic environment. A B REMOTE CONTROL "Full digital" remote control, C thanks to which functions such as "dehumidification", UNICO PRO INVERTER 12 HP A+ "silent mode", "sleep" and A B C Weight kg "ventilation only" can be mm 903 215 520 39 activated. * Hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 **Sound power 124 HYDRONIC SYSTEMS AIR CONDITIONING Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Silent mode cooling capacity Silent mode heating capacity Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Silent Mode sound pressure level Silent Mode sound power level Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) P rated P rated PEER PCOP EERd COPd PTO PSB QDD QDD LWA LWA GWP kW kW kW kW kW A kW A kWh/h kWh/h kW kW V-F-Hz V kW A kW A kW A l/h m³/h m³/h m³/h m³/h m³/h mm m / ° mm mm Kg Kg dB(A) dB(A) dB(A) dB(A) Type kgCO2 eq. kg MPa UNICO PRO INVERTER 12HP A+ 01866 1,7 / 3,4 1,5 / 3,0 2,2 2,4 0,7 3,1 0,8 3,4 3,1 3,1 22 0,5 0,7 0,8 1,7 1,5 230-1-50 198 / 264 0,8-1,7 3,5-7,5 0,8-1,7 3,1-6,2 1,3 490 / 390 / 350 490 / 390 / 350 600 / 120 600 / 120 3 6 162 / 202 8 / ±80° 903 x 520 x 215 980 x 610 x 330 39 42 32-43 57 34 49 IP20 R410A 2088 0,58 4,20 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 AIR TREATMENT HEATING 125 NEWUNICO® PRO inverter 14 HP e most powerful ever air conditioner without external unit. UNICO PRO INVERTER 14 HP Cod. 01868 Design by Matteo un & Antonio Rodriguez CLOUD Bluetooth Two methods of connection and all the security of the cloud by Olimpia Splendid FEATURES Capacity: up to 3,5 kW Available in versions: HP (Heat Pump) Class Refrigerant gas R410A* Installation versatility: top or bottom wall Easy installation: Unico can be installed from the inside in a few minutes Wireless wall control (Optional) Large flap for homogeneous air diffusion in the room Backlight display with on-board touch controls Multifunctional remote control with LCD STANDARD display 24 hour Timer FUNCTIONS Economy mode: allows energy saving by automatically optimizing the machine's performance Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Silent Mode: New function to set the machine at minimum noise level. NEW INVERTER PRO Olimpia Splendid Powerful, versatile and efficient thanks to a wide range of frequencies available and electronic management of the expansion valve SILENT MODE All the silence you want using the "silent mode" function. A true "orchestra conductor" who skilfully conducts or co-ordinates the inverter compressor (INVERTER PRO) and the ventilated sections (V PRO) for maximum acoustic comfort up to - 10dB(A)**. All of this enclosed in a beautiful body and lined with state-of-theart sound-absorbing material. FULL INVERTER DC FAN All of the fan are inverter DC and u e a new urface de ign (V PRO). ey are de igned to guarantee reduced con umption and ilence in all condition of u e. HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. PRO POWER Super cooling power up to 3,5 kW. DESIGNED AND MADE IN ITALY Designed by Matteo un & Antonio Rodriguez to perfectly fit every domestic environment. A B REMOTE CONTROL C "Full digital" remote control, thanks to which functions such as "dehumidification", UNICO PRO INVERTER 14 HP "silent mode", "sleep" and A B C Weight kg "ventilation only" can be mm 903 215 520 39 activated. * Hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 **Sound power 126 HYDRONIC SYSTEMS AIR CONDITIONING Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Silent mode cooling capacity Silent mode heating capacity Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Silent Mode sound pressure level Silent Mode sound power level Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) P rated P rated PEER PCOP EERd COPd PTO PSB QDD QDD LWA LWA GWP kW kW kW kW kW A kW A kWh/h kWh/h kW kW V-F-Hz V kW A kW A kW A l/h m³/h m³/h m³/h m³/h m³/h mm m / ° mm mm Kg Kg dB(A) dB(A) dB(A) dB(A) Tipo-Type kgCO2 eq. kg MPa UNICO PRO INVERTER 14HP 01868 1,7 / 3,5 1,5 / 3,15 2,9 2,6 1,1 4,9 0,8 3,7 2,6 3,1 22 0,5 1,1 0,8 1,7 1,5 230-1-50 198 / 264 0,8-1,7 3,5-7,5 0,7-1,4 3,1-6,2 1,4 490 / 390 / 350 490 / 390 / 350 600 / 120 600 / 120 3 6 162 / 202 8 / ±80° 903 x 520 x 215 980 x 610 x 330 39 42 32-43 59 34 49 IP20 R410A 2088 0,58 4,20 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 AIR TREATMENT HEATING 127 NEWUNICO® TOWER inverter 12 HP e air conditioning without outdoor unit in only 470 mm of width and 185 mm deep UNICO TOWER INVERTER 12 HP Cod. 01924 FEATURES Available from May Capacity: up to 2,95 kW Available in versions: HP (Heat Pump) Class Refrigerant gas R410A* Bottom installation Easy installation: Unico can be installed from the inside in a few minutes Wireless wall control (Optional) Large flap for homogeneous air diffusion in the room Backlight display with on-board touch controls Multifunctional remote control with LCD STANDARD display 24 hour Timer FUNCTIONS Economy mode: allows energy saving by automatically optimizing the machine's performance Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Silent Mode: New function to set the machine at minimum noise level. A 128 HEAT PUMP LARGE FLAP Heat pump air conditioner. anks to this Motorized superior Flap for homogeneus air diffu- B feature you can replace traditional heating in sion. intermediate seasons or support it. DESIGNED AND MADE IN ITALY INVERTER SYSTEM by OLIMPIA SPLENDID Designed by Matteo un & Antonio Rodriguez to perfectly fit every domestic environment. C SILENT MODE All the silence you want using the "silent mode" function. UNICO TOWER INVERTER 12 HP A B C Weight kg mm 470 185 1390 - REMOTE CONTROL "Full digital" remote control, thanks to which functions such as "dehumidification", "silent mode", "sleep" and "ventilation only" can be activated. HYDRONIC SYSTEMS AIR CONDITIONING Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Silent mode cooling capacity Silent mode heating capacity Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Silent Mode sound pressure level Silent Mode sound power level Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) P rated P rated PEER PCOP EERd COPd PTO PSB QDD QDD LWA LWA GWP kW kW kW kW kW A kW A kWh/h kWh/h kW kW V-F-Hz V kW A kW A kW A l/h m³/h m³/h m³/h m³/h m³/h mm m / ° mm mm Kg Kg dB(A) dB(A) dB(A) Tipo kgCO2 eq. kg MPa UNICO TOWER INVERTER 12 HP 01924 1,45 / 2,95 1,45 / 3,10 2,45 2,55 0,9 0,8 2,6 3,1 0,9 0,8 1,35 1,40 230-1-50 198 / 264 260 / - / 260 / - / 486 / 486 / 3 6 162 8 / ±80° 470 x 1390 x 185 54 27-40 57 31 44 IP20 R410A 2088 0,55 4,20 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 AIR TREATMENT HEATING 129 UNICO® twin MASTER Cod. 01273 WALL Cod. 01274 e system without outdoor unit to air condition two rooms at the same time. Two inside units, the traditional UNICO unit and the UNICO WALL unit, are connected by a refrigerating circuit. Design by King e Miranda Unico Twin® is the winner of GOOD DESIGN AWARD 2013. Founded in Chicago in 1950, GOOD DESIGN is the oldest internationally recognized competition for design excellence. FEATURES of the system Independent or combined mode: if you choose simultaneous mode the two units share the power available * Available in versions: HP (Heat pump) Duble class Refrigerant gas R410A** Multifunction double remote control 24h Timer FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. MASTER features Cooling capacity: 2.6 kW HP mode capacity (heat pump): 2.5 kW Installation versatility: top or bottom wall installation Possible glass installation* Easy installation: Unico Twin can be installed from the inside in a few minutes Large flap for a homogeneous diffusion of the air in the environment wall FEATURES Cooling capacity: 2.5 kW HP mode capacity (heat pump): 2.2 kW Maximum silence: up to 25% quieter than the master unit TWIN TECHNOLOGY anks to TWIN® technology double room conditioning is performed in total aesthetic integration with the building, with a considerable simplification of design. Twin® technology allows the use of the two units (Master unit and Wall unit) simultaneously or separately depending on requirements, both in heating and cooling mode. HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. PURE SYSTEM 2 A multi filtering system that combines an electrostatic filter(which eliminates small particles such as smoke, dust, pollen and pet hair, helping to prevent allergic reactions) with an activated carbon filter ( which eliminates bad odors and inactivates any harmful gas). Installation note By maintaining the same center to center distance of inlet and outlet holes, Unique Twin Master can easily substitute previously installed Unico models. * During simultaneous operation the inside units are forced at minimum speed. ** Not ermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 130 HYDRONIC SYSTEMS AIR CONDITIONING UNICO TWIN MASTER Product code Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling function Energy consumption for double pipe appliances (1) heating function Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Dimensions (Larg. x Alt. x Prof.) (without packaging) Weight (without packaging) Internal sound power level (EN 12102) Internal sound pressure (Min Max) (2) Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Power cable (N° pole x section mm2) Pnom. kW Pnom. kW PEER kW A PCOP kW A EERd COPd 01273 2,6 2,5 0,9 4,3 0,8 3,5 2,7 3,1 PTO W PSB W QDD kWh/h QDD kWh/h V-F-Hz V W A W A l/h m³/h m³/h m³/h m³/h mm mm Kg LWA dB(A) dB(A) Type GWP kgCO2 eq. kg 14,0 0,5 0,9 0,8 230-1-50 198 / 264 1200 5,4 1080 4,8 1,1 490 / 430 / 360 450 / 400 / 330 500 / 370 / 340 500 / 370 / 340 3 3 202* 902 x 516 x 229 40,5 57 33-42 IP 20 R410A 2088 0,85 3 x 1,5 Indoor Ambient Tempera- ture Outdoor Ambient Tempera- ture LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C Performance and optimal operation are guaranteed with units operating alternately. In simultaneous operation ambient air fan speed works at minimum speed. Performance is measured by gas piping at a length of 5 m. (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * Not ermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 UNICO TWIN WALL Product code 01274 Nominal cooling capacity (1) kW 2,5 Nominal heating capacity (1) kW 2,2 Nominal power consumption for heating (1) kW 0,9 Nominal absorption for cooling (1) A 4,2 Nominal power consumption for heating (1) kW 0,7 Nominal absorption for heating (1) A 3,2 Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Internal ventilation speed Dimensions (Larg. x Alt. x Prof.) (without packaging) Weight (without packaging) Internal sound power level (EN 12102) W A W A l/h m³/h m³/h mm Kg dB(A) 1200 5,4 1080 4,8 1,0 450 / 400 / 340 450 / 400 / 340 3 760 x 253 x 190 8 53 Internal sound pressure (Min Max) (2) Degree of protection providedby overs Power cable (N° pole x section mm2) dB(A) 25-38 IP X1 3 x 1 Connecting liquid pipeline diameter inch - mm 1/4 - 6,35 Connecting gas pipeline diameter inch - mm 3/8 - 9,52 Maximum piping length m 10 Maximum height difference m 5 Easy installation 1 MASTER UNIT anks to the template included in the package, the MASTER unit is installed, completely from the inside and in a few minutes, with the two holes of 202 mm diameter in the first room to beair conditioned. 2 e MASTER unit is connected to the WALL unit, thanks to the gas connection on the right side of the unit. Maximum length refrigerant lines: 10 meters. 3 AIR TREATMENT HEATING WALL UNIT e WALL unit is installed on the wall of the second room to be air conditioned. 131 UNICO® easy e consolle air-conditioner without outdoor unit. UNICO EASY SF Cod. 01056 UNICO EASY HP Cod. 00981 Design by Dario Tanfoglio FEATURES Cooling capacity: 2.1 kW Available in versions: SF (Cooling only) - HP (Heat Pump) Double class Refrigerant gas R410A* Easy installation: Unico can be installed from the inside in a few minutes Removable remote control on machine 24 hour Timer FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. REDUCED GRIDS Ø 16 CM SUPPORTING LEGS Equipped with two supporting legs for a more stable positioning. REMOTE CONTROL Removable remote control for more practicality HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. A B C A mm 693 UNICO EASY B C Weight kg 284 665 43 * Hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 132 HYDRONIC SYSTEMS AIR CONDITIONING Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) kW kW P rated kW P rated kW PEER kW A PCOP kW A EERd COPd PTO PSB QDD kWh/h QDD kWh/h V-F-Hz V kW A kW A kW A l/h m³/h m³/h m³/h m³/h m³/h mm m / ° mm mm Kg Kg dB(A) LWA dB(A) Type GWP kgCO2 eq. kg MPa UNICO EASY SF 01056 2,1 0,8 3,50 2,6 - 26,0 1,0 0,8 230-1-50 196 / 253 0,88 3,9 1,0 328 / 300 / 274 - 429 / 258 3 2 162 8 / ±80° 693 x 666 x 276 768 x 806 x 374 39 43 33-42 57 IP 20 R410A 2088 0,55 3,6 3 x 1,5 UNICO EASY HP 00981 2,0 2,0 0,8 3,40 0,7 3,2 2,6 2,8 26,0 1,0 0,8 0,7 230-1-50 216 / 244 1,0 3,9 900 3,8 0,9 310 / 280 / 250 310 / 280 / 250 430 / 350 / 260 400 / 350 / 260 3 3 162 8 / ±80°693 x 666 x 276 768 x 806 x 374 39 43 33-44 59 IP21 R410A 2088 0,51 3,6 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 32°C DB 16°C - DB 43°C - WB 32°C DB 18°C - WB 16°C - (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 AIR TREATMENT HEATING 133 UNICO® R Designed for the coldest climates. UNICO 10 HP Cod. 01495 UNICO 12 HP Cod. 01496 FEATURES Two capacity versions: 2,3 kW - 2,7 kW Available in versions: HP (Heat Pump) Double class Refrigerant gas R410A * Installation versatility: top or bottom wall Easy installation: Unico can be installed from the inside in a few minutes Wireless wall control (Optional) Multifunction remote control 24 hour Timer FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. +2 KW BACKUP AUXILIARY Suitable even for the coldest temperatures. HEAT PUMP When external ambient temperatures are below 2 ° C, only the fan and the electric heaters are activated for the heating mode. For temperatures over 2 ° C, heating is obtained by means of the heat pump. e management of either mode is completely automatic. PURE SYSTEM 2 A multi filtering system that combines an electrostatic filter (which eliminates small particles such as smoke, dust, pollen and pet hair, helping to prevent allergic reactions) with an activated carbon filter ( which eliminates bad odors and inactivates any harmful gas). A B UNICO R C A B C Weight kg mm 902 230 516 40 * Hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 134 HYDRONIC SYSTEMS AIR CONDITIONING Product code Cooling power (min/max) Heating power (min/max) Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling Energy consumption for double pipe appliances (1) heating Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Maximum power consumption with electric resistance heating Maximum absorption with electric resistance heating Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) Air flow rate with electric resistance heating environment External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Electric resistance heating Maximum range remote control (distance / angle) Dimensions (Larg. x Alt. x Prof.) (without packaging) Dimensions (Larg. x Alt. x Prof.) (with packaging) Weight (without packaging) Weight (with packaging) Internal sound pressure (Min Max) (2) Internal sound power level (EN 12102) Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Maximum operating pressure Power cable (N° pole x section mm2) kW kW P rated kW P rated kW PEER kW A PCOP kW A EERd COPd UNICO R 10 HP 01495 2,3 2,3 0,9 3,70 0,7 3,0 2,6 3,1 PTO 14,0 PSB 0,5 QDD kWh/h 0,9 QDD kWh/h 0,7 V-F-Hz 230-1-50 V 198 / 264 kW 0,9 A 3,9 kW 0,9 A 3,8 kW 2,0 A 8,7 l/h 0,9 m³/h 490 / 430 / 360 m³/h 410 / 350 / 270 m³/h -490 m³/h 520 / 350 m³/h 520 / 350 3 3 mm 162/202 2000 m / ° 8 / ±80° mm 902 x 516 x 229 mm 980 x 610 x 350 Kg 40 Kg 44 dB(A) 33-41 LWA dB(A) 56 IP 20 Type R410A GWP kgCO2 eq. 2088 kg 0,65 MPa 3,6 3 x 1,5 UNICO R 12 HP 01496 2,7 2,5 1,0 4,30 0,8 3,3 2,6 3,1 14,0 0,5 1,0 0,8 230-1-50 198 / 264 1,1 4,8 1,1 4,7 2,0 8,7 1,1 490 / 430 / 360 490 / 400 / 330 -490 500 / 340 500 / 340 3 3 162/202 2000 8 / ±80° 902 x 516 x 229 980 x 610 x 350 40 44 33-42 57 IP 20 R410A 2088 0,55 3,6 3 x 1,5 Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 35°C - WB 24°C DB 18°C DB 27°C - DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. ** hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 AIR TREATMENT HEATING 135 UNICO® boiler MASTER Cod. 01422 WALL Cod. 599509A e system without external unit which simultaneously air conditions and produces domestic hot water. Inside, two units are connected by a refrigerating circuit: the UNICO unit for air conditioning and the high efficiency boiler for DHW production. HEATING + DHW Design by Olimpia Splendid THE BOILER SYSTEM Heating + Domestic hot water with shared heating output FEATURES of the system Duble class Refrigerant gas R410A* Installation versatility: top or bottom wall installation; Easy installation: Unico can be installed from the inside within a few minutes Multifunction remote control 24 hour Timer BOILER MASTER features Cooling capacity: 2.6 kW HP mode capacity (heat pump): 2.5 kW Installation versatility: top or bottom wall installation Easy installation: Unico Twin can be installed from the inside in a few minutes Large flap for a homogeneous diffusion of the air in the environment BOILER WALL features Heating times: 1h49min (43 min in TURBO** mode) Accumulation capacity: 50 l Electrical power supply: 1,2 kW FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Cooling Heating Domestic Hot Water Cooling + DHW Heating + DHW COOLING + TOTAL RECOVERY Cooling +Domestic hot water with energy recovery In summer operation the heat extracted from indoor air is transferred to the boiler for free DHW production instead of being disposed externally. * Not ermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 ** With electrical resistance inserted 136 HYDRONIC SYSTEMS AIR CONDITIONING Product code Nominal cooling capacity (1) Nominal heating capacity (1) Nominal power consumption for cooling (1) Nominal absorption for cooling (1) Nominal power consumption for heating (1) Nominal absorption for heating (1) Nominal energy efficiency index (1) Nominal efficiency coefficient (1) Energy efficiency class in cooling (1) Energy efficiency class in heating (1) Energy consumption in "thermostat off" mode Energy consumption in "standby" mode (EN 62301) Energy consumption for double pipe appliances (1) cooling function Energy consumption for double pipe appliances (1) heating function Supply voltage Supply voltage minimum/maximum Maximum power consumption in cooling mode (1) Maximum absorption in cooling mode (1) Maximum power consumption in heating mode (1) Maximum absorption in heating mode (1) Dehumidification capacity Air flow rate in cooling environment (max/med/min) Air flow rate in heating environment (max/med/min) External air flow rate in cooling (max/min) External air flow rate in heating (max/min) Internal ventilation speed External ventilation speed Diameter wall holes Dimensions (Larg. x Alt. x Prof.) (without packaging) Weight (without packaging) Internal sound power level (EN 12102) Internal sound pressure (Min Max) (2) Degree of protection provided by covers Refrigerant gas* Global warming potential Refrigerant gas charge Power cable (N° pole x section mm2) Indoor Ambient Tempera- ture Outdoor Ambient Tempera- ture LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximun temperature in SHW mode Minimum temperature in SHW mode Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximun temperature in SHW mode Minimum temperature in SHW mode Pnom. kW Pnom. kW PEER kW A PCOP kW A EERd COPd UNICO BOILER MASTER 01422 2,6 2,5 0,9 4,3 0,8 3,5 2,7 3,1 PTO W 14,0 PSB W 0,5 QDD kWh/h 0,9 QDD kWh/h 0,8 V-F-Hz 230-1-50 V 198 / 264 W 1200 A 5,4 W 1080 A 4,8 l/h 1,1 m³/h 490 / 430 / 360 m³/h 450 / 400 / 330 m³/h 500 / 370 / 340 m³/h 500 / 370 / 340 3 3 mm 202* mm 902 x 516 x 229 Kg 40,5 LWA dB(A) 57 dB(A) 33-42 IP 20 Type R410A GWP kgCO2 eq. 2088 kg 0,85 3 x 1,5 DB 35°C - WB 24°C DB 18°C DB 27°C - Water 60°C HP/ 75°C E.H. 10°C DB 43°C - WB 32°C DB -10°C DB 24°C - WB 18°C DB -15°C DB 43°C - WB 32°C DB -10°C UNICO BOILER WALL Product code 599509A Overall heating efficiency + DHW 2,3 Overall cooling efficiency + DHW 4,0 Heating time * hh:mm 01:49 Heating time BOOST mode ** hh:mm 00:43 Electrical power supply W 1200 Accumulation capacity l 50 Dimensions mm 400 x 416 x 760 Weight without water kg 25 Insulation thickness mm 30 Power cable (N° pole x section mm2) 3x1 Maximum distance master and boiler m 10 Maximum height difference master and boiler m 5 Electrical protection IPX2 Diameter water connectors " 1/2 GM Diameter refrigerant connectors " 3/8 *values obtained in accordance with regulation EN 16147 indoor air temperature 20°C, external air 7°C RH 85%,inlet water at 10°C and temperature set at 55°C ** with active electrical resistance AIR TREATMENT HEATING Performance and optimal operation are guaranteed with units operating alternately. In simultaneous operation ambient air fan speed works at minimum speed. Performance is measured by gas piping at a length of 5 m. (1) Test condition: data refers to regulation EN14511 - HEATING MODE: outdoor ambient temperature DB 7°C / WB 6°C; indoor ambient DB 20°C / WB 15°C COOLING MODE: outdoor ambient temperature DB 35°C / WB 24°C; indoor ambient DB 27°C / WB 19°C (2): Data test declaration in semianechoic room at a distance of 2m, minimum sound pressure with ventilation only. - By maintaining the same center to center distance of inlet and outlet holes and the possibility of installation with 162 mm diameter holes, models in the Unico Smart, Unico Inverter and Unico Act range may easily substitute previously installed Unico Star and Unico Sky models. * Not hermetically sealed equipment containing fluorinated gas with GWP equivalent 2088 137 138 FIXED AIR CONDITIONERS 139 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS WI-FI SPLIT KIT SPLIT WI-FI 24 KIT SPLIT WI-FI Code B1016 Additional kit on USB dongle, compatible on the entire Nexya range (see compatibility table) EASY INSTALLATION First installation facilitated; just insert the USB dongle in the relative port under the front panel. WI-FI EASY Possibility of managing the terminals in WiFi mode. e connection does not require configuration of the router. REMOTE CONNECTION Remote connection (away from home) via 3G or 4G smartphone network. DOWNLOAD OUR APP OLIMPIA SPLENDID SPLIT e new Olimpia Splendid application to control and set your Nexya locally or in remote mode. Available for Download on Apple Store and Google Play 140 HYDRONIC SYSTEMS example@example.com FEATURES KIT SPLIT WIFI (B1016): - Simple installation, no need for qualified staff APP SPLIT WIFI: - Available for iPhone, iPad, iPod with IOS 7.0 Operating System or later versions - Available for Android smartphones with Android 4.0 Operating System or later versions - Possibility of managing air conditioners via Wi-Fi - Management of air conditions also when away from home - All modes can be set: Heating, Cooling, Dehumidification, ventilation only, automatic - "Special" functions can be set: Turbo, Vertical swing, Horizontal swing, Eco - Environment temperature display - Weekly timer with on time period, fixed mode and set points - Available in Italian, English, French, Spanish, Portuguese and Greek Special functions: - Anti-freeze protection: if the environment temperature reaches 8°C, the air conditioner will activate - Sleep setting: graphics for modification of the temperature set point for every time period over 24 hours AIR CONDITIONING AIR TREATMENT 24 24 19 19 Air Conditioning Function Heating Function Timer Function MODELS COMPATIBILITY TABLE I.U. Nexya S4 E inverter 9 I.U. Nexya S4 E inverter 12 I.U. Nexya S4 E inverter 18 I.U. Nexya S4 E inverter 24 I.U. Alyas E inverter 9 I.U. Alyas E inverter 12 I.U. Nexya S4 E Duct 9 I.U. Nexya S4 E Duct 12 I.U. Nexya S4 Duct 18 I.U. Nexya S4 E Duct 18 I.U. Nexya S4 Duct 24 I.U. Nexya S4 E Duct 24 KIT SPLIT WI-FI x x x x x x - I.U. Nexya S4 E Duct 36 I.U. Nexya S4 E Duct 48 Nexya S4 E Cassette Compact 12 Nexya S4 E Cassette Compact 18 Nexya S4 E Cassette 24 Nexya S4 E Cassette 36 Nexya S4 E Cassette 48 Nexya S4 E Ceiling 18 Nexya S4 E Ceiling 24 Nexya S4 E Ceiling 36 Nexya S4 E Ceiling 48 KIT SPLIT WI-FI - 141 HEATING NEXYA® S4 E inverter FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. 24 HIGH EFFICIENCY TECHNOLOGY Class A++ in cooling Class A+ in heating HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. OLIMPIA SPLENDID'S INVERTER SYSTEM 100% 80% 70% REMOTE CONTROL With the remote control you can set the desired comfort at the desired time. R32 GAS New low environmental impact refrigerant GAS. NON INVERTER AC INVERTER DC INVERTER 142 SAVINGS 30% HYDRONIC SYSTEMS AIR CONDITIONING Output power in cooling mode (1) (min / rated / max) Output power in heating mode (2) (min / rated / max) Absorbed power in cooling mode (1) (min / rated / max) Absorbed power in heating mode (2) (min / rated / max) Current consumption in cooling mode (1) (min / rated / max) Current consumption in heating mode (2) (min / rated / max) EER (1) (rated) COP (2) (rated) Energy efficiency class in cooling mode Energy efficiency class in heating mode INTERMEDIATE SEASON Energy efficiency class in heating mode WARMER SEASON Annual energy consumption in cooling mode Annual energy consumption in heating mode INTERMEDIATE SEASON Annual energy consumption in heating mode WARMER SEASON Absorbed power in cooling mode Absorbed power in heating mode Cooling Design load Heating / Average ( EN 14825 ) Heating / Warmer Heating / Colder Seasonal efficiency (En 14825) Cooling Heating / Average Heating / Warmer Heating / Colder Sound power (EN 12102) Sound Pressure ( min / rated / max speed ) Air flow rate in cooling mode (max/med/min) INDOOR Air flow rate in heating mode(max/med/min) UNIT Ventilation speed Degree of protection Dimensions (Width x H x Depth) Weight (without packaging) Sound power (EN 12102) Sound Pressure OUTDOOR UNIT Air flow rate (max) Ventilation speed Degree of protection Dimensions (Width x H x Depth) Weight (without packaging) Dehumidification rate Diameter of tube in liquid connection line Diameter of tube in gas connection line Maximum pipe length Maximum difference in level Maximum operating pressure Refrigerant gas* Global warming potential Refrigerant gas charge NEXYA S4E INVERTER 9 NEXYA S4E INVERTER 12 NEXYA S4E INVERTER 18 NEXYA S4E INVERTER 24 OS-C/SENEH09EI OS-C/SENEH12EI OS-C/SENEH18EI OS-C/SENEH24EI kW 0.91/2.64/3.11 1.11/3.52/4.16 1.82/5.28/6.13 2.08/7.03/7.95 kW 0.82/2.93/3.37 1.08/3.37/4.22 1.38/5.57/6.74 1.61/7.33/8.79 kW 0.1/0.710/1.240 0.13/1.237/1.580 0.14/1.921/2.360 0.16/2.345/2.96 kW 0.12/0.739/1.2 0.100/0.908/1.580 0.2/1.546/2.410 0.26/2.035/3.14 A 0.4/3.1/5.4 0.5/5.37/6.9 0.6/8.4/10.3 0.7/10.2/13.3 A 0.5/3.2/5.2 0.4/4.10/6.9 0.9/6.7/10.5 1.1/10.2/13.3 3,64 3,1 3,5 2,83 3,77 3,8 3,8 3,72 kWh/year kWh/year kWh/year W W Pdesignc kW Pdesignh kW Pdesignh kW Pdesignh kW SEER SCOP ( A ) SCOP ( W ) SCOP ( C ) LWA dB(A) dB(A) m³/h m³/h giri/min mm Kg LWA dB(A) dB(A) m³/h mm Kg l/h inch - mm inch - mm m m MPa Tipo-Type GWP kgCO2 eq. Kg 153 762 758 2150 2150 2,9 2,2 2,7 6,5 4,0 4,9 3,2 53 40/30/26/21 520/460/340 520/460/340 1030 / 850 / 700 IPX0 805x285x194 7,5 61 55,5 1700 3 IP24 700x550x270 22,7 1,0 1/4" - 6,35 3/8" - 9,52 25 10 4,3/1,7 R-32 675 0,50 204 841 837 2150 2150 3,7 2,4 2,7 6,4 4,0 4,6 53 40/34/26/22 600/500/360 600/500/360 1130 / 950 / 750 IPX0 805x285x194 7,5 65 58 1700 3 IP24 700x550x270 22,8 1,0 1/4" - 6,35 3/8" - 9,52 25 10 4,3/1,7 R-32 675 0,50 261 1444 1207 2950 2950 5,3 4,2 4,5 7,1 4,1 5,3 55 44/37/30/25 840/680/540 840/680/540 1130 / 900 / 800 IPX0 957x302x213 10 61 55,5 2000 3 IP24 800x554x333 34 1 1/4" - 6,35 1/2" - 12,7 30 20 4,6/1,7 R-32 675 1,0 412 1697 1784 3850 3850 7,2 4,9 6,4 6,1 4,0 5,1 59 44,5/42/34,5/28 980/817/662 980/817/662 1150 / 1000 / 850 IPX0 1040x327x220 12,3 67 59,5 3000 3 IP24 845x702x363 51,5 1 3/8" - 9,52 5/8" - 15,9 50 25 4,3/1,7 R-32 675 1,6 Indoor Ambient Tempera- ture Outdoor Ambient Tempera- ture LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in heating Minimum temperature in heating DB 32°C - WB 26°C DB 17°C DB 27°C DB 17°C DB 43°C - WB 32°C DB -15°C DB 24°C - WB 18°C DB -15°C (1) Test condition: data refers to regulation EN14511 Data declarated according to the UE Delegate Regulation 626/2011 (2) EER/COP in agreement with the regulation (EN-14511), declared only for the purpose of the tax deductions in effect at the time of this publication. * hermetically sealed equipment containing fluorinated gas AIR TREATMENT HEATING 143 NEWNEXYA® Commercial Climatizzatori inverter ad alta efficienza energetica. Duct Cassette FEATURES Combinations Combination and installation flexibility: Duct, Cassette and Ceiling Remote ON-OFF All commercial line units have terminals for remote unit switch-on and switch-off via an external device. Alarm Contact e units of the commercial line have a contact that allows synchronisation of the product alarm condition with an external device. Hydrophilic Aluminium Coating -Suitable for installations in coastal or particularly humid areas. -Excellent Anti-Corrosion Performance: with the same environmental conditions, the new coating of the condensers guarantees their longevity to over 7 times longer compared to traditional models. Ceiling HIGH EFFICIENCY TECHNOLOGY Classe A++ in cooling Classe A+ in heating intermediate season Classe A++ / A+++ in heating warmer season OLIMPIA SPLENDID'S INVERTER SYSTEM 100% 80% 70% 144 NON INVERTER AC INVERTER DC INVERTER SAVINGS 30% HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. Outdoor unit HYDRONIC SYSTEMS AIR CONDITIONING COMMERCIAL NEXYA S3 Product code OUTDOOR UNIT Supply voltage Dimensions (L x D x H) Weight (without packaging) Dimensions (with packaging) (L x D x H) Outdoor Weight unit Air flow rate Sound Pressure (max) Sound power level Compressor Type Diameter of tube in liquid connection line Diameter of tube in gas connection line Dimensions Covered piping length from pre-load and Limitations of the Cooling Piping recommended minimum length Circuit Piping Equivalent length (max) Increase of Refrigerant Maximum difference in level Refrigerant gas Refrigerant Global warming potential fluid Refrigerant gas charge Maximum applied pressure high pressure side/low pressure side Power supply connection Electrical Indoor - Outdoor unit connection connections Max Power absorption Max Current consumption operational Outdoor temperature in cooling (Min-Max) limits Outdoor temperature in heating (Min-Max) 410A OUT OF STOCK OUT OF STOCK OUTDOOR UNIT OUTDOOR UNIT NEXYA S3 NEXYA S3 COMMERCIAL 18 COMMERCIAL 24 OS-CECEH18EI OS-CECEH24EI V / F / Hz 220-240 / 1 / 50 mm 800 x 333 x 554 kg 35,5 mm - kg - m3/h 2100 dB(A) 57 dB(A) 64 rotating mm 6,35 mm 12,7 m 5 m 3 m 30 g/m 15 m 20 R410A 2088 kg 1,48 MPa 4,2-1,5 n° conductor 2+1 n° conductor 6 W 2200 A 10 °C B.S. -15 / +43 °C B.U. -15 / +24 220-240 / 1 / 50 845 x 363 x 702 49 2700 61 65 rotating 9,52 15,9 5 3 50 30 25 R410A 2088 1,95 4,2-1,5 2+1 6 2950 14 -15 / +43 -15 / +24 COMMERCIAL NEXYA S4 E NEW NEW NEW NEW NEW OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT NEXYA S4E NEXYA S4E NEXYA S4E NEXYA S4E NEXYA S4E COMMERCIAL 18 COMMERCIAL 24 COMMERCIAL 36 COMMERCIAL 36T COMMERCIAL 48T Product code OUTDOOR UNIT Supply voltage Dimensions (L x D x H) Weight (without packaging) Dimensions (with packaging) (L x D x H) Outdoor Weight unit Air flow rate Sound Pressure (max) Sound power level Compressor Type Diameter of tube in liquid connection line Diameter of tube in gas connection line Dimensions Covered piping length from pre-load and Limitations of the Cooling Piping recommended minimum length Circuit Piping Equivalent length (max) Increase of Refrigerant Maximum difference in level Refrigerant gas Refrigerant Global warming potential fluid Refrigerant gas charge Maximum applied pressure high pressure side/low pressure side Power supply connection Electrical Indoor - Outdoor unit connection connections Max Power absorption Max Current consumption operational Outdoor temperature in cooling (Min-Max) limits Outdoor temperature in heating (Min-Max) OS-CECIH18EI OS-CECIH24EI OS-CECIH36EI OS-CECITH36EI OS-CECITH48EI V / F / Hz 220-240 / 1 / 50 mm 800x333x554 kg 33,7 mm 920x390x615 kg 33,6 m3/h 2000 dB(A) 55 dB(A) 63 rotating mm 6,35 mm 12,7 m 5 m 3 m 30 g/m 12 m 20 R32 675 kg 1,15 MPa 4,3/1,7 n° conductor 2+1 n° conductor 6 W 2950 A 13,5 °C B.S. -15 / +50 °C B.U. -15 / +24 220-240 / 1 / 50 965x395x765 66,8 965x395x755 72,6 2700 62 65 rotating 9,52 15,9 5 3 50 24 25 R32 675 1,50 4,3/1,7 2+1 6 2950 13,5 -15 / +50 -15 / +24 220-240 / 1 / 50 1090x500x875 66,8 1090x500x865 73.4 4000 65 67 rotating 9,52 15,9 5 3 65 24 30 R32 675 2,40 4,3/1,7 2+1 6 4700 21,5 -15 / +50 -15 / +24 380-415 / 3 / 50 1090x500x875 81,5 1090x500x865 87 4000 64 68 rotating 9,52 15,9 5 3 65 24 30 R32 675 2,40 4,3/1,7 4+1 6 5600 10,0 -15 / +50 -15 / +24 380-415 / 3 / 50 1095x495x1480 106,7 1095x500x1333 119,9 7500 66 72 rotating 9,52 15,9 5 3 65 24 30 R32 675 2,80 4,3/1,7 4+1 6 6200 11,2 -15 / +50 -15 / +24 145 AIR TREATMENT HEATING NEWNEXYA® Commercial Indoor unit DUCT Wall remote control FEATURES Excellent performance and high-efficiency at low air flow rate with consequent noise reduction. Automatic setting of the air flow rate automatic air flow rate setting function, in order to automatically adapt the system depending on the ducts connected to the unit. Wall-installed remote control (standard supply) e wired, wall-installed remote control has a weekly programmer, which allows setting at daily intervals with different selections of the product operating parameters. Reversible Air Intake e air intake duct can be moved from the rear of the product (standard configuration) to the lower part. It is replaced by a sheet steel panel. In this way, the product can be made suitable for any installation condition. Vent for introduction of fresh air e indoor units of the commercial line are equipped with specific air vents for the introduction of outdoor or fresh air into the product. Condensate Lift Pump e indoor units have a condensate liquid lift pump FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. HIGH EFFICIENCY TECHNOLOGY Classe A++ in cooling Classe A+ in heating intermediate season Classe A++ / A+++ in heating warmer season HIGH HEAD Ducted indoor unit with static pressure avai- lable up to 160 Pa. OLIMPIA SPLENDID'S INVERTER SYSTEM HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. SLIM DESIGN e range is characterised by its small dimensions (Height from 210 mm) 146 AUTOMATIC SETTING OF THE AIR FLOW RATE Indoor unit HYDRONIC SYSTEMS AIR CONDITIONING OUT OF STOCK OUT OF STOCK NEW NEW NEW NEW NEW DUCT NEXYA INDOOR UNIT NEXYA S4 DUCT 18 INDOOR UNIT NEXYA S4 DUCT 24 INDOOR UNIT NEXYA S4 E DUCT 18 INDOOR UNIT NEXYA S4 E DUCT 24 INDOOR UNIT NEXYA S4 E DUCT 36 (UE One Phase) INDOOR UNIT NEXYA S4 E DUCT 36 (UE ree Phase) INDOOR UNIT NEXYA S4 E DUCT 48 Product code INDOOR UNIT OS-SEMPH18EI OS-SEMPH24EI OS-SEDIH18EI OS-SEDIH24EI OS-SEDIH36EI OS-SEDIH36EI OS-SEDIH48EI Product code OUTDOOR UNIT OS-CECEH18EI OS-CECEH24EI OS-CECIH18EI OS-CECIH24EI OS-CECIH36EI OS-CECITH36EI OS-CECITH48EI Supply voltage INDOOR UNIT V / F / Hz One Phase 220-240 / 1 / 50 Supply voltage OUTDOOR UNIT V / F / Hz One Phase 220-240 / 1 / 50 ree Phase 380-415 / 3 / 50 Capacity (min / rated / max) kW 0,8-5,3-6,2 1,2-7,0-8,2 2,55-5,28-5,69 3,28-7,03-8,16 4,04-10,55-12,02 4,04-10,55-12,02 4,26-14,07-15,19 Absorbed power (min / rated / max) kW 0,3-1,7-2,2 0,4-2,3-2,9 710-1633-1900 480-2190-2850 902-4000-4900 890-4100-4980 1170-5150-5699 Current A 1,2-7,7-10 1,8-10,4-14 3,2-7,2-8,3 2,1-9,5-12,4 4,2-17,5-19,6 1,4-6,5-8,2 1,8-8,3-9,4 Cooling eoretical Load (PdesignC) kW 5,4 7,0 5,3 7,0 10,5 10,5 14 SEER 6,3 6,3 6,1 6,1 6,1 6,1 Energy efficiency class Annual energy consumption kWh/A 299 394 Capacity (Min-Nom-Max) kW 0,9-5,6-7,0 1,2-7.0-8,6 2,2-5,9-6,15 2,72-7,62-8,72 2,81-11,14-13,19 2,81-11,14-13,19 3,7-16,12-18,02 Absorbed power (min / rated / max) W 300-1500-2200 400-1900-2900 740-1580-1760 500-2050-2880 800-3100-4640 780-3000-4665 948-4280-5824 Current A 1,3-6,7-10 1,8-10,4-14 3,3-7,0-7,7 2,2-8,9-12,5 3,6-12,9-18,4 1,3-4,7-7,4 1,5-6,8-9,2 eoretical Load (PdesignH) (intermediate season - warmer season) kW Heating Scop (intermediate season - warmer season) 4,6-5,0 4,0-5,1 5,9-6,1 4,0-5,1 4,3-5,0 4,0-5,0 5,4-6,1 4,0-5,0 8,4-10,5 4,0-5,1 8,4-10,5 4,0-5,1 11,9-12,5 4,0-5,0 Energy efficiency class interm. season (intermediate season - warmer season) warmer season Annual energy consumption (intermediate season - warmer season) kWh/A - - - - - - - Operating limit temperature °C -15 -15 -15 -15 -15 -15 -15 Energy efficiency E.E.R./C.O.P. W/W 2,87 / 4,88 3,10 / 4,94 3,24 / 3,73 3,21 / 3,72 2,64 / 3,59 2,57 / 3,71 2,73 / 3,77 Dimensions (L x D x H) mm 880x674x210 1100x774x249 880x764x210 1100x774x249 1360x774x249 1360x774x249 1200x874x300 Weight (without packaging) kg 25,6 31,5 24,3 31,5 40,5 40,5 47,6 Dimensions (with packaging) (L x D x H) mm - - 1070x725x280 1305x805x305 1570x805x305 1570x805x305 1405x915x355 Indoor unit Weight (with packaging) (L x D x H) Air flow rate (min / rated / max) Rated Fan Pressure kg - - 29,6 38,9 48,5 48,5 55,8 m3/h 680-830-1000 840-1050-1250 350-650-850 839-1054-1248 750-1150-1400 750-1150-1400 1680-2040-2400 Pa 70 70 25 25 37 37 50 Fan pressure adjustment field Pa 25-110 30-110 0-100 0-160 0-160 0-160 0-160 Sound Pressure (min / rated / max) dB(A) - - 33-38-41,5 38-40-42 40-43-47 40-43-47 48-50-51 Sound power level ( max) dB(A) 59 65 59 62 63 63 68 Dimensions (L x D x H) mm 800x333x554 845x363x702 800x333x554 845x363x702 946x410x810 946x410x810 952x415x1333 Weight (without packaging) kg 35,5 49 33,7 66,8 66,8 81,5 106,7 Outdoor Dimensions (with packaging) (L x D x H) mm - unit Weight (with packaging) (L x D x H) kg - - 920x390x615 965x395x765 1090x500x875 1090x500x875 1095x495x1480 - 36,6 72,6 73,4 87,0 119,9 Air flow rate (min / rated / max) m3/h 2100 2700 2100 2700 4000 4000 7500 Compressor Type rotating rotating rotating rotating rotating rotating rotating Diameter of tube in liquid connection line mm 6,35 9,52 6,35 9,52 9,52 9,52 9,52 Diameter of tube in gas connection line mm 12,7 15,88 12,7 15,88 15,88 15,88 15,88 Dimensions Covered piping length from pre-load m 5 5 5 5 5 5 5 and Limitations of the Cooling Piping recommended minimum length m 3 3 3 3 3 3 3 Circuit Piping Equivalent length (max) m 30 50 30 50 65 65 65 Increase of Refrigerant g/m 15 37 12 24 24 24 24 Maximum difference in level m 20 25 20 25 30 30 30 Refrigerant gas Refrigerant fluid Global warming potential Refrigerant gas charge R410A R410A R32 R32 R32 R32 R32 2088 2088 675 675 675 675 675 kg 1,78 1,95 1,15 1,50 2,40 2,40 2,80 Maximum applied pressure high pressure side/low pressure side MPa 4,2/1,5 4,2/1,5 4,3/1,7 4,3/1,7 4,3/1,7 4,3/1,7 4,3/1,7 Indoor unit connection n° conductor 2+1 2+1 2+1 2+1 2+1 2+1 2+1 Electrical Outdoor unit connection n° conductor 2+1 2+1 2+1 2+1 2+1 4+1 4+1 connections Indoor - Outdoor unit connection n° conductor 6 6 6 6 6 6 6 Max Power absorption W 2200 2950 2950 2950 4700 5600 6200 Max Current consumption A 10,0 14,0 13,5 13,5 21,5 10,0 11,2 Indoor temperature in cooling (Min-Max) °C B.S. +17 / +32 +17 / +32 +17 / +32 +17 / +32 +17 / +32 +17 / +32 +17 / +32 operational Indoor temperature in heating (Min-Max) °C B.U. limits Outdoor temperature in cooling (Min-Max) °C B.S. +17 / +27 -15 / +43 +17 / +27 -15 / +43 0 / +30 -15 / +50 0 / +30 -15 / +50 0 / +30 -15 / +50 0 / +30 -15 / +50 0 / +30 -15 / +50 Outdoor temperature in heating (Min-Max) °C B.U. -15 / +24 -15 / +24 -15 / +24 -15 / +24 -15 / +24 -15 / +24 -15 / +24 e data declared is relative to the conditions envisioned in EN 14825 and EN 14511 (2014). During actual use, the effective electric consumption of the product may differ from that indicated. e data is subject to variation and modification without prior notice. e sound pressure values are at the following conditions: environment sound pressure level equal to 0 dB (Pressure equal to 20 Pa), unit positioned in free field condition, measuring device positioned at 1 metre from the front of the unit. 147 AIR TREATMENT HEATING NEWNEXYA® Commercial Indoor unit CASSETTE Cassette Compact Cassette Remote control (standard) Remote control (standard) FEATURES Two Models - Compact Cassette with width and length reduced to only 600x600 mm -Cassette with width and length exceeding 600x600 mm and slim height of 205 mm Vent for introduction of fresh air e indoor units of the commercial line are equipped with specific air vents for the introduction of outdoor or fresh air into the product. Condensate Lift Pump e indoor units have a lift pump for the condensate liquid. Decorative Panel e decorative panel has a digital display and has slots for expelling air also at the corners. FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. HIGH EFFICIENCY TECHNOLOGY Classe A++ in cooling Classe A+ in heating intermediate season Classe A++ / A+++ in heating warmer season HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. OLIMPIA SPLENDID'S INVERTER SYSTEM 100% 80% 70% NON INVERTER AC INVERTER DC INVERTER 148 SAVINGS 30% Indoor unit HYDRONIC SYSTEMS AIR CONDITIONING OUT OF STOCK OUT OF STOCK NEW NEW NEW NEW NEW CASSETTE NEXYA Product code INDOOR UNIT INDOOR UNIT NEXYA S4 CASSETTE 18 OS-SECPH18EI INDOOR UNIT NEXYA S4 CASSETTE 24 OS-SECPH24EI INDOOR UNIT NEXYA S4 E CASSETTE COMPACT 18 OS-SECIH18EI INDOOR UNIT NEXYA S4 E CASSETTE 24 OS-SECIH24EI INDOOR UNIT NEXYA S4 E CASSETTE 36 (UE One Phase) OS-SECIH36EI INDOOR UNIT NEXYA S4 E CASSETTE 36 (UE ree Phase) OS-SECIH36EI INDOOR UNIT NEXYA S4 E CASSETTE 48 OS-SECIH48EI Product code OUTDOOR UNIT OS-CECEH18EI OS-CECEH24EI OS-CECIH18EI OS-CECIH24EI OS-CECIH36EI OS-CECITH36EI OS-CECITH48EI Cooling Heating Supply voltage INDOOR UNIT Supply voltage OUTDOOR UNIT Capacity (min / rated / max) Absorbed power (min / rated / max) Current eoretical Load (PdesignC) SEER Energy efficiency class Annual energy consumption Capacity (Min-Nom-Max) Absorbed power (min / rated / max) Current eoretical Load (PdesignH) (intermediate season - warmer season) Scop (intermediate season - warmer season) V / F / Hz V / F / Hz kW W A kW 0,8-5,3-6,2 0,3-1,7-2,7 1,2-7,7-10 5,3 6,3 One Phase 220-240 / 1 / 50 One Phase 220-240 / 1 / 50 ree Phase 380-415 / 3 / 50 0,8-5,3-6,2 2,90-5,28-5,74 3,22-7,03-8,21 4,04-10,55-12,02 4,04-10,55-12,02 4,75-14,07-14,58 0,3-1,7-2,7 720-1633-1860 480-2190-2850 890-3750-4500 890-3950-4500 1174-5130-5602 1,2-7,7-10 3,2-7,2-8,2 2,1-9,5-12,4 3,9-16,3-19,6 3,9-6,6-8,2 1,8-8,3-9,3 5,3 5,3 7,0 10,5 10,5 14 6,1 6,1 6,1 6,1 6,1 6,1 kWh/A kW W A kW 294 0,9-5,6-7,0 300-1500-2200 1,3-6,7-10 402 0,9-5,6-7,0 300-1500-2200 1,3-6,7-10 304 2,37-5,42-6,10 700-1460-1930 3,1-6,4-8,5 402 2,43-7,62-8,65 2,94-11,14-13,48 500-2050-2880 720-2993-4450 2,2-8,9-12,5 3,2-13,0-19,4 2,95-11,14-14,14 720-3000-4750 3,2-5,0-8,3 3,93-16,12-16,77 987-5050-5378 1,56-8,2--8,9 4,9-5,0 5,8-5,9 4,2-5,3 5,4-5,9 8,8-10,5 8,1-10,5 11,2-12,2 4,0-5,1 4,0-5,1 4,0-4,9 4,0-5,1 4,0-5,1 4,0-5,1 4,0-5,1 Energy efficiency class interm. season (intermediate season - warmer season) warmer season Annual energy consumption (intermediate season - warmer season) kWh/A Operating limit temperature °C Energy efficiency E.E.R./C.O.P. W/W Dimensions (L x D x H) mm Weight (without packaging) kg Dimensions (with packaging) (L x D x H) mm Indoor unit Weight (with packaging) (L x D x H) kg Air flow rate (min / rated / max) m3/h Sound Pressure (min / rated / max) dB(A) Sound power level ( max) dB(A) Dimensions (L x D x H) mm Decorative Weight (without packaging) kg panel Dimensions (with packaging) (L x D x H) mm Weight (with packaging) (L x D x H) kg Dimensions (L x D x H) mm Weight (without packaging) kg Outdoor Dimensions (with packaging) (L x D x H) mm unit Weight (with packaging) (L x D x H) kg Air flow rate (min / rated / max) m3/h Compressor Type Diameter of tube in liquid connection line mm Diameter of tube in gas connection line mm Dimensions Covered piping length from pre-load m and Limitations of the Cooling Piping recommended minimum length m Circuit Piping Equivalent length (max) m Increase of Refrigerant g/m Maximum difference in level m Refrigerant gas Refrigerant Global warming potential fluid Refrigerant gas charge kg Maximum applied pressure high pressure side/low pressure side MPa Indoor unit connection n° conductor Outdoor unit connection Electrical connections Indoor - Outdoor unit connection Max Power absorption n° conductor n° conductor W Max Current consumption A Indoor temperature in cooling (Min-Max) °C B.S. operational Indoor temperature in heating (Min-Max) °C B.U. limits Outdoor temperature in cooling (Min-Max) °C B.S. Outdoor temperature in heating (Min-Max) °C B.U. - -15 3,06-5,87 840x840x205 21,4 - 763-867-1036 37-41-46 56 950x950x55 5 - 800x333x554 35,5 2100 rotating 6,35 17,7 5 30 15 20 R410A 2088 1,48 4,2/1,5 2+1 2+1 6 2200 10,0 +17 - +32 +17 - +27 -15 - +43 -15 - +24 - -15 3,10-5,70 840x840x245 23,0 - 1032-1200-1378 40-43-47 61 950x950x55 5 - 845x363x702 39 2700 rotating 9,52 15,88 5 50 37 25 R410A 2088 1,95 4,2/1,5 2+1 2+1 6 2950 14,0 +17 - +32 +17 - +27 -15 - +43 -15 - +24 - -15 3,23-3,71 570x570x260 16,2 662x662x317 21,4 540-625-720 35,5-39-42,5 56 647x647x50 2,5 647x647x50 4,5 800x333x554 33,7 920x390x615 36,6 2000 rotating 6,35 12,7 5 3 30 12 20 R32 675 1,15 4,3/1,7 2+1 2+1 6 2950 13,5 +17 - +32 0 - +30 -15 - +50 -15 - +24 - - - - -15 -15 -15 -15 3,21-3,72 2,81-3,72 2,67-3,71 2,74-3,19 840x840x205 840x840x245 840x840x245 840x840x287 23,0 27,5 27,5 29 900x900x225 900x900x265 900x900x265 900x900x292 27,0 31,0 31,0 32,7 1032-1200-1378 1438-1620-1775 1438-1620-1775 1381-1568-1715 40-43-47 46-49-51 41-47-51 49-50-52 59 61 62 65 950x950x55 950x950x55 950x950x55 950x950x55 5 5 5 5 1035x1035x90 1035x1035x90 1035x1035x90 1035x1035x90 8 8 8 8 845x363x702 946x410x810 946x410x810 952x410x1333 66,8 66,8 81,5 106,7 965x395x765 1090x500x875 1090x500x875 1095x495x1480 72,6 73,4 87,0 119,9 2700 4000 4000 7500 rotating rotating rotating rotating 9,52 9,52 9,52 9,52 15,88 15,88 15,88 15,88 5 5 5 5 3 3 3 3 50 65 65 65 24 24 24 24 25 30 30 30 R32 R32 R32 R32 675 675 675 675 1,50 2,40 2,40 2,80 4,3/1,7 4,3/1,7 4,3/1,7 4,3/1,7 2+1 2+1 6 2950 13,5 +17 - +32 0 - +30 -15 - +50 -15 - +24 2+1 2+1 6 4700 21,5 +17 - +32 0 - +30 -15 - +50 -15 - +24 2+1 4+1 6 5600 10,0 +17 - +32 0 - +30 -15 - +50 -15 - +24 2+1 4+1 6 6200 11,2 +17 - +32 0 - +30 -15 - +50 -15 - +24 e data declared is relative to the conditions envisioned in EN 14825 and EN 14511 (2014). During actual use, the effective electric consumption of the product may differ from that indicated. e data is subject to variation and modification without prior notice. e sound pressure values are at the following conditions: environment sound pressure level equal to 0 dB (Pressure equal to 20 Pa), unit positioned in free field condition, measuring device positioned at 1 metre from the front of the unit. 149 AIR TREATMENT HEATING NEWNEXYA® Commercial Indoor unit CEILING Remote control (standard) HIGH EFFICIENCY TECHNOLOGY HEAT PUMP OLIMPIA SPLENDID'S INVERTER SYSTEM OUT OF STOCK OUT OF STOCK NEW NEW NEW NEW NEW CEILING NEXYA Cooling Heating Product code indoor unit Product code outdoor unit Supply voltage indoor unit Supply voltage outdoor unit Capacity (min / rated / max) Absorbed power (min / rated / max) Current eoretical Load (PdesignC) SEER Energy efficiency class Annual energy consumption Capacity (Min-Nom-Max) Absorbed power (min / rated / max) Current eoretical Load (PdesignH) (intermediate season - warmer season) Scop (intermediate season - warmer season) v / F / Hz v / F / Hz kW W A kW kWh/A kW W A kW INDOOR UNIT NEXYA S4 CEILING 18 OS-SEFPH18EI OS-CECEH18EI 0,8-5,3-6,2 0,3-1,7-2,7 1,2-7,7-10 5,3 6,3 INDOOR UNIT NEXYA S4 CEILING 24 INDOOR UNIT NEXYA S4 E CEILING 18 INDOOR UNIT NEXYA S4 E CEILING 24 INDOOR UNIT NEXYA S4 E CEILING 36 (UE One Phase) INDOOR UNIT NEXYA S4 E CEILING 36 (UE ree Phase) INDOOR UNIT NEXYA S4 E CEILING 48 OS-SEFPH24EI OS-SEFIH18EI OS-SEFIH24EI OS-SEFIH36EI OS-SEFIH36EI OS-SEFIH48EI OS-CECEH24EI OS-CECIH18EI OS-CECIH24EI OS-CECIH36EI OS-CECITH36EI OS-CECITH48EI One Phase 220-240 / 1 / 50 One Phase 220-240 / 1 / 50 ree Phase 380-415 / 3 / 50 1,2-7,0-8,2 1,23-5,3-6,15 3,22-7,03-8,29 3,93-10,55-12,02 3,93-10,55-12,02 4,96-14,07-15,11 0,4-2,2-2,9 330-1500-2180 489-2190-2930 875-3800-4500 870-3750-4500 1158-5500-6003 1,8-9,9-14 1,2-7,1-9,3 2,1-10,0-13,1 4,1-16,7-19,6 1,2-5,8-8,2 1,8-9,1-9,8 7,0 5,3 7,0 10,5 10,5 14 6,1 6,1 6,1 6,1 6,1 6,1 285 402 - - - - - 0,9-5,6-7,0 1,2-7,0-8,2 1,4-5,6-9,5 2,72-7,62-8,65 2,81-11,14-13,48 2,81-11,14-13,95 3,81-16,12-18,07 300-1500-2200 400-1900-2900 330-1500-2180 500-2050-2850 730-3040-4550 730-3000-4885 1026-5050-6200 1,3-6,7-10 1,8-8,7-14 1,4-6,5-9,5 2,2-9,5-12,7 2,8-14,0-19,8 1,2-4,8--8,3 1,6-8,14-10,3 4,9-5,2 5,8-5,6 4,2-5,0 5,4-4,9 8,7-10,5 9,0-9,0 11,1-12,5 4,0-5,1 4,0-5,1 4,0-5,1 4,0-5,1 4,0-5,1 4,0-5,1 4,0-5,1 Energy efficiency class (intermediate season - warmer season) interm. season warmer season Operating limit temperature °C -15 Energy efficiency E.E.R./C.O.P. W/W 3,13/5,23 Dimensions (L x D x H) mm 1068x235x675 Weight (without packaging) kg 26,6 Dimensions (with packaging) (L x D x H) mm - Indoor unit Weight (with packaging) (L x D x H) kg - Air flow rate (min / rated / max) m3/h 677-760-902 Sound Pressure (min / rated / max) dB(A) 37-40-45 Sound power level ( max) dB(A) 56 Dimensions (L x D x H) mm 800x333x554 Weight (without packaging) kg 35,5 Outdoor Dimensions (with packaging) (L x D x H) mm - unit Weight (with packaging) (L x D x H) kg - Air flow rate (min / rated / max) m3/h 2100 Compressor Type rotating Diameter of tube in liquid connection line mm 6,35 Diameter of tube in gas connection line mm 17,7 Dimensions Covered piping length from pre-load m 5 and Limitations of the Cooling Piping recommended minimum length m - Circuit Piping Equivalent length (max) m 30 Increase of Refrigerant g/m 15 Maximum difference in level m 20 Refrigerant gas R410A Refrigerant Global warming potential fluid Refrigerant gas charge kg Maximum applied pressure high pressure side/low pressure side MPa 2088 1,48 4,2/1,5 Indoor unit connection n° conductor 2+1 Outdoor unit connection Electrical connections Indoor - Outdoor unit connection Max Power absorption n° conductor 2+1 n° conductor 6 W 2200 Max Current consumption A 10,0 Indoor temperature in cooling (Min-Max) °C B.S. +17 - +32 operational Indoor temperature in heating (Min-Max) limits Outdoor temperature in cooling (Min-Max) °C B.U. °C B.S. +17 - +27 -15 - +43 Outdoor temperature in heating (Min-Max) °C B.U. -15 - +24 -15 2,65/5,04 1068x235x675 26,8 - 853-1066-1208 41-46-50 61 845x363x702 39 2700 rotating 9,52 15,88 5 50 37 25 R410A 2088 1,95 4,2/1,5 2+1 2+1 6 2950 14,0 +17 - +32 +17 - +27 -15 - +43 -15 - +24 -15 3,53-3,71 1068x235x675 26,6 1145x755x313 31,8 677-786-902 37-40-45 63 800x333x554 33,7 920x390x615 36,6 2000 rotating 6,35 12,7 5 3 30 12 20 R32 675 1,15 4,3/1,7 2+1 2+1 6 2950 13,5 +17 - +32 0 - +30 -15 - +50 -15 - +24 -15 3,21-3,72 1068x235x675 26,8 1145x755x313 31,9 853-1066-1208 41-46-50 61 845x363x702 66,8 965x395x765 72,6 2700 rotating 9,52 15,88 5 3 50 24 25 R32 675 1,50 4,3/1,7 2+1 2+1 6 2950 13,5 +17 - +32 0 - +30 -15 - +50 -15 - +24 -15 2,78-3,66 1650x675x235 39,0 1725x755x313 45,0 1431-1844-2160 42-47-51 61 946x410x810 66,8 1090x500x875 73,4 4000 rotating 9,52 15,88 5 3 65 24 30 R32 675 2,40 4,3/1,7 2+1 2+1 6 4700 21,5 +17 - +32 0 - +30 -15 - +50 -15 - +24 -15 -15 2,81-3,71 2,67-3,19 1650x675x235 1650x675x235 39,0 41,2 1725x755x313 1725x755x313 45,0 47,6 1431-1844-2160 1417-1930-2329 42-47-51 46-50-54 59 66 946x410x810 952x410x1333 81,5 106,7 1090x500x875 1095x495x1480 87,0 119,9 4000 7500 rotating rotating 9,52 9,52 15,88 15,88 5 5 3 3 65 65 24 24 30 30 R32 R32 675 675 2,40 2,80 4,3/1,7 4,3/1,7 2+1 4+1 6 5600 10,0 +17 - +32 0 - +30 -15 - +50 -15 - +24 2+1 4+1 6 6200 11,2 +17 - +32 0 - +30 -15 - +50 -15 - +24 e data declared is relative to the conditions envisioned in EN 14825 and EN 14511 (2014). During actual use, the effective electric consumption of the product may differ from that indicated. e data is subject to variation and modification without prior notice. e sound pressure values are at the following conditions: environment sound pressure level equal to 0 dB (Pressure equal to 20 Pa), unit positioned in free field condition, measuring device positioned at 1 metre from the front of the unit. 150 NEXYA® COMMERCIAL Compatibility Range OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT NEXYA S3 COMM. 18 NEXYA S3 COMM. 24 NEXYA S4E COMM. 18 NEXYA S4E COMM. 24 NEXYA S4E COMM. 36 NEXYA S4E COMM. 36T NEXYA S4E COMM. 48T HYDRONIC SYSTEMS AIR CONDITIONING 410A 410A I.U. NEXYA S4 DUCT 18 OUTSTOOFCK 18 · 24 · · I.U. NEXYA S4 CASSETTE OUTSTOOFCK 18 · 24 · · I.U. NEXYA S4 CEILING OUTSTOOFCK 18 · 24 · · NEW I.U. NEXYA S4 E DUCT 18 · · 24 · · 36 · · 48 · NEW I.U. NEXYA S4 E CASSETTE COMPACT 18 · · NEW I.U. NEXYA S4 E CASSETTE 24 · · 36 · · 48 · NEW I.U. NEXYA S4 E CEILING 18 · · 24 · · 36 · · 48 · 151 AIR TREATMENT HEATING NEWNEXYA® Multisplit Energy efficient multisplit inverter air conditioners. Duct Cassette compact FUNCTIONS Fan only mode Dehumidification only mode Auto mode: changes parameters depending on ambient temperature. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Wall MULTISPLIT SELECTION: e Nexya Multi is a stackable system: mixed systems can be designed by using wall units, ducted units or cassette units, and by choosing the right size depending on the thermal load of the system. 24 Wi-Fi ready only for wall models: Nexya S4 E 9/12 and Alyas 9/12 HIGH EFFICIENCY TECHNOLOGY Classe A++ in cooling Classe A+ in heating intermediate season Classe A++ / A+++ in heating warmer season 2 3 4 5 MULTISPLIT Nexya S4E is available in the versions: dual, trial, quadri and penta, to air-condition up to four rooms by using only one outside motor. OLIMPIA SPLENDID'S INVERTER SYSTEM 100% 80% 70% HEAT PUMP Heat pump air conditioner. anks to this feature you can replace traditional heating in intermediate seasons or support it. ECOLOGICAL R32 GAS New low environmental impact refrigerant GAS. NON INVERTER AC INVERTER DC INVERTER 152 SAVINGS 30% HYDRONIC SYSTEMS AIR CONDITIONING Outdoor unit NEW NEW OUT OF STOCK NEW OUT OF STOCK NEW OUT OF STOCK MULTISPLIT NEXYA S4 E OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT OUTDOOR UNIT NEXYA S4 E NEXYA S4 E NEXYA S4 E NEXYA S4 E NEXYA S4 E NEXYA S4 E NEXYA S4 E NEXYA S4 E DUAL 14 DUAL 18 DU AL 21 TRIAL 21 TRIAL 26 QUADRI 28 QUADRI 36 PENTA 42 Cooling Heating Product code outdoor unit Supply voltage Capacity (min / rated / max) Absorbed power (min / rated / max) Current eoretical Load (PdesignC) SEER Energy efficiency class Annual energy consumption Capacity (Min-Nom-Max) Absorbed power (min / rated / max) Current eoretical Load (PdesignH) (intermediate season - warmer season) Scop (intermediate season - warmer season) V / F / Hz kW W A kW OS-CEMYH14EI OS-CEMYH18EI OS-CEMEH21EI OS-CEMYH21EI OS-CEMEH26EI OS-CEMYH28EI OS-CEMEH36EI OS-CEMEH42EI One Phase 220-240 / 1 / 50 1,44-4,10-4,79 2,05-5,27-6,86 1,34-5,28-5,81 1,94-6,15-6,86 2,96-7,91-8,50 2,05-8,20-9,84 2,05-10,55-12,66 2,05-12,31-14,15 1270(120-1680) 1630(690-2000) 1630(123-2234) 1950(180-2240) 2450(235-3220) 2540(890-3180) 3270(1140-4090) 4260(1490-4580) 5.9(0.78-9.1) 7.1(3.1-9.2) 7,1 (2,6-9,7) 9.0(1.09-9.9) 13.7(2.2-14.3) 11.3(3.9-14.1) 14.3(5.1-18.2) 18.5(6.6~20.3) 4,1 5.3 5,4 6,1 7,9 8.2 10.6 12.4 6,8 6.1 5,9 6,1 6,1 6.1 6.2 6.1 kWh/A kW W A kW - - 319 - - - - - 1,45-6,59-6,86 2,34-5,57-7,24 1,88-5,57-6,57 1,73-6,59-7,25 2,04-8,20-9,38 2,34-8,79-10,55 2,34-10,84-13,00 2,34-12,31-14,77 1770 (250-1980) 1500 (600-1670) 1390 (301-2347) 1780 (325-1920) 2100 (310-2890) 2200 (770-2750) 2760 (970-3450) 3100 (1090-4000) 8.1 (1.76-8.8) 6.6 (2.6-7.9) 6,1 (3,24-10,2) 8.5 (1.94-8.5) 12.5 (2.5-12.9) 9.8 (3.4-12.2) 12.1 (4.3-15.3) 13.5 (4.8-17.8) 3,7 - 3,7 4.3 - 5,1 5,0 - / 5,6 - 5,6 5,6 - 6,1 6,5 - 6,9 9,0 - 10,4 9,2 - 10,6 4,0 - 5,1 4,0 - 5,1 3,9 - / 4,0 - 4,8 4,0 - 5,1 3,8 - 4,6 3,8 - 5,0 3,5 - 4,9 Energy efficiency class interm. season (intermediate season - warmer season) warmer season Annual energy consumption (intermediate season - warmer season) Operating limit temperature Energy efficiency E.E.R./C.O.P. Dimensions (L x D x H) Weight (without packaging) Dimensions (with packaging) (L x D x H) Outdoor Weight (with packaging) (L x D x H) unit Air flow rate (min / rated / max) Sound Pressure (min / rated / max) Sound power level ( max) Compressor Type Diameter of tube in liquid connection line Diameter of tube in gas connection line Covered piping length from pre-load Piping recommended minimum length Piping Equivalent length (max) Dimensions and Limitations Piping Equivalent max. branch of piping) length (single of the Cooling Circuit Increase of Refrigerant Difference in level (Max) (outdoor unit in higher position that indoor units) Difference in level (Max) (outdoor unit in lower position that indoor units) Difference in level (Max) (elevation difference between indoor units) Refrigerant gas Refrigerant fluid Global warming potential Refrigerant gas charge Maximum applied pressure high pressure side/low pressure side kWh/A °C W/W mm kg mm kg m3/h dB(A) dB(A) mm mm m m m m g/m m m m kg MPa - - 1822 - - - - - -15 3,23 - 3,71 800x333x554 31.6 920x390x615 34.7 57 66 rotating 2x6.35 2x9.52 40 -15 3,24 - 3,71 800x333x554 35.5 920x390x615 38.5 56 65 rotating 3x6.35 3x9.52 40 -15 3,1 - 4,9 800x333x554 36 2200 63 rotating 2x6,35 2,9,52 7,5 40 -15 3,23 - 3,71 845x363x702 46.8 965x395x775 51.1 - 57.5 65 rotating 3x6.35 3x9.52 60 -15 -15 -15 -15 3,23 - 3,91 3,23 - 4,00 3,23 - 3,93 2,89 - 3,97 845x363x702 946x410x810 946x410x810 946x410x810 51.1 62.1 68.8 73.3 965x395x775 1090x500x875 1090x500x875 1090x500x875 55.8 67.7 75.6 80.4 - - - - 54 61.5 63 64 67 67 67 69 rotating rotating rotating rotating 4x6.35 4x6.35 5x6.35 5x6,35 4x9.52 4x9.52 5x9.52 3x9,52+1x12,7 - - - - - - - - 60 80 80 80 25 30 25 30 35 35 35 35 - - 12 - - - - - 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 10 R32 675 1.25 4.3/1.7 10 R32 675 1,4 4.3/1.7 10 R32 675 1,3 4,3/1,7 10 R32 675 1,72 4.3/1.7 10 R32 675 2.1 4.3/1.7 10 R32 675 2.1 4.3/1.7 10 R32 675 2.4 4.3/1.7 10 R32 675 2,1 4,3/1,7 Main power supply V / F / Hz Electrical Indoor - Outdoor unit connection n° conductor 3+1 3+1 connections Max Power absorption W 2850 3300 Max Current consumption A 13 15.5 operational Outdoor temperature in cooling (Min-Max) °C B.S. limits Outdoor temperature in heating (Min-Max) °C B.U. -15 / +50 -15 / +24 -15 / +50 -15 / +24 For the energy classes of the individual combinations, refer to the energy labels of the specific combination. 3+1 2700 11,8 -15 / +50 -15 / +24 One Phase 220-240 / 1 / 50 3+2 3+2 3600 4150 17,5 19.0 -15 / +50 -15 / +50 -15 / +24 -15 / +24 3+2 4600 21.5 -15 / +50 -15 / +24 3+2 4700 22 -15 / +50 -15 / +24 3+1 4700 22,0 -15 - +50 -15 - +24 e data declared is relative to the conditions envisioned in EN 14825 and EN 14511 (2014). During actual use, the effective electric consumption of the product may differ from that indicated. e data is subject to variation and modification without prior notice. e sound pressure values are at the following conditions: environment sound pressure level equal to 0 dB (Pressure equal to 20 Pa), unit positioned in free field condition, measuring device positioned at 1,5 metre from the front of the unit. AIR TREATMENT HEATING 153 NEWNEXYA® Multisplit Indoor unit Wall Nexya S4E Alyas E REMOTE CONTROL WI FI Ready (standard) WALL INDOOR UNIT NEXYA S4 E INVERTER 9 INDOOR UNIT NEXYA S4 E INVERTER 12 NEW INDOOR UNIT ALYAS E INVERTER 9 NEW INDOOR UNIT ALYAS E INVERTER 12 Product code Indoor unit OS-SENEH09EI OS-SENEH12EI OS-SECYH09EI OS-SECYH12EI Supply voltage V / F / Hz 220-240 / 1 / 50 Cooling kW (Nom) 2,64 3,55 2,64 3,55 Heating kW (Nom) 2,93 3,81 2,93 3,81 Dimensions (L x D x H) mm 805X194X285 805X194X285 722x187x290 802x189x297 Weight (without packaging) kg 7,5 7,5 7.3 8.2 Dimensions (with packaging) (LxDxH) mm Indoor Unit Weight (with packaging) (LxDxH) kg Air flow rate (min/rated/max) m3/h 870x270x360 9,7 340-460-520 870x270x360 9,7 360-500-600 790x270x370 9.7 700-850-1150 875x285x375 10.7 700-1000-1100 Sound Pressure (Silent-Min-Med-Max) dB(A) 21-26-30-40 22-26-34-40 20-23-31-39 21-22-30-38 Sound power level (max) dB(A) 53 53 54 56 piping Diameter of tube in liquid connection line mm 6,35 6,35 6 6 dimensionsDiameter of tube in gas connection line mm 9,52 9,52 10 10 Indoor - Outdoor unit connection n° conductor 3+1 3+1 3+1 3+1 operation- Indoor temperature in cooling (Min-Max) °C B.S. al limits Indoor temperature in heating (Min-Max) °C B.S. +17 / +32 0 / +30 +17 / +32 0 / +30 .+17 / +32 0 / +30 .+17 / +32 0 / +30 e data declared is relative to the conditions envisioned in EN 14825 and EN 14511 (2014). During actual use, the effective electric consumption of the product may differ from that indicated. e data is subject to variation and modification without prior notice. e sound pressure values are at the following conditions: environment sound pressure level equal to 0 dB (Pressure equal to 20 Pa), unit positioned in free field condition, measuring device positioned at 0,8 metre from the front of the unit. Indoor unit Duct DUCT NEXYA S4 E INDOOR UNIT NEXYA S4 E DUCT 9 INDOOR UNIT NEXYA S4 E DUCT 12 NEW INDOOR UNIT NEXYA S4 E DUCT 18 HIGH HEAD SLIM DESIGN Product code Indoor unit OS-SEDDH09EI OS-SEDDH12EI OS-SEDIH18EI AUTOMATIC SETTING OF THE AIR FLOW RATE Supply voltage V / F / Hz Cooling kW (Nom) Heating kW (Nom) Dimensions (L x D x H) mm Weight (without packaging) kg Dimensions (with packaging) (LxDxH) mm Weight (with packaging) (LxDxH) kg Indoor Unit Air flow rate (min/rated/max) m3/h Sound Pressure (Silent-Min-Med-Max) dB(A) Sound power level (max) dB(A) Air flow Pressure Pa Fan pressure adjustment field Pa piping Diameter of tube in liquid connection line mm dimensions Diameter of tube in gas connection line mm Indoor - Outdoor unit connection n° conductor operational Indoor temperature in cooling (Min-Max) limits Indoor temperature in heating (Min-Max) °C B.S. °C B.S. 2,64 2,93 700x450x200 18 860x540x275 22 300-480-600 27,5-34,5-40,0 59 25 0-40 6,35 9,52 3+1 +17 / +32 0 / +30 220-240 / 1 / 50 3,55 3,81 700x450x200 18 860x540x275 22 300-480-600 27,5-34,5-40,0 59 25 0-60 6,35 9,52 3+1 +17 / +32 0 / +30 5,27 5,57 880x674x210 24,3 1070x725x280 29,5 350-650-880 33-38-41,5 59 25 0-100 6,35 12,7 3+1 +17 / +32 0 / +30 WALL REMOTE CONTROL (standard) e data declared is relative to the conditions envisioned in EN 14825 and EN 14511 (2014). During actual use, the effective electric consumption of the product may differ from that indicated. e data is subject to variation and modification without prior notice. e sound pressure values are at the following conditions: environment sound pressure level equal to 0 dB (Pressure equal to 20 Pa), unit positioned in free field condition, measuring device positioned at 1.5 metres below the indoor unit to which standard ducts, with length measuring 2 metres (supply) and 1 metre (return), are applied. 154 HYDRONIC SYSTEMS AIR CONDITIONING Indoor unit Cassette REMOTE CONTROL (standard) COMPACT DESIGN OUT OF STOCK NEW NEW CASSETTE NEXYA S4 E INDOOR UNIT NEXYA S4 E CASSETTE 12 INDOOR UNIT NEXYA S4 E CASSETTE COMPACT 12 INDOOR UNIT NEXYA S4 E CASSETTE COMPACT 18 Product code Indoor unit OS-SECPH12EI OS-SECIH12EI OS-SECIH18EI Supply voltage F-V-Hz Cooling kW (Nom) Heating kW (Nom) Dimensions (L x D x H) mm Weight (without packaging) kg Dimensions (with packaging) (LxDxH) mm Indoor Unit Weight (with packaging) (LxDxH) kg Air flow rate (min/rated/max) m3/h Sound Pressure (Silent-Min-Med-Max) dB(A) Sound power level (max) dB(A) Dimensions (L x D x H) mm Decorative Weight (without packaging) kg Panel Dimensions (with packaging) (LxDxH) mm Weight (with packaging) (LxDxH) kg piping Diameter of tube in liquid connection line mm dimensions Diameter of tube in gas connection line mm Indoor - Outdoor unit connection n° conductor operational Indoor temperature in cooling (Min-Max) °C B.U. limits Indoor temperature in heating (Min-Max) °C B.S. 3,55 4,10 570x570x260 16,2 655x655x290 21,4 416-506-608 35-39-43 57 647x647x50 2,5 715x715x123 4,5 6,35 9,52 3+1 +17 / +32 0 / +30 220-240V 1-50Hz 3,55 4,10 570x570x260 16,2 655x655x290 21,4 416-506-608 35-39-43 57 647x647x50 2,5 715x715x123 4,5 6,35 9,52 3+1 +17 / +32 0 / +30 5,27 5,42 570x570x260 16,2 655x655x290 21,4 500-560-680 41-42-44 56 647x647x50 2,5 715x715x123 4,5 6,35 12,7 3+1 +17 / +32 0 / +30 e data declared is relative to the conditions envisioned in EN 14825 and EN 14511 (2014). During actual use, the effective electric consumption of the product may differ from that indicated. e data is subject to variation and modification without prior notice. e sound pressure values are at the following conditions: environment sound pressure level equal to 0 dB (Pressure equal to 20 Pa), unit positioned in free field condition, measuring device positioned at 1 metre from the front of the unit. Performance tables of the Multisplit combinations e performance tables of the Multisplit combinations can be found on-line at www.olimpiasplendid.it/area-download AIR TREATMENT HEATING 155 NEXYA Multisplit selection table 1 INDOOR UNITS 2 INDOOR UNITS 3 INDOOR UNITS 4 INDOOR UNITS 5 INDOOR UNITS OUTDOOR UNIT NEXYA S4 E DUAL 14 9 12 18 9 + 9 9+12 - OUTDOOR UNIT NEXYA S4 E DUAL 18 9 12 18 9 + 9 9+12 9+18 12+12 - OUTDOOR UNIT NEXYA S4 E DUAL 21 9 12 18 9 + 9 9+12 9+18 12+12 - OUTDOOR UNIT NEXYA S4 E TRIAL 21 9 12 18 9+9 9+12 9+18 12+12 9+9+9 9+9+12 - OUTDOOR UNIT NEXYA S4 E TRIAL 26 9 12 18 9+9 9+12 9+18 12+12 12+18 9+9+9 9+9+12 9+12+12 12+12+12 - OUTDOOR UNIT NEXYA S4 E QUADRI 28 9 12 18 9+9 9+12 9+18 12+12 12+18 18+18 9+9+9 9+9+12 9+9+18 9+12+12 9+12+18 12+12+12 9+9+9+9 9+9+9+12 - OUTDOOR UNIT NEXYA S4 E QUADRI 36 9 12 18 9+9 9+12 9+18 12+12 12+18 18+18 9+9+9 9+9+12 9+9+18 9+12+12 9+12+18 9+18+18 12+12+12 12+12+18 12+18+18 9+9+9+9 9+9+9+12 9+9+9+18 9+9+12+12 9+9+12+18 9+12+12+12 9+12+12+18 12+12+12+12 - OUTDOOR UNIT NEXYA S4 E PENTA 42 9 12 18 9+9 9+12 9+18 12+12 12+18 18+18 9+9+9 9+9+12 9+9+18 9+12+12 9+12+18 9+18+18 12+12+12 12+12+18 12+18+18 18+18+18 9+9+9+9 9+9+9+12 9+9+9+18 9+9+12+12 9+9+12+18 9+12+12+12 9+9+18+18 9+12+12+18 9+12+18+18 12+12+12+12 12+12+12+18 9+9+9+9+9 9+9+9+9+12 9+9+9+9+18 9+9+9+12+12 9+9+9+12+18 9+9+12+12+12 9+12+12+12+12 156 HYDRONIC SYSTEMS AIR CONDITIONING Mono- and multisplit tubes installation INDOOR UNIT Highest A MAXIMUM GAP B C D Lower E Maximum distance single pipe Indoor Unit - Outdoor Unit Total length A+B+C+D+E OUTDOOR UNIT between higher indoor unit and lower outdoor unit (low) 15 m between higher indoor unit and lower outdoor unit 10 m between lower indoor unit and higher outdoor unit (high) 15 m MONO DUAL TRIAL QUADRI PENTA 25 m 25 m 30 m 35 m 35 m - 40 m 60 m 80 m 80 m AIR TREATMENT HEATING 157 158 PORTABLE AIR CONDITIONERS 159 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS NEWDOLCECLIMA® compact 8 P DOLCECLIMA COMPACT 8 P Cod. 01913 Italian Design by Sebastiano Ercoli & Alessandro Garlandini FEATURES Nominal cooling capacity: 2,1 kW(1) Energy Class: Sound power: dB (A)63 Rated energy efficiency index: EER 2.7(1) Refrigerant gas: R290 No tank: automatic condensation disposal Multifunction remote control LCD Display Timer 12h Practical side handles Wheels FUNCTIONS Fan mode: Adjustable 2 fan speed. Fan only mode is also available. Dehumidification mode Auto mode: automatic operation which regulates cooling in relation to the ambient temperature to optimize energy consumption. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Turbo mode: Maximum fan speed. Extra cool. COMPACT TECHNOLOGY Space savings: only 70 cm height and 35 cm width. REMOTE CONTROL User-friendly remote control. Quick and easy set of all functions. ROTATING CASTORS Practical rotating castors for easier transferring. NATURAL REFRIGERANT - R290 e natural refrigerant with the lowest impact on global warming (GWP = 3) (1) In accordance with regulation EN14511 160 HYDRONIC SYSTEMS AIR CONDITIONING PRELIMINARY DATA Product code EAN code Rated output power for cooling (1) Rated power input for cooling (1) Nominal absorption in cooling mode (1) Rated efficiency energy ratio (1) Energy Efficiency Class in cooling mode (1) ermostat off mode power consumption Standby mode power consumption (EN 62301) Hourly electricity consumption for single duct (1) cooling mode Power supply Power supply min / max Power absorption in cooling mode (1) Maximum absorption in cooling mode (1) Max. Dehumidification capacity (2) Air flow (max/med/min) Fan speeds Flexible pipe (lenght x diameter) Maximun remote control range (distance / angle) Dimensions ( W x D x H ) (without packaging) Dimensions ( W x D x H ) (with packaging) Weight (without packing) Weight (with packing) Sound pressure level Sound power level (indoor only) (EN 12102) Protection level Refrigerant gas* Global warming potential of refrigerant Refrigerant gas charge Maximum operating pressure Maximum operating pressure (low pressure side) LIMITS OF OPERATING CONDITIONS Indoor Ambient Maximum temperature in cooling Temperature Minimum temperature in cooling Outdoor Ambient Maximum temperature in cooling Temperature Minimum temperature in cooling (1) Test conditions: data refers to regulation EN14511 (2) Test conditions :30/27.1°C (DB/WB) drying mode. *Hermetically sealed equipment Is included a flexible duct to exhaust the air (ø 150 mm, lenght 1,5 m) P rated PEER EERd POFF PSB QSD LWA GWP kW kW A W W kWh/h V-F-Hz V W A l/h m³/h mm m / ° mm mm kg kg dB(A) min-max dB(A) Type kgCO2 eq. kg MPa MPa DOLCECLIMA COMPACT 8 P 01913 8021183019131 2,1 0,76 3,30 2,7 1 0,5 0,76 220-240-1-50 198 / 264 960 5,00 1,8 319 / 213 2 1500 x 150 8 / ±80° 345 x 355 x 703 390 x 400 x 880 22,5 26 47 - 52,5 63 IP 10 R290 3 0,13 2,6 1,00 DB 35°C - WB 32°C DB 17°C DB 43°C - WB 32°C DB 18°C - WB 16°C AIR TREATMENT HEATING 161 NEWDOLCECLIMA® compact 9 P DOLCECLIMA COMPACT 9 P Cod. 01914 Italian Design by Sebastiano Ercoli & Alessandro Garlandini FEATURES Nominal cooling capacity: 2,34 kW(1) Energy Class: Sound power: dB (A)62 Rated energy efficiency index: EER 2.6(1) Refrigerant gas: R290 No tank: automatic condensation disposal Multifunction remote control LCD Display Timer 12h Practical side handles Wheels FUNCTIONS Fan mode: Adjustable 2 fan speed. Fan only mode is also available. Dehumidification mode Auto mode: automatic operation which regulates cooling in relation to the ambient temperature to optimize energy consumption. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Turbo mode: Maximum fan speed. Extra cool. COMPACT TECHNOLOGY Space savings: only 70 cm height and 35 cm width. REMOTE CONTROL User-friendly remote control. Quick and easy set of all functions. ROTATING CASTORS Practical rotating castors for easier transferring. NATURAL REFRIGERANT - R290 e natural refrigerant with the lowest impact on global warming (GWP = 3) (1) In accordance with regulation EN14511 162 HYDRONIC SYSTEMS AIR CONDITIONING PRELIMINARY DATA Product code EAN code Rated output power for cooling (1) Rated power input for cooling (1) Nominal absorption in cooling mode (1) Rated efficiency energy ratio (1) Energy Efficiency Class in cooling mode (1) ermostat off mode power consumption Standby mode power consumption (EN 62301) Hourly electricity consumption for single duct (1) cooling mode Power supply Power supply min / max Power absorption in cooling mode (1) Maximum absorption in cooling mode (1) Max. Dehumidification capacity (2) Air flow (max/med/min) Fan speeds Flexible pipe (lenght x diameter) Maximun remote control range (distance / angle) Dimensions ( W x D x H ) (without packaging) Dimensions ( W x D x H ) (with packaging) Weight (without packing) Weight (with packing) Sound pressure level Sound power level (indoor only) (EN 12102) Protection level Refrigerant gas* Global warming potential of refrigerant Refrigerant gas charge Maximum operating pressure Maximum operating pressure (low pressure side) LIMITS OF OPERATING CONDITIONS Indoor Ambient Maximum temperature in cooling Temperature Minimum temperature in cooling Outdoor Ambient Maximum temperature in cooling Temperature Minimum temperature in cooling (1) Test conditions: data refers to regulation EN14511 (2) Test conditions :30/27.1°C (DB/WB) drying mode. *Hermetically sealed equipment Is included a flexible duct to exhaust the air (ø 150 mm, lenght 1,5 m) P rated PEER EERd POFF PSB QSD LWA GWP kW kW A W W kWh/h V-F-Hz V W A l/h m³/h mm m / ° mm mm kg kg dB(A) min-max dB(A) Type kgCO2 eq. kg MPa MPa DOLCECLIMA COMPACT 9 P 01914 8021183019148 2,34 0,90 4,10 2,6 1 0,5 0,9 220-240-1-50 198 / 264 1100 5,80 2,14 286 / 194 2 1500 x 150 8 / ±80° 345 x 355 x 703 390 x 400 x 880 25,5 28,1 47 - 52 62 IP 10 R290 3 0,15 2,6 1,0 DB 35°C - WB 32°C DB 16°C DB 43°C - WB 32°C DB 18°C - WB 16°C AIR TREATMENT HEATING 163 NEWDOLCECLIMA® compact 10 P DOLCECLIMA COMPACT 10 P Cod. 01921 Italian Design by Sebastiano Ercoli & Alessandro Garlandini FEATURES Nominal cooling capacity: 2,64 kW(1) Energy Class: Sound power: dB (A)63 Rated energy efficiency index: EER 2.6(1) Refrigerant gas: R290 No tank: automatic condensation disposal Multifunction remote control LCD Display Timer 12h Practical side handles Wheels FUNCTIONS Fan mode: Adjustable 2 fan speed. Fan only mode is also available. Dehumidification mode Auto mode: automatic operation which regulates cooling in relation to the ambient temperature to optimize energy consumption. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Turbo mode: Maximum fan speed. Extra cool. COMPACT TECHNOLOGY Space savings: only 70 cm height and 35 cm width. REMOTE CONTROL User-friendly remote control. Quick and easy set of all functions. ROTATING CASTORS Practical rotating castors for easier transferring. NATURAL REFRIGERANT - R290 e natural refrigerant with the lowest impact on global warming (GWP = 3) (1) In accordance with regulation EN14511 164 HYDRONIC SYSTEMS AIR CONDITIONING PRELIMINARY DATA Product code EAN code Rated output power for cooling (1) Rated power input for cooling (1) Nominal absorption in cooling mode (1) Rated efficiency energy ratio (1) Energy Efficiency Class in cooling mode (1) ermostat off mode power consumption Standby mode power consumption (EN 62301) Hourly electricity consumption for single duct (1) cooling mode Power supply Power supply min / max Power absorption in cooling mode (1) Maximum absorption in cooling mode (1) Max. Dehumidification capacity (2) Air flow (min/med/ max) Fan speeds Flexible pipe (lenght x diameter) Maximun remote control range (distance / angle) Dimensions ( W x D x H ) (without packaging) Dimensions ( W x D x H ) (with packaging) Weight (without packing) Weight (with packing) Sound pressure level Sound power level (indoor only) (EN 12102) Protection level Refrigerant gas* Global warming potential of refrigerant Refrigerant gas charge Maximum operating pressure Maximum operating pressure (low pressure side) LIMITS OF OPERATING CONDITIONS Indoor Ambient Maximum temperature in cooling Temperature Minimum temperature in cooling Outdoor Ambient Maximum temperature in cooling Temperature Minimum temperature in cooling (1) Test conditions: data refers to regulation EN14511 (2) Test conditions :30/27.1°C (DB/WB) drying mode. *Hermetically sealed equipment Is included a flexible duct to exhaust the air (ø 150 mm, lenght 1,5 m) P rated PEER EERd POFF PSB QSD LWA GWP kW kW A W W kWh/h V-F-Hz V W A l/h m³/h mm m / ° mm mm kg kg dB(A) min-max dB(A) Type kgCO2 eq. kg MPa MPa DOLCECLIMA COMPACT 10 P 01921 8021183019216 2,64 1,00 4,35 2,6 1 0,5 1,0 220-240-1-50 198 / 264 1280 6,22 2,12 295/0/195 2 1500 x 150 8 / ±80° 345 x 355 x 703 390 x 400 x 880 25,3 28,1 47 - 52 63 IP 10 R290 3 0,17 2,6 1,0 DB 35°C - WB 32°C DB 16°C DB 43°C - WB 32°C DB 18°C - WB 16°C AIR TREATMENT HEATING 165 NEWDOLCECLIMA® silent 10 P DOLCECLIMA SILENT 10 P Code 01920 FEATURES Nominal cooling capacity: 2,6 kW(2) Energy Class: Sound power: dB (A)63 Rated energy efficiency index: EER 2,8(2) Refrigerant gas: R290 No tank: automatic condensation disposal Multifunction remote control LCD Display Timer 12h Practical side handles Wheels FUNCTIONS Fan mode: Adjustable 3 fan speed. Fan only mode is also available. Dehumidification mode Auto mode: automatic operation which regulates cooling in relation to the ambient temperature to optimize energy consumption. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Turbo mode: Maximum fan speed. Extra cool. SILENT SYSTEM Up to 10%(1) quieter at minimum speed. GOODNIGHT SLEEP REMOTE CONTROL User-friendly remote control. Quick and easy set of all functions. TOTAL WHITE DESIGN Essential design with white nuances, to perfectly fit in every home environment. La diffeLreandziaffterraenuznaptorartautnilepotrtaadtiizlieontraaldeizeioEnllaisleseeHEPl.lisse HP. La diffeLreandziaffterraenuznaptorartautnilepotrtaadtiizlieontraaldeizeioEnllaisleseeHEPl.lisse HP. Per spiegarPeeur lstpeireiogramreenutlteelraiodrmivernstietàladedlivfleursistoàddeell'flaruisasdoidEellli'sasreiaHdPi rEisllpisestetoHaPi rnisopremtatoli apionrtoartmilialèi sptoarttoatfialittèosatantcohefauttnoaaltnrcohteipuondailtarnoatlipsio. Ldai atenramliosig.rLaafitaeèrmuongarafia è una rPielervsapziieognaerrPeideleurvllsltaopezirsieiopognerametrteedroneultldlteoeelrisairpoadergmitvgteriornisntdietfeàrliaadroaedgslivsgflieiureismnistfoeàrasddsreoielsld'sflaaigrueilsamisodoegisdgsEeielltdli'tsaais.greiQlaiHuodPegisrgEtiiesllptritsaeisgt.etgQoHiuavPeeisrnntiigsoproraemngtoatgolcii aavppeiotnnratgotaoritmnidloiaalèciaasppptopatroattsotaittfeidaliatttèeaorspmatpanootccsohaitemfeauetttrneoeramaeltnoprccorhaotemdipuueocrneodanielotaprniormaotldmipsuaioc.goLdianioiatednirmoamvlmieosaigs.griLaieanfivitaiedèreomnvuezonigaasriaefivaidèenuzniaa BLUE AIR TECHNOLOGY rilevazioneridlevllaozsiopneettdroeldloeisrpaegtgtrioindferiaroagssgiieimnferassroi sdsaigelmi oegsgsietdtai.gQliuoegsgtietrtaig. gQiuveesntigroangogci avpetnagtoindoa caappptoastitedatearpmpoocsaitmeetreermeopcraomduecreoneopirmodmuacgoinoi dimovmeasgi ienviideonveziasi evidenzia la differenzla difftermenpzearadtui rtaemalpl'einrateturnrao adlil'uinntoersntoesdsiouanmobsiteenstseo. ambiente. la differenzla difftermenpzearadtui rtaemalpl'einrateturnrao adlil'uinntoersntoesdsiouanmobsiteenstseo. ambiente. MININA VMEILNOICNIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. MININA VMEILNOICNIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. MASSIMAMVAESLSOIMCIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. MASSIMAMVAESLSOIMCIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. EllisEslleissHeP.HP. BLUE AIR TECHNOLOGY EllisEslleissHeP.HP. ADVANCED CONTROL WITH TOUCH DISPLAY e latest technology aimed to optimize all available features. min. fan speed max. fan speed PortPaotritlaetitlrea tdirzaidoinzialoen.ale. PORTABLE TRADITIONAL PortPaotritlaetitlrea tdirzaidoinzialoen.ale. NATURAL REFRIGERANT - R290 e natural refrigerant with the lowest impact on global warming (GWP = 3) (1) Internal laboratory tests on traditional Olimpia Splendid range (2) In accordance with regulation EN14511 166 Queste terQmuoegsrtaefiteerampopgrreasfienetraanpoprilesfeuntzaionnoaiml feunntzoiodneal mcoendtoizidoenlactonredipzoiorntaattiolereEplloisrsteatHilPe eElldisisuenHcPoneddiziiounactonreditzriaodniaztionrealteratdeisztiaotni ainleutnesatastai ninzaundai 3s,t5anmzadidi 3,5 m di lQuunegshteeztzearlQmeuunodegigs2rhta,ee7fiztezmearamdepiodpagirlt2reeas,7zfieznemat.raadInlpiotpaerlistletesfzseuzinaètz.aisIonvlnootaeltismlotfeasunilnltèazoismodvnoaeallstmscoiomeanaldltaoeizdmidoaenllslasactiommnraeidneipizmdoiorantlavlaatetiollmoerceiEnitpliàlmoisdrastieavvteHeillnPoetcieEiltalàldzisiidosuiennveHecdnPoetnielldaedzizmiioiouannceaccdhtoeinnrlleede,itzmcriahoadenciacznhtieoilnnlreeea,lvtecarahrtideeeisznftioaeottlnloieaisnlveoanurtioneesapftoassttoaiizniisnozoannuaondtaiep3oisn,st5aibznmiaozsansdaoidtie3in,5bmassdoi lunghezza leundig2h,e7zzma deidailt2e,7zzma. dIlitaelsttezszi aè.sIvl oteltsot asillèa smvoalstsoimaallaedmalslsaimmaineimd alvlaelmocinitiàmdaivveelnotciiltaàzidoinveednetillaezmioancecdheinllee, mchaeccnheilnlee,vcahriee nfoetlloesvoanrioepfostoizisoonnaotepoinsibziaosnsaote in basso a sinistra. Laesminaisctcrhai.eLedimcaoclocrheieazdziucrorloorreaapzpzruesrreontraanpopirlelsaennctiaondoeilll'laarniaciforedseclal'adreial cforensdciazidoenlactonrediezisoinpautòorneoetasriepiunòmnoodtaoreviindemnotedocoemviedeEnlltiessceoHmPegEellnisesrei uHnPflguesnseori un flusso da'asirniaistfrreas. cLdaae'ascmirnhiaaiesctfrcrriheais.mecLpaediiecmchlaoeaclorscirtheeaimneazpzdaziieucinrloarlomosrtoreaadnapozzpadzrueeinscrreiosmnatomraadnepoonpdtireleelscpaeiinsnùactmioaomnedonoetgilelle'lapnarieniùaoc.ioformedsoecglale'andreeiaol .cforensdciazidoenlactonrediezisoinpautòorneoetasriepiunòmnoodtaoreviindemnotedocoemviedeEnlltiessceoHmPegEellnisesrei uHnPflguesnseori un flusso d'aria frescda'acrhiae frriesmcpaiechlea rsiteamnzpaieinlamstoadnozadeincismaomdeondteecpiisùamomenotgeepnieùo.omogeneo. 24x24_ok.indd24x12348_ok.indd 138 24x24_ok.indd24x12348_ok.indd 138 31-01-2011 2301:-2041:-222011 20:24:22 31-01-2011 2301:-2041:-222011 20:24:22 HYDRONIC SYSTEMS AIR CONDITIONING PRELIMINARY DATA Product code EAN code Rated output power for cooling (1) Rated power input for cooling (1) Nominal absorption in cooling mode (1) Rated efficiency energy ratio (1) Energy Efficiency Class in cooling mode (1) ermostat off mode power consumption Standby mode power consumption (EN 62301) Hourly electricity consumption for single duct (1) cooling mode Power supply Power supply (min-max) Power absorption in cooling mode (1) Maximum absorption in cooling mode (1) Max. Dehumidification capacity (3) Air flow (max) Fan speeds Flexible pipe (lenght x diameter) Maximun remote control range (distance / angle) Dimensions ( W x H x D ) (without packaging) Dimensions ( W x H x D ) (with packaging) Weight (without packing) Weight (with packing) Sound power level (indoor only) (EN 12102) Sound pressure level (min-max) (2) Protection level Refrigerant gas* Global warming potential of refrigerant Refrigerant gas charge Maximum operating pressure Minimum flor area for installation, use and storage Power cable (N° pole x section mm2) Fuse Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in cooling Minimum temperature in cooling (1) Test conditions: data refers to regulation EN14511 (2) Declaration of test date in semi anechoic chamber at a distance of 2m, low fan only (3) Test conditions: 30/27.1°C (DB/WB) in dehumidification mode. *Hermetically sealed equipment Is included a flexible duct to exhaust the air (ø 120 mm, lenght 1,5 m) P rated PEER EERd POFF PSB QSD LWA GWP kW kW A W W kWh/h V-F-Hz V W A l/h m³/h mm m / ° mm mm Kg Kg dB(A) dB(A) Type kgCO2 eq. kg MPa MPa DOLCECLIMA® SILENT 10 P 01920 8021183019209 2,6 0,90 4,00 2,8 1 0,5 0,90 220-240-1-50 198 / 264 1100 5,60 1,5 355 3 1500 x 120 8 / ±80° 396 x 762 x 460 460 x 860 x 496 28,0 32,8 63 38-48 IP 10 R290 3 0,23 12 2,60 3 x 1,0 / VDE 10AT DB 35°C - WB 32°C DB 17°C DB 43°C - WB 32°C DB 18°C - WB 16°C AIR TREATMENT HEATING 167 NEWDOLCECLIMA® silent 12 P DOLCECLIMA SILENT 12 P Code 01919 FEATURES Nominal cooling capacity: 2,7 kW(2) Energy Class: Sound power: dB (A)64 Rated energy efficiency index: EER 2,8(2) Refrigerant gas: R290 No tank: automatic condensation disposal Multifunction remote control LCD Display Timer 12h Practical side handles Wheels FUNCTIONS Fan mode: Adjustable 2 fan speed. Fan only mode is also available. Dehumidification mode Auto mode: automatic operation which regulates cooling in relation to the ambient temperature to optimize energy consumption. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Turbo mode: Maximum fan speed. Extra cool. METALLIC FINISHING Elegant finishing touch with silver metallic painting. REMOTE CONTROL User-friendly remote control. Quick and easy set of all functions. La diffeLreandziaffterraenuznaptorartautnilepotrtaadtiizlieontraaldeizeioEnllaisleseeHEPl.lisse HP. La diffeLreandziaffterraenuznaptorartautnilepotrtaadtiizlieontraaldeizeioEnllaisleseeHEPl.lisse HP. Per spiegarPeeur lstpeireiogramreenutlteelraiodrmivernstietàladedlivfleursistoàddeell'flaruisasdoidEellli'sasreiaHdPi rEisllpisestetoHaPi rnisopremtatoli apionrtoartmilialèi sptoarttoatfialittèosatantcohefauttnoaaltnrcohteipuondailtarnoatlipsio. Ldai atenramliosig.rLaafitaeèrmuongarafia è una rPielervsapziieognaerrPeideleurvllsltaopezirsieiopognerametrteedroneultldlteoeelrisairpoadergmitvgteriornisntdietfeàrliaadroaedgslivsgflieiureismnistfoeàrasddsreoielsld'sflaaigrueilsamisodoegisdgsEeielltdli'tsaais.greiQlaiHuodPegisrgEtiiesllptritsaeisgt.etgQoHiuavPeeisrnntiigsoproraemngtoatgolcii aavppeiotnnratgotaoritmnidloiaalèciaasppptopatroattsotaittfeidaliatttèeaorspmatpanootccsohaitemfeauetttrneoeramaeltnoprccorhaotemdipuueocrneodanielotaprniormaotldmipsuaioc.goLdianioiatednirmoamvlmieosaigs.griLaieanfivitaiedèreomnvuezonigaasriaefivaidèenuzniaa BLUE AIR TECHNOLOGY rilevazioneridlevllaozsiopneettdroeldloeisrpaegtgtrioindferiaroagssgiieimnferassroi sdsaigelmi oegsgsietdtai.gQliuoegsgtietrtaig. gQiuveesntigroangogci avpetnagtoindoa caappptoastitedatearpmpoocsaitmeetreermeopcraomduecreoneopirmodmuacgoinoi dimovmeasgi ienviideonveziasi evidenzia la differenzla difftermenpzearadtui rtaemalpl'einrateturnrao adlil'uinntoersntoesdsiouanmobsiteenstseo. ambiente. la differenzla difftermenpzearadtui rtaemalpl'einrateturnrao adlil'uinntoersntoesdsiouanmobsiteenstseo. ambiente. MININA VMEILNOICNIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. MININA VMEILNOICNIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. MASSIMAMVAESLSOIMCIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. MASSIMAMVAESLSOIMCIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. EllisEslleissHeP.HP. BLUE AIR TECHNOLOGY EllisEslleissHeP.HP. ADVANCED CONTROL WITH TOUCH DISPLAY e latest technology aimed to optimize all available features. SILENT SYSTEM Up to 10%(1) quieter at minimum speed,. PortPaotritlaetitlrea tdirzaidoinzialoen.ale. PORTABLE TRADITIONAL PortPaotritlaetitlrea tdirzaidoinzialoen.ale. min. fan speed max. fan speed Queste terQmuoegsrtaefiteerampopgrreasfienetraanpoprilesfeuntzaionnoaiml feunntzoiodneal mcoendtoizidoenlactonredipzoiorntaattiolereEplloisrsteatHilPe eElldisisuenHcPoneddiziiounactonreditzriaodniaztionrealteratdeisztiaotni ainleutnesatastai ninzaundai 3s,t5anmzadidi 3,5 m di lQuunegshteeztzearlQmeuunodegigs2rhta,ee7fiztezmearamdepiodpagirlt2reeas,7zfieznemat.raadInlpiotpaerlistletesfzseuzinaètz.aisIonvlnootaeltismlotfeasunilnltèazoismodvnoaeallstmscoiomeanaldltaoeizdmidoaenllslasactiommnraeidneipizmdoiorantlavlaatetiollmoerceiEnitpliàlmoisdrastieavvteHeillnPoetcieEiltalàldzisiidosuiennveHecdnPoetnielldaedzizmiioiouannceaccdhtoeinnrlleede,itzmcriahoadenciacznhtieoilnnlreeea,lvtecarahrtideeeisznftioaeottlnloieaisnlveoanurtioneesapftoassttoaiizniisnozoannuaondtaiep3oisn,st5aibznmiaozsansdaoidtie3in,5bmassdoi lunghezza leundig2h,e7zzma deidailt2e,7zzma. dIlitaelsttezszi aè.sIvl oteltsot asillèa smvoalstsoimaallaedmalslsaimmaineimd alvlaelmocinitiàmdaivveelnotciiltaàzidoinveednetillaezmioancecdheinllee, mchaeccnheilnlee,vcahriee nfoetlloesvoanrioepfostoizisoonnaotepoinsibziaosnsaote in basso a sinistra. Laesminaisctcrhai.eLedimcaoclocrheieazdziucrorloorreaapzpzruesrreontraanpopirlelsaennctiaondoeilll'laarniaciforedseclal'adreial cforensdciazidoenlactonrediezisoinpautòorneoetasriepiunòmnoodtaoreviindemnotedocoemviedeEnlltiessceoHmPegEellnisesrei uHnPflguesnseori un flusso da'asirniaistfrreas. cLdaae'ascmirnhiaaiesctfrcrriheais.mecLpaediiecmchlaoeaclorscirtheeaimneazpzdaziieucinrloarlomosrtoreaadnapozzpadzrueeinscrreiosmnatomraadnepoonpdtireleelscpaeiinsnùactmioaomnedonoetgilelle'lapnarieniùaoc.ioformedsoecglale'andreeiaol .cforensdciazidoenlactonrediezisoinpautòorneoetasriepiunòmnoodtaoreviindemnotedocoemviedeEnlltiessceoHmPegEellnisesrei uHnPflguesnseori un flusso d'aria frescda'acrhiae frriesmcpaiechlea rsiteamnzpaieinlamstoadnozadeincismaomdeondteecpiisùamomenotgeepnieùo.omogeneo. NATURAL REFRIGERANT - R290 24x24_ok.indd24x12348_ok.indd 138 24x24_ok.indd24x12348_ok.indd 138 e natural refrigerant with the lowest impact on global warming (GWP = 3) (1) Internal laboratory tests on traditional Olimpia Splendid range (2) In accordance with regulation EN14511 168 31-01-2011 2301:-2041:-222011 20:24:22 31-01-2011 2301:-2041:-222011 20:24:22 HYDRONIC SYSTEMS AIR CONDITIONING PRELIMINARY DATA Product code EAN code Rated output power for cooling (1) Rated power input for cooling (1) Nominal absorption in cooling mode (1) Rated efficiency energy ratio (1) Energy Efficiency Class in cooling mode (1) ermostat off mode power consumption Standby mode power consumption (EN 62301) Hourly electricity consumption for single duct (1) cooling mode Power supply Power supply min / max Power absorption in cooling mode (1) Maximum absorption in cooling mode (1) Max. Dehumidification capacity (3) Air flow (max/med/min) Fan speeds Flexible pipe (lenght x diameter) Maximun remote control range (distance / angle) Dimensions ( W x H x D ) (without packaging) Dimensions ( W x H x D ) (with packaging) Weight (without packing) Weight (with packing) Sound power level (indoor only) (EN 12102) Sound pressure level (min-max) (2) Protection level Refrigerant gas* Global warming potential of refrigerant Refrigerant gas charge Maximum operating pressure Maximum operating pressure suction side Power cable (N° pole x section mm2) Fuse Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in cooling Minimum temperature in cooling (1) Test conditions: data refers to regulation EN14511 (2) Declaration of test date in semi anechoic chamber at a distance of 2m, low fan only (3) Test conditions: 30/27.1°C (DB/WB) in dehumidification mode. *Hermetically sealed equipment Is included a flexible duct to exhaust the air (ø 120 mm, lenght 1,5 m) P rated PEER EERd POFF PSB QSD LWA GWP DOLCECLIMA® SILENT 12 P 01919 8021183019193 kW 2,7 kW 1,01 A 4,50 2,8 W W kWh/h V-F-Hz V W A l/h m³/h mm m / ° mm mm Kg Kg dB(A) dB(A) Type kgCO2 eq. kg MPa MPa 1 0,5 1,01 220/240-1-50 198 / 264 1200 6,40 2,0 410 / 345 / 255 3 1500 x 120 8 / ±80° 396 x 762 x 460 460 x 860 x 496 28,5 32,5 64 38-48 IP 10 R290 3 0,24 2,60 1,00 3 x 1,5 10AT DB 35°C - WB 32°C DB 16°C DB 43°C - WB 32°C DB 18°C - WB 16°C AIR TREATMENT HEATING 169 NEWDOLCECLIMA® 12 hp P DOLCECLIMA 12 HP P Code 01922 FEATURES Nominal cooling capacity: 2,7 kW(1) Energy Class: / in heating Sound power: dB (A)64 Rated energy efficiency index: EER 2,8(1) Rated coefficient of performance: COP 2,9(1) Refrigerant gas: R290 Multifunction remote control LCD Display Timer 12h Practical side handles Wheels FUNCTIONS Fan mode: Adjustable 2 fan speed. Fan only mode is also available. Dehumidification mode Auto mode: automatic operation which regulates cooling in relation to the ambient temperature to optimize energy consumption. Sleep mode: gradually increases the temperature set and ensures reduced noise for greater wellbeing at night. Turbo mode: Maximum fan speed. Extra cool. HIGH EFFICIENCY TECHNOLOGY Energy Class A+ in heating mode.(1) REMOTE CONTROL User-friendly remote control. Quick and easy set of all functions. HEAT PUMP MODE Replace or support your heating system (a condensate drain piping is mandatory in heat pump mode). ADVANCED CONTROL WITH TOUCH DISPLAY e latest technology aimed to optimize all available features. NATURAL REFRIGERANT - R290 e natural refrigerant with the lowest impact on global warming (GWP = 3) La diffeLreandziaffterraenuznaptorartautnilepotrtaadtiizlieontraaldeizeioEnllaisleseeHEPl.lisse HP. La diffeLreandziaffterraenuznaptorartautnilepotrtaadtiizlieontraaldeizeioEnllaisleseeHEPl.lisse HP. Per spiegarPeeur lstpeireiogramreenutlteelraiodrmivernstietàladedlivfleursistoàddeell'flaruisasdoidEellli'sasreiaHdPi rEisllpisestetoHaPi rnisopremtatoli apionrtoartmilialèi sptoarttoatfialittèosatantcohefauttnoaaltnrcohteipuondailtarnoatlipsio. Ldai atenramliosig.rLaafitaeèrmuongarafia è una rPielervsapziieognaerrPeideleurvllsltaopezirsieiopognerametrteedroneultldlteoeelrisairpoadergmitvgteriornisntdietfeàrliaadroaedgslivsgflieiureismnistfoeàrasddsreoielsld'sflaaigrueilsamisodoegisdgsEeielltdli'tsaais.greiQlaiHuodPegisrgEtiiesllptritsaeisgt.etgQoHiuavPeeisrnntiigsoproraemngtoatgolcii aavppeiotnnratgotaoritmnidloiaalèciaasppptopatroattsotaittfeidaliatttèeaorspmatpanootccsohaitemfeauetttrneoeramaeltnoprccorhaotemdipuueocrneodanielotaprniormaotldmipsuaioc.goLdianioiatednirmoamvlmieosaigs.griLaieanfivitaiedèreomnvuezonigaasriaefivaidèenuzniaa BLUE AIR TECHNOLOGY lrailedviaffzeiroennezlraidledvlilafoftzesirompenenpetzetardraoedtlduiloertaeismrpaaelpglt'eigtnrriaotietndurfnerraoiaradoaligsl'suigniniteoiemnrsfnertoaesssrdoisiosdsuaaingmeolmibsoietegesngsstieseotd.taia.gmQlibuoieegsngttieetr.taig. gQiuveesntigroangogci avpetnagtoindoa caappptoastitedatearpmpoocsaitmeetreermeopcraomduecreoneopirmodmuacgoinoi dimovmeasgi ienviideonveziasi evidenzia la differenzla difftermenpzearadtui rtaemalpl'einrateturnrao adlil'uinntoersntoesdsiouanmobsiteenstseo. ambiente. MININA VMEILNOICNIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. MININA VMEILNOICNIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. MASSIMAMVAESLSOIMCIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. MASSIMAMVAESLSOIMCIATÀVEDLIOVCEINTÀTILDAIZVIOENTEI.LAZIONE. EllisEslleissHeP.HP. BLUE AIR TECHNOLOGY EllisEslleissHeP.HP. min. fan speed max. fan speed PortPaotritlaetitlrea tdirzaidoinzialoen.ale. PORTABLE TRADITIONAL PortPaotritlaetitlrea tdirzaidoinzialoen.ale. (1) In accordance with regulation EN14511 hermetically sealed equipment containing fluorinated gas 170 Queste terQmuoegsrtaefiteerampopgrreasfienetraanpoprilesfeuntzaionnoaiml feunntzoiodneal mcoendtoizidoenlactonredipzoiorntaattiolereEplloisrsteatHilPe eElldisisuenHcPoneddiziiounactonreditzriaodniaztionrealteratdeisztiaotni ainleutnesatastai ninzaundai 3s,t5anmzadidi 3,5 m di lQuunegshteeztzearlQmeuunodegigs2rhta,ee7fiztezmearamdepiodpagirlt2reeas,7zfieznemat.raadInlpiotpaerlistletesfzseuzinaètz.aisIonvlnootaeltismlotfeasunilnltèazoismodvnoaeallstmscoiomeanaldltaoeizdmidoaenllslasactiommnraeidneipizmdoiorantlavlaatetiollmoerceiEnitpliàlmoisdrastieavvteHeillnPoetcieEiltalàldzisiidosuiennveHecdnPoetnielldaedzizmiioiouannceaccdhtoeinnrlleede,itzmcriahoadenciacznhtieoilnnlreeea,lvtecarahrtideeeisznftioaeottlnloieaisnlveoanurtioneesapftoassttoaiizniisnozoannuaondtaiep3oisn,st5aibznmiaozsansdaoidtie3in,5bmassdoi alusnignhisetzraza. Laleuesndmiigna2hisc,e7tczrhazmai.eLdeedidimaicltao2ecl,o7zczrhmeai.eadIzdlizitaueclrstorteloozszirreaèa.apsIzpvlzortueeltsrsoretonastilralèaanpsompvoiralelsltssaoeinmnactalialoaneddomeailllls'llasaairnmimacaiifonreiedmdsecalall'vlaaderelimoal cicfniortieànmsdcdaiaizvivdoeeenlnolatcctiilotaànrzedidoieiznivseoiendnpaeuttilòloaernzemiooetanacsericedphieuinnlòleme,nmocodhtaaoecrcnehveiiilndnleeemn,vocatedhrioeceonefmoveitledloeeEsnvlolatinesriosceeopfHmoPsteoizgEiseololnninseaosrteiepuHoinnPsiflbzguiaeossnnsseaoortieuinn flbuassssoo a sinistra. Laesminaisctcrhai.eLedimcaoclocrheieazdziucrorloorreaapzpzruesrreontraanpopirlelsaennctiaondoeilll'laarniaciforedseclal'adreial cforensdciazidoenlactonrediezisoinpautòorneoetasriepiunòmnoodtaoreviindemnotedocoemviedeEnlltiessceoHmPegEellnisesrei uHnPflguesnseori un flusso d'aria frescda'acrhiae frriesmcpaiechlea rsiteamnzpaieinlamstoadnozadeincismaomdeondteecpiisùamomenotgeepnieùo.omogeneo. d'aria frescda'acrhiae frriesmcpaiechlea rsiteamnzpaieinlamstoadnozadeincismaomdeondteecpiisùamomenotgeepnieùo.omogeneo. 24x24_ok.indd24x12348_ok.indd 138 24x24_ok.indd24x12348_ok.indd 138 31-01-2011 2301:-2041:-222011 20:24:22 31-01-2011 2301:-2041:-222011 20:24:22 PRELIMINARY DATA Product code EAN code Rated output power for cooling (1) Rated output power for heating (1) Rated power input for cooling (1) Nominal absorption in cooling mode (1) Rated power input for heating (1) Nominal absorption in heating mode (1) Rated efficiency energy ratio (1) Rated Coefficient of performance (1) Energy Efficiency Class in cooling mode (1) Energy Efficiency Class in heating mode (1) ermostat off mode power consumption Standby mode power consumption ( EN 62301 ) Hourly electricity consumption for single duct (1) cooling mode Hourly electricity consumption for single duct (1) heating mode Power supply Power supply min / max Power absorption in cooling mode (1) Maximum absorption in cooling mode (1) Power absorption in heating mode (1) Maximum absorption in heating mode (1) Dehumidification capacity (3) Fan speeds Flexible pipe ( lenght x diameter ) Maximun remote control range ( distance / angle ) Dimensions ( W x H x D ) (without packaging) Dimensions ( W x H x D ) (with packaging) Weight ( without packing ) Weight ( with packaging ) Sound pressure level (2) (min-max) Sound power level ( indoor only ) ( EN 12102 ) Refrigerant gas Global warming potential of refrigerant Lower flamability limit Refrigerant gas charge Minimum flor area for installation, use and storage Maximum operating pressure Maximum operating pressure ( low pressure side ) Power cable ( N° pole x section mmq ) Fuse Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in cooling Minimum temperature in cooling (1) Test conditions: data refers to regulation EN14511 (2) Declaration of test date in semi anechoic chamber at a distance of 2m, low fan only (3) Test conditions: 30/27.1°C (DB/WB) in dehumidification mode. *Hermetically sealed equipment Is included a flexible duct to exhaust the air (ø 120 mm, lenght 1,5 m) P rated kW P rated kW PEER kW A PCOP kW A EERd COPrated POFF W PSB W QSD kWh/h QSD kWh/h V-F-Hz V W A W A l/h mm m / ° mm mm kg kg dB(A) LWA dB(A) Type GWP kgCO2 eq. LFL kg/m3 kg m2 MPa MPa DOLCECLIMA® 12 HP P 01922 8021183019223 2,7 2,34 1,01 4,50 0,90 4,00 2,8 2,9 1 0,5 1,01 0,90 220/240-1-50 198 / 264 1200 6,4 1200 6,4 2,0 3 1500 x 120 8 / ±80° 396 x 762 x 460 460 x 860 x 496 30,0 34,3 38-49 64 R290 3 0,038 0,24 12 2,60 1,00 3 x 1,5 VDE 10AT DB 35°C - WB 32°C DB 17°C DB 43°C - WB 32°C DB 18°C - WB 16°C 171 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS NEWDOLCECLIMA® Air Pro 13 A+ DOLCECLIMA AIR PRO 13 A+ Cod. 01916 Design by EMO DESIGN FEATURES Nominal cooling capacity: 2,93 kW(2) Energy Class: Sound power: dB (A) 62 Rated energy efficiency index: EER 3,1(2) Refrigerant gas: R290 Multifunction remote control LCD Display Practical side handles Wheels Motorized flap FUNCTIONS Dehumidification only function Eco function: adjusts cooling on the basis of room temperature in order to optimise energy consumption. Turbo Function: maximum fan speed at the lowest set-point. Silent Function: minimum fan speed to reduce noise Blue Air/Auto Function: automatic fan speed for excellent air flow management. Timer Function: 24 hours timeframe to start or stop settings. SILENT SYSTEM Up to 10%(1) quieter at minimum speed. HIGH EFFICIENCY TECHNOLOGY Energy Class A+. Up to 15% energy saving (1) DESIGNED IN ITALY Hi-tech goes hand in hand with Made in Italy design. ADVANCED CONTROL WITH TOUCH DISPLAY e latest technology aimed to optimize all available features. MOVING FLAP Enjoy the best comfort experience thanks to the air flow management function. NATURAL REFRIGERANT - R290 e natural refrigerant with the lowest impact on global warming (GWP = 3) (1) Internal laboratory tests on traditional Olimpia Splendid range (2) In accordance with regulation EN14511 172 HYDRONIC SYSTEMS AIR CONDITIONING product code EAN code Rated output power for cooling (1) Rated power input for cooling (1) Nominal absorption in cooling mode (1) Rated efficiency energy ratio (1) Energy Efficiency Class in cooling mode (1) Off mode power consumption ( ON-OFF switch ) ermostat off mode power consumption Standby mode power consumption ( EN 62301 ) Hourly electricity consumption for single duct (1) cooling mode Power supply Power supply min / max Power absorption in cooling mode (1) Maximum absorption in cooling mode (1) Max. Dehumidification capacity (2) Room air volume ( max/med/min ) Fan speeds Flexible pipe ( lenght x diameter ) Maximun remote control range ( distance / angle ) Dimensions ( W x H x D ) (without packaging) Dimensions ( W x H x D ) (with packaging) Weight ( without packing ) Weight ( with packaging ) Sound pressure level (1) Sound power level ( indoor only ) ( EN 12102 ) Refrigerant gas* Global warming potential of refrigerant Refrigerant gas charge Maximum operating pressure Power cable ( N° pole x section mmq ) Fuse Conformity mark Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in cooling Minimum temperature in cooling (1) Test conditions: data refers to regulation EN14511 (2) Test conditions :30/27.1°C (DB/WB) drying mode. *Hermetically sealed equipment Is included a flexible duct to exhaust the air (ø 150 mm, lenght 1,5 m) Prated kW PEER kW A EERrated W PTO W PSB W QSD kWh/h V-F-Hz V W A l/h m³/h mm m / ° mm mm kg kg dB(A) min-max LWA dB(A) Tipo-Type GWP kgCO2 eq. kg MPa DOLCECLIMA® AIR PRO 13 A+ 01916 8021183019162 2,93 0,95 4,5 3,1 0,5 1 0,5 0,9 220/240-1-50 198 / 264 1150 6 3,0 420 / 370 / 355 3 1500 x 150 8 / ±80° 490 x 765 x 425 535 x 890 x 487 32 37 50-52 62 R290 3 0,20 2,60 3 x 1,5 10AT CE DB 35°C - WB 32°C DB 16°C DB 43°C - WB 32°C DB 18°C - WB 16°C AIR TREATMENT HEATING 173 NEWDOLCECLIMA® Air Pro 14 DOLCECLIMA AIR PRO 14 Cod. 01917 Design by EMO DESIGN FEATURES Nominal cooling capacity: 3,52 kW(2) Energy Class: Sound power: dB (A) 63 Rated energy efficiency index: EER 2,6(2) Refrigerant gas: R290 Multifunction remote control LCD Display Practical side handles Wheels Motorized flap FUNCTIONS Dehumidification only function Eco function: adjusts cooling on the basis of room temperature in order to optimise energy consumption. Turbo Function: maximum fan speed at the lowest set-point. Silent Function: minimum fan speed to reduce noise Blue Air/Auto Function: automatic fan speed for excellent air flow management. Timer Function: 24 hours timeframe to start or stop settings. SILENT SYSTEM Up to 10%(1) quieter at minimum speed. PRO POWER Super cooling power up to 3.5 kW. DESIGNED IN ITALY Hi-tech goes hand in hand with Made in Italy design. ADVANCED CONTROL WITH TOUCH DISPLAY e latest technology aimed to optimize all available features. MOVING FLAP Enjoy the best comfort experience thanks to the air flow management function. NATURAL REFRIGERANT - R290 e natural refrigerant with the lowest impact on global warming (GWP = 3) (1) Internal laboratory tests on traditional Olimpia Splendid range (2) In accordance with regulation EN14511 174 HYDRONIC SYSTEMS AIR CONDITIONING product name product code EAN code Rated output power for cooling (1) Rated power input for cooling (1) Nominal absorption in cooling mode (1) Rated efficiency energy ratio (1) Energy Efficiency Class in cooling mode (1) Off mode power consumption ( ON-OFF switch ) ermostat off mode power consumption Standby mode power consumption ( EN 62301 ) Hourly electricity consumption for single duct (1) cooling mode Power supply Power supply min / max Power absorption in cooling mode (1) Maximum absorption in cooling mode (1) Max. Dehumidification capacity (2) Room air volume ( max/med/min ) Fan speeds Flexible pipe ( lenght x diameter ) Maximun remote control range ( distance / angle ) Dimensions ( W x H x D ) (without packaging) Dimensions ( W x H x D ) (with packaging) Weight ( without packing ) Weight ( with packaging ) Sound pressure level (1) Sound power level ( indoor only ) ( EN 12102 ) Refrigerant gas* Global warming potential of refrigerant Refrigerant gas charge Maximum operating pressure Power cable ( N° pole x section mmq ) Fuse Conformity mark Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in cooling Minimum temperature in cooling (1) Test conditions: data refers to regulation EN14511 (2) Test conditions :30/27.1°C (DB/WB) drying mode. *Hermetically sealed equipment Is included a flexible duct to exhaust the air (ø 150 mm, lenght 1,5 m) Prated kW PEER kW A EERrated W PTO W PSB W QSD kWh/h V-F-Hz V W A l/h m³/h mm m / ° mm mm kg kg dB(A) min-max LWA dB(A) Tipo-Type GWP kgCO2 eq. kg MPa DOLCECLIMA® AIR PRO 14 01917 8021183019179 3,52 1,35 5,9 2,6 0,5 1 0,5 1,35 220/240-1-50 198 / 264 1600 8,0 3,5 420 / 370 / 355 3 1500 x 150 8 / ±80° 490 x 765 x 425 535 x 890 x 487 34 38 50.5 / 51 / 52 63 R290 3 0,22 2,60 3 x 1,5 10AT CE DB 35°C - WB 32°C DB 16°C DB 43°C - WB 32°C DB 18°C - WB 16°C AIR TREATMENT HEATING 175 NEWDOLCECLIMA® Air Pro 14 HP DOLCECLIMA AIR PRO 14 HP Cod. 01918 Design by EMO DESIGN FEATURES Nominal cooling capacity: 3,5 kW(2) Energy Class: / in heating Sound power: dB (A) 64 Rated energy efficiency index: EER 2,6(2) Rated coefficient of performance: COP 2,8(1) Refrigerant gas: R290 Multifunction remote control LCD Display Practical side handles Wheels Motorized flap FUNCTIONS Dehumidification only function Eco function: adjusts cooling on the basis of room temperature in order to optimise energy consumption. Turbo Function: maximum fan speed at the lowest set-point. Silent Function: minimum fan speed to reduce noise Blue Air/Auto Function: automatic fan speed for excellent air flow management. Timer Function: 24 hours timeframe to start or stop settings. SILENT SYSTEM Up to 10%(1) quieter at minimum speed. PRO POWER Super cooling power up to 3.5 kW. DESIGNED IN ITALY Hi-tech goes hand in hand with Made in Italy design. ADVANCED CONTROL WITH TOUCH DISPLAY e latest technology aimed to optimize all available features. MOVING FLAP Enjoy the best comfort experience thanks to the air flow management function. HEAT PUMP MODE Replace or support your heating system (a condensate drain piping is mandatory in heat pump mode). (1) Internal laboratory tests on traditional Olimpia Splendid range (2) In accordance with regulation EN14511 NATURAL REFRIGERANT - R290 e natural refrigerant with the lowest impact on global warming (GWP = 3) 176 HYDRONIC SYSTEMS AIR CONDITIONING product name product code EAN code Rated output power for cooling (1) Rated output power for heating (2) Rated power input for cooling (1) Nominal absorption in cooling mode (1) Rated power input for heating (2) Nominal absorption in heating mode (2) Rated efficiency energy ratio (1) Rated Coefficient of performance (2) Energy Efficiency Class in cooling mode (1) Energy Efficiency Class in heating mode (2) Off mode power consumption ( ON-OFF switch ) ermostat off mode power consumption Standby mode power consumption ( EN 62301 ) Hourly electricity consumption for single duct (1) cooling mode Hourly electricity consumption for single duct (2) heating mode Power supply Power supply min / max Power absorption in cooling mode Maximum absorption in cooling mode Maximum Power absorption in heating mode (3) Maximum absorption in heating mode (3) Max. Dehumidification capacity (5) Room air volume ( max/med/min ) Fan speeds Flexible pipe ( lenght x diameter ) Maximun remote control range ( distance / angle ) Dimensions ( W x H x D ) (without packaging) Dimensions ( W x H x D ) (with packaging) Weight ( without packing ) Weight ( with packaging ) Sound pressure level (4) Sound power level ( indoor only ) ( EN 12102 ) Protection level Refrigerant gas* Global warming potential of refrigerant Refrigerant gas charge Maximum operating pressure Power cable ( N° pole x section mmq ) Fuse Conformity mark Indoor Ambient Temperature Outdoor Ambient Temperature LIMITS OF OPERATING CONDITIONS Maximum temperature in cooling Minimum temperature in cooling Maximum temperature in cooling Minimum temperature in cooling (1) Rated output power for cooling , EER, Hourly consumption, Energy efficiency class tests ( EN 14511 ) (2) Rated output power for heating , COP, Hourly consumption, Energy efficiency class tests ( EN 14511 ) (3) High load test and maximum capacity in heating mode (4) Test conditions: data refers to regulation EN14511 (5) Test conditions: 30 °C DB - 80% UR dry mode *Hermetically sealed equipment Is included a flexible duct to exhaust the air (ø 150 mm, lenght 1,5 m) Prated kW Prated kW PEER kW A PCOP kW A EERrated COPrated DOLCECLIMA® AIR PRO 14 HP 01918 8021183019186 3,5 2,9 1,35 5,90 1,05 5,00 2,6 2,8 W PTO W PSB W QSD kWh/h QSD kWh/h V-F-Hz V W A W A l/h m³/h mm m / ° mm mm kg kg dB(A) min-max LWA dB(A) Tipo-Type GWP kgCO2 eq. kg MPa 0,5 1 0,5 1,35 0,5 220/240-1-50 198 / 264 1600 8,0 1600 8,0 3,3 420 / 370 / 355 3 1500 x 150 8 / ±80° 490 x 765 x 425 535 x 890 x 487 35 38 54 / 54.3 / 54.5 64 IPX0 R290 3 0,23 2,60 3 x 1,5 10AT CE DB 35°C - WB 32°C DB 16°C DB 43°C - WB 32°C DB 18°C - WB 16°C AIR TREATMENT HEATING 177 178 AIR COOLERS 179 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS PELER 4E PELER 4E Cod. 99429 FEATURES Max absorbed power: 75 W Air flow (max): 400 m3/h Max air speed: 5,8 m/s Max power noise level: 63 dB (A) Water tank capacity: 3,5 l Practical wheels Horizontal swing air flow Remote control Timer 1-2-4 h Handle 3 power setting Multifunction control panel Antidust filter COMPACTNESS Compact, space-saving design. REMOTE CONTROL SILENT SYSTEM FILTER Washable fabric Antidust filter. 180 HYDRONIC SYSTEMS AIR CONDITIONING Product code EAN code Power supply Maximum power absorption Stand-by power consumption Fan speeds Air volume (maximum) Air speed (maximum) Sound pressure level (1) Maximum Sound power level (1) Degrees of protection provided by enclosures Insulation class Power cable Water tank capacity Evaporative sheet Control panel Maximun remote control range ( distance / angle ) Conformity Mark Certification Mark Product size (W x H x D) Gift box size (W x H x D) Weight (without packing) Weight (with packing) Units per master box Master size (W x H x D) V/ph/Hz W W n m3/h m/s dB (A) dB (A) n / mm2 l m / ° mm mm kg kg n mm PELER 4E 99429 8021183994292 220-240 / 1 / 50 - 60 75 0,5 3 400 5,8 36 / 48 63 II 2 x 0,75 3,5 honeycomb touch CE TUV 240x610x300 295x610x325 4,5 5,5 - Timer Removable water tank Oscillating function Remote controller Ionizer Wall support Power supply cable housing 1, 2 or 4 hours - (1) Test condition: e sound pressure level is measured in half-anechoic room far 2 meters from the front of the appliance with the microphone at 1 meter of height. During the test, all the appliance functions are enabled with the exception of swing function (if available) AIR TREATMENT HEATING 181 PELER 4 PELER 4 Cod. 99468 FEATURES Max absorbed power: 70 W Air flow: 558 m3/h Max power noise level: 62 dB (A) Water tank capacity:: 4 l Remote control Ionizer Horizontal swing air flow SUPERSLIM DESIGN Compact, space-saving design. OPENABLE TANK Easy accessible water tank. REMOTE CONTROL Removable remote control for more practicality SILENT SYSTEM FILTER Fabric Antidust filter. ION TECHNOLOGY e integrated ionizer guarantees cleaner and revitalized air, by releasing negative ions which eliminate positive ones. 182 HYDRONIC SYSTEMS AIR CONDITIONING Product code Power supply Maximum power absorption Stand-by power consumption Fan speeds Air volume (maximum) Air speed (maximum) Sound pressure level (1) Maximum Sound power level (1) Degrees of protection provided by enclosures Insulation class Power cable Water tank capacity Evaporative sheet Control panel Maximun remote control range ( distance / angle ) Conformity Mark Certification Mark Product size (W x H x D) Gift box size (W x H x D) Weight (without packing) Weight (with packing) Units per master box Master size (W x H x D) V/ph/Hz W W n m3/h m/s dB (A) dB (A) n / mm2 l m / ° mm mm kg kg n mm PELER 4 99468 220-240 / 1 / 50 65 0,2 3 558 8,2 47 - 36 62 I 3 x 0,75 4,0 clotch LED CE TUV Rheinland 292x883x308 330x945x345 5,0 5,5 - Timer Removable water tank Oscillating function Remote controller Ionizer Wall support Power supply cable housing 1, 2 or 4 hours - YES of the horizontal air flow - (1) Test condition: e sound pressure level is measured in half-anechoic room far 2 meters from the front of the appliance with the microphone at 1 meter of height. During the test, all the appliance functions are enabled with the exception of swing function (if available) AIR TREATMENT HEATING 183 PELER 5 PELER 5 Cod. 99454 FEATURES Max absorbed power: 50 W Air flow (max): 400 m3/h Max air speed: 1,1 m/s Max power noise level: 60 dB(A) Water tank capacity: 5,0 l Swing function Removable tank Remote control TOWER ELONGATED DESIGN More beautiful and practical. REMOVABLE TANK Easy to fill and clean. REMOTE CONTROL Removable remote control for more practicality SILENT SYSTEM ANTIDUST FILTER Washable Fabric Antidust filter. 184 HYDRONIC SYSTEMS AIR CONDITIONING Product code Power supply Maximum power absorption Stand-by power consumption Fan speeds Air volume (maximum) Air speed (maximum) Sound pressure level (1) Maximum Sound power level (1) Degrees of protection provided by enclosures Insulation class Power cable Water tank capacity Evaporative sheet Control panel Maximun remote control range ( distance / angle ) Conformity Mark Certification Mark Product size (W x H x D) Gift box size (W x H x D) Weight (without packing) Weight (with packing) Units per master box Master size (W x H x D) V/ph/Hz W W n m3/h m/s dB (A) dB (A) n / mm2 l m / ° mm mm kg kg n mm PELER 5 99454 220-240 / 1 / 50 50 0,5 3 400 1,1 37 - 45 60 II 2 x 0,75 5,0 cloth touch 6 CE Intertek - GS 260x959x260 310x1020x315 6,0 7,0 - Timer Removable water tank Oscillating function Remote controller Ionizer Wall support Power supply cable housing 1, 2, 4 or 8 hours YES of top column - (1) Test condition: e sound pressure level is measured in half-anechoic room far 2 meters from the front of the appliance with the microphone at 1 meter of height. During the test, all the appliance functions are enabled with the exception of swing function (if available) AIR TREATMENT HEATING 185 PELER 6E PELER 6E Cod. 99428 FEATURES Max absorbed power: 70 W Air flow (max): 300 m3/h Max air speed: 5,2 m/s Max power noise level: 62 dB(A) 3 power settings Removable tank 6 Lt Timer 1/2/3 h Washable fabric antidust filter With automatic swing of the horizontal flaps Manual adjustment of the vertical flaps High capacity tank Compact design COMPACTNESS Compact, space-saving design. REMOVABLE TANK Easy to fill and clean. SILENT SYSTEM ANTIDUST FILTER Washable Fabric Antidust filter. 186 HYDRONIC SYSTEMS AIR CONDITIONING Product code Power supply Maximum power absorption Stand-by power consumption Fan speeds Air volume (maximum) Air speed (maximum) Sound pressure level (1) Maximum Sound power level (1) Degrees of protection provided by enclosures Insulation class Power cable Water tank capacity Evaporative sheet Control panel Maximun remote control range ( distance / angle ) Conformity Mark Certification Mark Product size (W x H x D) Gift box size (W x H x D) Weight (without packing) Weight (with packing) Units per master box Master size (W x H x D) V/ph/Hz W W n m3/h m/s dB (A) dB (A) n / mm2 l m / ° mm mm kg kg n mm PELER 6E 99428 220-240 / 1 / 50 70 0,4 3 300 5,2 37 - 45 62 II 2 x 0,75 6,0 honeycomb buttons CE Intertek 238x683x302 286x745x340 5,4 7,0 - Timer Removable water tank Oscillating function Remote controller Ionizer Wall support Power supply cable housing 1, 2, 4 or 3 hours YES of horizontal air flow flaps - (1) Test condition: e sound pressure level is measured in half-anechoic room far 2 meters from the front of the appliance with the microphone at 1 meter of height. During the test, all the appliance functions are enabled with the exception of swing function (if available) AIR TREATMENT HEATING 187 PELER 7 PELER 7 Cod. 99453 FEATURES Max absorbed power: 90 W Air flow (max): 700 m3/h Max air speed: 3,5 m/s Max power noise level: 63 dB(A) Water tank capacity: 7,0 l Swing function Removable water tank Remote control Ionizer Honeycomb filter REMOVABLE TANK Easy to fill and clean. ION TECHNOLOGY e integrated ionizer guarantees cleaner and revitalized air, by releasing negative ions which eliminate positive ones. HONEYCOMB FILTER It gives more fresh air. REMOTE CONTROL Removable remote control for more practicality. SILENT SYSTEM 188 HYDRONIC SYSTEMS AIR CONDITIONING Product code Power supply Maximum power absorption Stand-by power consumption Fan speeds Air volume (maximum) Air speed (maximum) Sound pressure level (1) Maximum Sound power level (1) Degrees of protection provided by enclosures Insulation class Power cable Water tank capacity Evaporative sheet Control panel Maximun remote control range ( distance / angle ) Conformity Mark Certification Mark Product size (W x H x D) Gift box size (W x H x D) Weight (without packing) Weight (with packing) Units per master box Master size (W x H x D) V/ph/Hz W W n m3/h m/s dB (A) dB (A) n / mm2 l m / ° mm mm kg kg n mm PELER 7 99453 220-240 / 1 / 50 90 0,5 3 700 3,5 34 - 48 63 II 2 x 0,75 7,0 honeycomb touch 6 CE Intertek - GS 267x809x333 310x865x380 7,5 8,5 - Timer Removable water tank Oscillating function Remote controller Ionizer Power off switch Power supply cable housing 0,5 to 7,5 hours YES of the air flow (1) Test condition: e sound pressure level is measured in half-anechoic room far 2 meters from the front of the appliance with the microphone at 1 meter of height. During the test, all the appliance functions are enabled with the exception of swing function (if available) AIR TREATMENT HEATING 189 PELER 20 PELER 20 Cod. 99355 FEATURES Max absorbed power: 110 W Air flow (max): 600 m3/h Max air speed: 9 m/s Max power noise level dB (A): 60 4 air flow speed Back housing for slim remote control 1- 2- 4 - 8 hours timer Anti-dust filter Handy wheels for transportation Cable reel 20 L TANK WITH FILLING FROM ABOVE OR BELOW Large 20 lt tank for long autonomy, with easy filling from above, so it does not have to be removed from its seat . TOUCH SCREEN DISPLAY TECHNOLOGY Innovative control panel with touch sensors. AIR FLOW AUTO-SWING Continuous and automatic air flow swing from right to left. DUAL FUNCTION: FAN /COOLER Functions with or without water, respectively as a cooler or fan. 3 FAN SPEEDS Ventilation with three practical air flow intensity adjustments. 190 HYDRONIC SYSTEMS AIR CONDITIONING Product code EAN code Power supply Maximum power absorption Stand-by power consumption Fan speeds Air volume (maximum) Air speed (maximum) Sound pressure level (1) Maximum Sound power level (1) Insulation class Power cable Water tank capacity Evaporative sheet Control panel Product size (W x H x D) Gift box size (W x H x D) Weight (without packing) Weight (with packing) V/ph/Hz W W n m3/h m/s dB (A) dB (A) n / mm2 l mm mm kg kg PELER 20 99355 8021183993554 220-240 / 1 / 50 110 0,45 4 600 9,0 51 60 II 2 x 0,75 20,0 Honeycomb Touch 342x897x390 405x960x440 8,0 10,5 Timer Removable water tank Oscillating function Remote controller Ionizer Weels Power off switch Power supply cable housing 1 - 2 -4 -8 hours YES of the air flow from right to left (1) Test condition: e sound pressure level is measured in half-anechoic room far 2 meters from the front of the appliance with the microphone at 1 meter of height. During the test, all the appliance functions are enabled with the exception of swing function (if available) AIR TREATMENT HEATING 191 PELER CHILL Misting cooler for immediate freshness. PELER CHILL Cod. 99356 FEATURES Misting cooler 2 L Tank Mist function Airclean function Wheels for transportation LED Display Mosquito repellent function 360° grid rotation Remote control Up to 9 hours timer MIST FUNCTION Creates a moist breeze for an immediate sensation of freshness. EASY TO USE Remote control and handy wheels for transportation. PROGRAMMING WITH TIMER Operation up to 9.5 hours. AIRCLEAN FUNCTION Ionizer and integrated mosquito repellent function* for cleaner air. 360° GRID ROTATION For uniform diffusion of the air flow. WATER LEVEL DISPLAY Luminous indicator that shows the amount of water in the tank. *mosquito repellent tablets housing compatible with the most common tablets on the market, not included. 192 HYDRONIC SYSTEMS AIR CONDITIONING Product code EAN code Power supply Maximum power absorption Stand-by power consumption Fan speeds Air volume (maximum) Air speed (maximum) Water tank capacity Product size (W x H x D) Units per master box V/ph/Hz W W n m3/h n / mm2 l mm n PELER CHILL 99356 8021183993561 220-240 / 1 / 50 80 0,59 3 789 2 x 0,75 2 402x816x216 2 Timer Umidification function Cold ultrasound technology Display Removable water tank Oscillating function Remote controller Ionizer Mosquito trepellent function Power off switch Power supply cable housing - (1) Test condition: e sound pressure level is measured in half-anechoic room far 2 meters from the front of the appliance with the microphone at 1 meter of height. During the test, all the appliance functions are enabled with the exception of swing function (if available) AIR TREATMENT HEATING 193 194 DEHUMIDIFIERS 195 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS AQUARIA SLIM 10 P AQUARIASLIM10P Cod.01939 FEATURES Dehumidification capacity: 10 l/24h(1) Tank capacity: 2 l Constant condensation disposal Defrosting device Ambient humidity display Air filter Full tank alarm Ergonomic handle Wheels Maximum volume of dehumidification: 100 m3 SLIM DESIGN Only 185 mm thickness. DIGITAL TOUCH DISPLAY For precision commands. SEMI-TRANSPARENT TANK To view the water level. PRACTICAL anks to the handle and the transportable wheels. 196 Dehumidification capacity (1) Dehumidification capacity (2) Dehumidificable volume Power absorption in dehumidifcation mode (1) Max. power absorption in dehumidification mode (2) Max. absorption in dehumidification mode (2) Protection level Fan speeds Tank capacity Air volume ( max ) Dimensions (W x H x D with wheels) Packing dimensions (W x H x D) Noise level Weight (without packing) Weight (with packing) Refrigerant gas Global warming potential of refrigerant GWP Refrigerant gas charge Plug Power supply Power supply min - max Fuse Conformity Mark Air filter Carbon filter Continuous operation with hose Dehumidistat Humidity level power settings Indoor humidity visualizer Indoor temperature visualizer Tank full light Defrosting device Heating function with adjustable temperature Dehumidifing + heating function (1) DB 27°C - WB 21°C ( 27°C - 60% RH ) (2) DB 32°C - WB 29°C ( 32°C - 80% RH ) *hermetically sealed equipment containing fluorinated gas GWP 1430 Code EAN l/24h l/24h m³ W W A l m³/h mm mm dB(A) kg kg Tipo-Type kgCO2 eq. kg V-F-Hz V AQUARIA SLIM 10 P 01939 8021183019391 5.4 10 100 280 262 1,39 IP 20 1 2,0 120 276X500X185 315X555X215 42 9,5 10,4 R290 3 0,045 SCHUKO 220-240 - 1 - 50 207- 254 2 AT CE 197 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS AQUARIA SILENT 14 AQUARIASILENT14 Cod.01667 FEATURES Dehumidification capacity: 14l*/24h Tank capacity: 2 l Sound level: only 36 dB (A) Full tank alarm Continuous operation with hose Electronic defrosting device Visible water level - transparent tank Handle Dehumidificable volume: 120-140 m3 SILENT SYSTEM Aquaria Silent 14 is among the quietest dehumidifiers in its category, more than 10%quieter with a sound level of only 36 dB (A) QUICK CONTROL Extremely easy to use mechanical control to adjust room humidity. (1) 32° C 80 %RH (2) Internal tests on the range Olimpia Splendid 198 Dehumidification capacity (1) Dehumidification capacity (2) Dehumidificable volume Heating capacity Power absorption in dehumidifcation mode (1) Max. power absorption in dehumidification mode (2) Max. power absorption in dehumidification+heating mode (2) Fan speeds Tank capacity Air volume ( max ) Dimensions (W x H x D) Noise level Weight Refrigerant gas / charge Power supply Power supply min - max Air filter Carbon filter Photocatalytic filter HEPA filter Continuous operation with hose Machanical controls Digital control Mechanical humidistat Electronic humidistat LCD Display Backlit liquid crystal display Indoor humidity visualizer Indoor temperature visualizer Tank full light Defrosting device Hot gas defrosting system Dehumidifing + heating function Handle Wheels Concealed tank with push-pull panel Water tank with handle Visible water level Wall mounting kit (1) DB 27°C - WB 21°C ( 27°C - 60% RH ) (2) DB 32°C - WB 29°C ( 32°C - 80% RH ) *hermetically sealed equipment containing fluorinated gas GWP 1430 Code EAN l/24h l/24h m³ W W W W l m³/h mm db(A) Kg Type / kg V-F-Hz V AQUARIA SILENT 14 01667 8021183016673 6,2 14 120 172 214 1 2 80 307 x 427 x 258 36 12,8 R134A / 0,110 / 1430 230 - 1 - 50 216/244 199 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS AQUARIA 16 AQUARIA 16 Cod. 01440 FEATURES Dehumidification capacity: 16 l*/24h Tank capacity: 1,8 l Sound power: 40 dB (A) Digital control Drying mode: constant and fast dehumidification LCD Display Full tank alarm Constant condensation disposal Electronic defrosting device visible water level and transparent tank Handle Wheels Maximum volume of dehumidification: 120-140 m3 Design by Ercoli & Garlandini PURE SYSTEM Mechanic air filtration system, for better air quality. EASY TO USE Equipped with barycentric and ergonomic handle, and wheels for easier transport. DIGITAL CONTROL Multifunction electronic panel, to set the desired humidity level and activate the Drying mode, Equipped with back-lit LCD display to view humidity level and ambient temperature. COMPACT TECHNOLOGY In just25 cm of depth and a height of 45 cm, a dehumidification capacity of 16 l/24h. TURBO/DRYING is function optimizes the laundry's drying process by constantly operating the dehumidifier at full power. (1) 32° C 80 %RH 200 Dehumidification capacity (1) Dehumidification capacity (2) Humidificable Area Heating power Power consumption in dehumidification (1) Max Power consumption in dehumidification (2) Max Power consumption in dehumidification + heating (2) Fan speed Tank capacity Air flow rate ( max ) Dimensions (Width x H x Depth) Sound level Weight Refrigerant gas / Charge / GWP* Power supply Minimum/maximum power supply voltage Air filter Active carbon filter Fotocathalitic filter HEPA filter Operation with continuous drain Mechanical controls Electronic controls Mechanical Humidostat Digital Humidostat LCD Display Backlight LED Display Indoor humidity visualizer Indoor temperature visualizer Tank full light Defrosting device Mot gas defrosting system Dehumidifing + heating function (with electrical resistance) Handle Wheels Tank with push-pull locking Tank with handle Visible water level Wall mounting kit (1) DB 27°C - WB 21°C ( 27°C - 60% RH ) (2) DB 32°C - WB 29°C ( 32°C - 80% RH ) *hermetically sealed equipment containing fluorinated gas GWP 1430 Code EAN l/24h l/24h m³ W W W W l m³/h mm db(A) Kg Type / kg V-F-Hz V AQUARIA 16 01440 8021183014402 6,5 16 243 312 1 1,8 170 305X464X261 40 12 R410A / 0,130 / 1430 230 - 1 - 50 216/244 201 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS AQUARIA 16T AQUARIA 16T Cod. 01446 FEATURES Dehumidification capacity: 16 l/24h(1) Tank capacity: 1,8 l Electrical Resistance 1000W Sound power: 40 dB (A) Digital control Drying mode: constant and fast dehumidification LCD Display Full tank alarm Constant condensation disposal Electronic defrosting device visible water level and transparent tank Handle Wheels Maximum volume of dehumidification: 120-140 m3 Design by Ercoli & Garlandini PURE SYSTEM Mechanic air filtration system, for better air quality. SUPER DEHUMIDIFICATION Combines dehumidification with heating thanks to a 1000 W electrical element that significantly reduces dehumidification time. DIGITAL CONTROL Multifunction electronic panel, to set the desired humidity level and activate the Drying mode, Equipped with back-lit LCD display to view humidity level and ambient temperature. COMPACT TECHNOLOGY In just25 cm of depth and a height of 45 cm, a dehumidification capacity of 16 l/24h. EASY TO USE Equipped with barycentric and ergonomic handle, and wheels for easier transport. TURBO/DRYING is function optimizes the laundry's drying process by constantly operating the dehumidifier at full power. (1) 32° C 80 %RH 202 Dehumidification capacity (1) Dehumidification capacity (2) Humidificable Area Heating power Power consumption in dehumidification (1) Max Power consumption in dehumidification (2) Max Power consumption in dehumidification + heating (2) Fan speed Tank capacity Air flow rate ( max ) Dimensions (Width x H x Depth) Sound level Weight Refrigerant gas / Charge / GWP* Power supply Minimum/maximum power supply voltage Air filter Active carbon filter Fotocathalitic filter HEPA filter Operation with continuous drain Mechanical controls Electronic controls Mechanical Humidostat Digital Humidostat LCD Display Backlight LED Display Indoor humidity visualizer Indoor temperature visualizer Tank full light Defrosting device Mot gas defrosting system Dehumidifing + heating function (with electrical resistance) Handle Wheels Tank with push-pull locking Tank with handle Visible water level Wall mounting kit (1) DB 27°C - WB 21°C ( 27°C - 60% RH ) (2) DB 32°C - WB 29°C ( 32°C - 80% RH ) *hermetically sealed equipment containing fluorinated gas GWP 1430 Code EAN l/24h l/24h m³ W W W W l m³/h mm db(A) Kg Type / kg V-F-Hz V AQUARIA 16T 01446 8021183014464 6,5 16 120-140 1000 243 312 1 1,8 170 305X464X261 40 12 R410A / 0,130 / 1430 230 - 1 - 50 216/244 203 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS AQUARIA 22 AQUARIA 22 Cod. 01644 FEATURES Dehumidification capacity: 22 l/24h(1) Tank capacity: 3.5 l Digital control LCD Display Full tank alarm Constant condensation disposal Electronic defrosting device Hidden tank with push-pull closing panel Water tank with handle, for easier transport and emptying Visible water level Hidden handle Wheels Cable winder Maximum volume of dehumidification: 120-140 m3 Design by King & Miranda PURE SYSTEM 3 Triple filtration system which combines the filter with activated carbons (eliminates odors and deactivates any potentially harmful gases) HEPA filter (retains fine dust with a few microns diameter) Photo catalytic filter (sterilizes air by eliminating a high percentage of viruses and bacteria). NON-STOP OPERATING e constant condensation disposal, which can be selected on the control panel, allows uninterrupted dehumidification. DIGITAL CONTROL Multifunction electronic panel, to set the desired humidity level and activate the Drying mode; moreover, Aquaria is equipped with back-lit LCD display to view humidity level and ambient temperature. BACK CABLE WINDER Cable winder to tidily put the product away. (1) 32° C 80 %RH 204 LARGE TANK e tank contains 3.5 l and it can be easily extracted. Dehumidification capacity (1) Dehumidification capacity (2) Dehumidificable Area Heating power Power consumption in dehumidification (1) Max Power consumption in dehumidification (2) Max Power consumption in dehumidification + heating (2) Fan speed Tank capacity Air flow rate ( max ) Dimensions (Width x H x Depth) Sound level Weight Refrigerant gas / Charge / GWP* Power supply Minimum/maximum power supply voltage Air filter Active carbon filter Fotocathalitic filter HEPA filter Operation with continuous drain Mechanical controls Electronic controls Mechanical Humidostat Digital Humidostat LCD Display Backlight LED Display Indoor humidity visualizer Indoor temperature visualizer Tank full light Defrosting device Mot gas defrosting system Dehumidifing + heating function (with electrical resistance) Handle Wheels Tank with push-pull locking Tank with handle Visible water level Wall mounting kit (1) DB 27°C - WB 21°C ( 27°C - 60% RH ) (2) DB 32°C - WB 29°C ( 32°C - 80% RH ) *hermetically sealed equipment containing fluorinated gas GWP 1430 Code EAN l/24h l/24h m³ W W W W l m³/h mm db(A) Kg Type / kg V-F-Hz V AQUARIA 22 01644 8021183016444 13, 5 22 120/140 250 295 1 3,5 230 280 x 545 x 385 40 17 R134A / 0,175 / 1430 230 - 1 - 50 198 / 264 205 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS AQUARIA THERMO 22 AQUARIA THERMO 22 Cod. 01645 FEATURES Dehumidification capacity: 22l/24h(1) Tank capacity: 3,5 l Electrical Resistance 1000W Digital control LCD Display Full tank alarm Constant condensation disposal Electronic defrosting device Hidden tank with push-pull closing panel Water tank with handle, for easier transport and emptying Visible water level Handle Wheels Maximum volume of dehumidification: 120-140 m3 Design by King & Miranda PURE SYSTEM 3 Triple filtration system which combines the filter with activated carbons (eliminates odors and deactivates any potentially harmful gases) HEPA filter (retains fine dust with a few microns diameter) Photo catalytic filter (sterilizes air by eliminating a high percentage of viruses and bacteria). SUPER DEHUMIDIFICATION Combines dehumidification with heating thanks to a 1000 W electrical element that significantly reduces dehumidification time. DIGITAL CONTROL Multifunction electronic panel, to set the desired humidity level and activate the Drying mode; moreover, Aquaria is equipped with back-lit LCD display to view humidity level and ambient temperature. BACK CABLE WINDER Cable winder to tidily put the product away. (1) 32° C 80 %RH 206 Dehumidification capacity (1) Dehumidification capacity (2) Dehumidificable Area Heating power Power consumption in dehumidification (1) Max Power consumption in dehumidification (2) Max Power consumption in dehumidification + heating (2) Fan speed Tank capacity Air flow rate ( max ) Dimensions (Width x H x Depth) Sound level Weight Refrigerant gas / Charge / GWP* Power supply Minimum/maximum power supply voltage Air filter Active carbon filter Fotocathalitic filter HEPA filter Operation with continuous drain Mechanical controls Electronic controls Mechanical Humidostat Digital Humidostat LCD Display Backlight LED Display Indoor humidity visualizer Indoor temperature visualizer Tank full light Defrosting device Mot gas defrosting system Dehumidifing + heating function (with electrical resistance) Handle Wheels Tank with push-pull locking Tank with handle Visible water level Wall mounting kit (1) DB 27°C - WB 21°C ( 27°C - 60% RH ) (2) DB 32°C - WB 29°C ( 32°C - 80% RH ) *hermetically sealed equipment containing fluorinated gas GWP 1430 Code EAN l/24h l/24h m³ W W W W l m³/h mm db(A) Kg Type / kg V-F-Hz V AQUARIA THERMO 22 01645 8021183016451 13,5 22 200 1000 250 295 1315 1 3,5 250 280 x 545 x 385 40 17 R134A / 0,175 / 1430 230 - 1 - 50 198 / 264 207 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS AQUARIA 28 AQUARIA 28 Cod. 01646 FEATURES Dehumidification capacity: 28l/24h(1) Tank capacity: 3.5 l Digital control LCD Display Full tank alarm Constant condensation disposal Electronic defrosting device Hidden tank with push-pull closing panel Water tank with handle, for easier transport and emptying Visible water level Hidden handle Wheels Cable winder Maximum volume of dehumidification: 240 m3 Design by King & Miranda PURE SYSTEM 3 Triple filtration system which combines the filter with activated carbons (eliminates odors and deactivates any potentially harmful gases) HEPA filter (retains fine dust with a few microns diameter) Photo catalytic filter (sterilizes air by eliminating a high percentage of viruses and bacteria). DIGITAL CONTROL Multifunction electronic panel, to set the desired humidity level and activate the Drying mode; moreover, Aquaria is equipped with back-lit LCD display to view humidity level and ambient temperature. (1) 32° C 80 %RH 208 HYDRONIC SYSTEMS AIR CONDITIONING Dehumidification capacity (1) Dehumidification capacity (2) Dehumidificable Area Heating power Power consumption in dehumidification (1) Max Power consumption in dehumidification (2) Max Power consumption in dehumidification + heating (2) Fan speed Tank capacity Air flow rate ( max ) Dimensions (Width x H x Depth) Sound level Weight Refrigerant gas / Charge / GWP* Power supply Minimum/maximum power supply voltage Air filter Active carbon filter Fotocathalitic filter HEPA filter Operation with continuous drain Mechanical controls Electronic controls Mechanical Humidostat Digital Humidostat LCD Display Backlight LED Display Indoor humidity visualizer Indoor temperature visualizer Tank full light Defrosting device Mot gas defrosting system Dehumidifing + heating function (with electrical resistance) Handle Wheels Tank with push-pull locking Tank with handle Visible water level Wall mounting kit (1) DB 27°C - WB 21°C ( 27°C - 60% RH ) (2) DB 32°C - WB 29°C ( 32°C - 80% RH ) *hermetically sealed equipment containing fluorinated gas GWP 1430 Code EAN l/24h l/24h m³ W W W W l m³/h mm db(A) Kg Type / kg V-F-Hz V AQUARIA 28 01646 8021183016468 15 28 240 425 510 1 3,5 285 280 x 545 x 385 42 18 R134A / 0,160 / 1430 230 - 1 - 50 207 / 264 AIR TREATMENT HEATING 209 SECCOPROF SECCOPROF 28 Cod. 01208 SECCOPROF 38 Cod. 01209 Design by King & Miranda FEATURES OF SECCOPROF 28 Dehumidification capacity: 22 l/24h(1) Tank capacity: 3.5 l Digital control LCD Display Visible water level Full tank alarm Double handle Wheels Maximum volume of dehumidification: 250 m3 FEATURES OF SECCOPROF 38 Dehumidification capacity: 38 l/24h(1) Tank capacity: 10 l Warm gas defrosting Digital control LCD Display Visible water level Full tank alarm Double handle Wheels Maximum volume of dehumidification: 330 m3 SUPER POWER e products in the SeccoProf range are extremely powerful, and they can absorb up to 38 l of excess humidity per day, thus allowing to dehumidify large spaces. NON-STOP OPERATING e constant condensation disposal, which can be selected on the control panel, allows uninterrupted dehumidification. DIGITAL CONTROL Multifunction electronic panel, to set the desired humidity level and activate the Drying mode; moreover, Aquaria is equipped with back-lit LCD display to view humidity level and ambient temperature. WARM GAS DEFROSTING Guarantees a constant operation of the compressor, avoiding frequent activation and deactivation periods. It also allows the product to work even near 0°C(2). IRON SHAPE Its metal frame makes the Seccoprof range solid and corrosion- and impact-resistant. (1) 32° C 80 %RH (2) Only model SeccoProf 38 210 HYDRONIC SYSTEMS AIR CONDITIONING Dehumidification capacity (1) Dehumidification capacity (2) Humidificable Area Heating power Power consumption in dehumidification (1) Max Power consumption in dehumidification (2) Max Power consumption in dehumidification + heating (2) Fan speed Tank capacity Air flow rate ( max ) Dimensions (Width x H x Depth) Sound level Weight Refrigerant gas / Charge / GWP* Power supply Minimum/maximum power supply voltage Air filter Active carbon filter Fotocathalitic filter HEPA filter Operation with continuous drain Mechanical controls Electronic controls Mechanical Humidostat Digital Humidostat LCD Display Backlight LED Display Indoor humidity visualizer Indoor temperature visualizer Tank full light Defrosting device Mot gas defrosting system Dehumidifing + heating function (with electrical resistance) Handle Wheels Tank with push-pull locking Tank with handle Visible water level Wall mounting kit (1) DB 27°C - WB 21°C ( 27°C - 60% RH ) (2) DB 32°C - WB 29°C ( 32°C - 80% RH ) *hermetically sealed equipment containing fluorinated gas GWP 1430 Code EAN l/24h l/24h m³ W W W W l m³/h mm db(A) Kg Type / kg V-F-Hz V SECCOPROF 28 01208 8021183012088 15 28 250 450 550 1 10 340 310 x 650 x 435 47 23 R410A / 0,260 / 1430 230 - 1 - 50 198 / 264 SECCOPROF 38 01209 8021183012095 20 38 330 500 585 1 10 350 310 x 650 x 435 49 25 R410A / 0,330 / 1430 230 - 1 - 50 198 / 244 AIR TREATMENT HEATING 211 212 HUMIDIFIERS 213 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS NEWLIMPIA 2 LIMPIA 2 Cod. 99423 FEATURES Cold ultrasound technology Humidification capacity 150 ml/h LED light for chromotherapy Tank capacity: 2 l 8h timer Empty tank alarm Cleaning brush included CHANGING COLOURED LED LIGHT DISPLAY TOUCH l TANK CAPACITY 2L 8h 8H TOUCH DISPLAY TIMER 214 HYDRONIC SYSTEMS AIR CONDITIONING Humidification capacity (cold mist) Humidificable Area Power absorption (cold mist) Protection level Tank capacity Master box quantity Dimensions (W x H x D) Packing dimensions (W x H x D) Master Box dimensions (W x H x D) Weight (without packing) Weight (with packing) Power supply Conformity Mark Ultrasonic technology cold mist Electromechanical controls Digital control Display Indoor humidity visualizer Tank empty signal Warm steam function Night light Adjustable steam nozzle Ionizer Remote controller Automatic re-start function on return of mains voltage Timer Cod. EAN ml/h m3 W l mm mm mm Kg Kg V-F-HZ LIMPIA 2 99673 8021183996739 125 25 12 IP X0 2,0 4 180 X 189 X 180 215 x 226 x 215 450 X 246 X 445 0,80 1,20 100-240 - 1 - 50/60 CE AIR TREATMENT HEATING 215 NEWLIMPIA 4 LIMPIA 4 Cod. 99424 FEATURES Cold ultrasound technology Humidification capacity 300 ml/h Remote control Coloured LED light for chromotherapy Vapour intensity continuous adjustment Tank capacity: 4 l 8h timer Empty tank alarm CHROMOTHERAPY REMOTE CONTROL VARIO POWER Continuous adjustment of the humidity emitted. 4l TANK CAPACITY 4L 8h TIMER 8h timer 216 HYDRONIC SYSTEMS AIR CONDITIONING Humidification capacity (cold mist) Humidificable Area Power absorption (cold mist) Protection level Tank capacity Master box quantity Dimensions (W x H x D) Packing dimensions (W x H x D) Master Box dimensions (W x H x D) Weight (without packing) Weight (with packing) Power supply Conformity Mark Ultrasonic technology cold mist Electromechanical controls Digital control Display Indoor humidity visualizer Tank empty signal Warm steam function Night light Adjustable steam nozzle Ionizer Remote controller Automatic re-start function on return of mains voltage Timer Cod. EAN ml/h m3 W l mm mm mm Kg Kg V-F-HZ LIMPIA 4 99424 8021183994230 300 35 25 IP X0 4,0 4 204 X 290 X 205 245 x 340 x 235 510 X 360 X 485 1,20 1,80 100-240 - 1 - 50/60 CE AIR TREATMENT HEATING 217 NEWLIMPIA 6 LIMPIA 6 Cod. 99425 FEATURES Cold ultrasound technology Humidification capacity 330 ml/h Vapour pre-heat function Digital touch display 3 humidity emission settings Draw for essential oils Slim remote control Night light Tank capacity: 6 l 8h timer Empty tank alarm Two-way vapour emission 3 HUMIDITY EMISSION SETTINGS FRAGRANCE DIFFUSER l TANK CAPACITY 6L REMOTE CONTROL 218 HYDRONIC SYSTEMS AIR CONDITIONING Humidification capacity (cold mist) Humidificable Area Power absorption (cold mist) Protection level Tank capacity Master box quantity Dimensions (W x H x D) Packing dimensions (W x H x D) Master Box dimensions (W x H x D) Weight (without packing) Weight (with packing) Power supply Conformity Mark Ultrasonic technology cold mist Electromechanical controls Digital control Display Indoor humidity visualizer Tank empty signal Warm steam function Night light Adjustable steam nozzle Ionizer Remote controller Automatic re-start function on return of mains voltage Timer Cod. EAN ml/h m3 W l mm mm mm Kg Kg V-F-HZ LIMPIA 6 99425 8021183994254 290 / 330 50 25 / 55 IP X0 6,0 4 290 X 337 X 170 315 x 360 x 195 650 X 380 X 405 2,00 2,30 220-240 - 1 - 50/60 CE AIR TREATMENT HEATING 219 LIMPIA PURE LIMPIA PURE Cod. 99483 FEATURES Cold and hot Ultrasound technology Humidification capacity 300 ml /h (cold steam) 400 ml /h (hot cold) Tank capacity: 3,5l Touch controls Humidifing + heating function Full tank alarm Humidificable volume: 40 m3 WATER PRE-HEATING anks to the pre-heating function the product has an highest performance, improving the quantity of the humidity in the air: 30%* more. TOUCH BUTTONS Touch bright buttons that are hidden when the product is off, lighted when the product is on. * Compared to the itself product used in normal conditions. 220 HYDRONIC SYSTEMS Humidification capacity (cold steam / hot steam) Humidificable volume Power absorption (cold steam / hot steam) Tank capacity Dimensions (W x H x D) Weight (without packing) Power supply Cold and hot ultrasound technology Ionizer Touch controls Digital control Display Indoor humidity visualizer Tank full light Humidifing + heating function Hot steam function Setting steam level Night light Directionality steam flow Remote control Code EAN ml/h m3 W l mm Kg V-F-Hz LIMPIA PURE 99483 8021183994834 300/400 40 30/90 3,5 214 x 255 x 214 1,25 100-240V, 50/60Hz AIR CONDITIONING AIR TREATMENT HEATING 221 AQUA PURE AQUA PURE Cod. 99482 FEATURES Cold and hot Ultrasound technology Humidification capacity 300 ml /h (cold steam) 400 ml /h (hot steam) Tank capacity: 5l Touch controls Hot steam function Full tank alarm Humidificable volume: 50 m3 WATER PRE-HEATING anks to the pre-heating function the product has an highest performance, improving the quantity of the humidity in the air: 30%* more. STEAM SUPPLY It's possible to decide the speed of the steam: minimum, medium, maximum, through two different ways thanks to the double hole on the top spout. DESIRED HUMIDITY Set up the desired humidity from 40% to 70%. TOUCH DISPLAY Touch technology: allow to enter to all functionalities in a simple and immediate way. * Compared to the itself product used in normal conditions 222 HYDRONIC SYSTEMS AIR CONDITIONING Dehumidification capacity (cold steam / hot steam) Dehumidificable volume Power absorption (cold steam / hot steam) Heating capacity Tank capacity Dimensions (W x H x D) Weight (without packing) Power supply Cold and hot ultrasound technology Ionizer Touch controls Digital control Display Indoor humidity visualizer Tank full light Dehumidifing + heating function Hot steam function Setting desired humidity from 40% to 70% Setting steam level Automatic timer shutdown from 1 to 12 h Setting pre-heating water Night light Directionality steam flow Remote control Code EAN ml/h m3 W l mm Kg V-F-Hz AQUA PURE 99482 8021183994827 300/400 50 30/90 3 5 248 x 355 x 130 2,25 100-240V, 50/60Hz AIR TREATMENT HEATING 223 224 AIR PURIFIERS 225 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS NEWAURA LI AURA LI Cod. 99427 FEATURES 3 filtering stages (dust filter/HEPA filter/active carbon filter) Air quality luminous indication Filter pack removable from front panel Ionizer Automatic fan speed operation according to the quality of air detected Filter duration up to 2000 h 8h timer Sleep/Turbo function 3 air flow rate settings CODE B0845 DESCRIPTION AURA LI Filter Kit 3 FILTERING STAGES With pre-filter. HEPA filter and active carbon filter. IONIZER AUTOMATIC ADJUSTMENT Depending on the quality of the air. MULTI-FUNCTION CONTROL PANEL DURATION OF THE FILTER Up to 2000h. 226 HYDRONIC SYSTEMS AIR CONDITIONING Power absorption Protection level Protection class Fan speeds Sound pressure level Dimensions (w x h x d) Packing dimensions (w x h x d) Weight (without packing) Weight (with packing) Power supply Conformity mark Digital control Air quality indicator led Air quality indicator display Filter cleaning/replacing signal Ionizer UV lamp HEPA filter Carbon filter Remote controller Automatic re-start function on return of mains voltage Timer Cod. EAN W dB(A) min-max mm mm kg kg V-F-Hz AURA LI 99427 8021183994278 55 IP X0 II 3 25 / 54 345 x 583 x 176 360 x 600 x 191 5,60 6,70 220-240 - 1 - 50 CE AIR TREATMENT HEATING 227 NEWAURA DI AURA DI Cod. 99426 FEATURES 3 filtering stages (dust filter/HEPA filter/active carbon filter) Germicidal UV light Filter pack removable from front panel Ionizer Particulate concentration digital indicator Automatic fan speed operation according to the quality of air detected Filter duration up to 2000 h 8h timer Sleep/Turbo function 3 air flow rate settings CODE B0846 DESCRIPTION AURA DI Filter Kit 3 FILTERING STAGES With pre-filter. HEPA filter and active carbon filter. UV STERILIZER AND IONIZER WITHHOLDS FINE DUSTS Up to 2.5 micron. AUTOMATIC ADJUSTMENT Depending on the quality of the air. MULTI-FUNCTION CONTROL PANEL FILTER DURATION Up to 2000h. 228 HYDRONIC SYSTEMS AIR CONDITIONING Protection level Protection class Fan speeds Sound pressure level Dimensions (w x h x d) Packing dimensions (w x h x d) Weight (without packing) Weight (with packing) Power supply Conformity mark Digital control Air quality indicator led Air quality indicator display Filter cleaning/replacing signal Ionizer UV lamp HEPA filter Carbon filter Automatic re-start function on return of mains voltage Timer Cod. EAN dB(A) min-max mm mm Kg Kg V-F-Hz AURA DI 99426 8021183994261 IP X0 II 3 25 / 54 345 x 583 x 176 360 x 600 x 191 5,60 6,70 220-240 - 1 - 50 CE AIR TREATMENT HEATING 229 230 AROMA DIFFUSERS 231 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS NEWASTOMI 80 ASTOMI 80 Cod. 99407 FEATURES Tank capacity 80 ml Changing LED light for chromotherapy USB cable power supply unit 6 h continuous operation Automatic switch-off with empty tank 6h 6H AUTONOMY COMPACT DESIGN SAFE AND ALWAYS WITH YOU CHROMOTHERAPY 232 HYDRONIC SYSTEMS AIR CONDITIONING Humidification capacity (cold mist) Humidificable Area Power absorption (cold mist) Protection level Protection class Fan speeds Tank capacity Master box quantity Dimensions (W x H x D) Packing dimensions (W x H x D) Master Box dimensions (W x H x D) Weight (without packing) Weight (with packing) Master box weight Power supplier Power supply Conformity Mark Ultrasonic technology cold mist Electromechanical controls Digital control Display Indoor humidity visualizer Tank empty signal Warm steam function Night light Adjustable steam nozzle Ionizer Remote controller Automatic re-start function on return of mains voltage Timer Bluetooth Cod. EAN ml/h m3 W ml mm mm mm kg kg kg V-F-Hz ASTOMI 80 99407 8021183994070 20 10 5 IP X0 III 1 80 24 110 x 129 x 110 115 X 137 X 115 483 X 293 X 361 0,22 0,29 8 USB CABLE 5VDC 1A CE AIR TREATMENT HEATING 233 NEWASTOMI 200 ASTOMI 200 Cod. 99406 FEATURES Tank capacity 200 ml Changing LED light for chromotherapy Humidification capacity: 25 ml/h Corrosion-proof polypropylene material 9 h continuous operation Automatic switch-off with empty tank Multi-function touch key 9h 9H AUTONOMY 2 IN 1: HUMIDIFIER AND FRAGRANCE DIFFUSER CHROMOTHERAPY WITH AN ARRAY OF UP TO 6 LIGHT COLOURS SAFE WITH AUTOMATIC SWITCH-OFF 234 HYDRONIC SYSTEMS AIR CONDITIONING Humidification capacity (cold mist) Humidificable Area Power absorption (cold mist) Protection level Protection class Fan speeds Tank capacity Master box quantity Dimensions (W x H x D) Packing dimensions (W x H x D) Master Box dimensions (W x H x D) Weight (without packing) Weight (with packing) Master box weight Power supplier Power supply Conformity Mark Ultrasonic technology cold mist Electromechanical controls Digital control Display Indoor humidity visualizer Tank empty signal Warm steam function Night light Adjustable steam nozzle Ionizer Remote controller Automatic re-start function on return of mains voltage Timer Bluetooth Cod. EAN ml/h m3 W ml mm mm mm kg kg kg V-F-Hz ASTOMI 200 99406 8021183994063 25 15 12 IP X0 III 1 200 12 110 x 151 x 110 130 x 210 x 130 541 x 230 x 406 0,30 0,55 8 external 100-240 - 1 - 50/60 CE AIR TREATMENT HEATING 235 NEWASTOMI SOUND ASTOMI SOUND Cod. 99408 FEATURES Tank capacity 400 ml Changing LED light for chromotherapy Bluetooth speakers for mobile devices 2 emission settings: intense/light Humidification function 60 ml/h emission 11 h continuous operation Automatic switch-off with empty tank 2-4-6 HOUR TIMER 2 IN 1: HUMIDIFIER AND FRAGRANCE DIFFUSER CHROMOTHERAPY WITH FIXED OR CHANGING LIGHTS SAFE WITH AUTOMATIC SWITCH-OFF BLUETOOTH SPEAKER 236 HYDRONIC SYSTEMS AIR CONDITIONING Humidification capacity (cold mist) Humidificable Area Power absorption (cold mist) Protection level Protection class Fan speeds Tank capacity Master box quantity Dimensions (W x H x D) Packing dimensions (W x H x D) Master Box dimensions (W x H x D) Weight (without packing) Weight (with packing) Master box weight Power supplier Power supply Conformity Mark Ultrasonic technology cold mist Electromechanical controls Digital control Display Indoor humidity visualizer Tank empty signal Warm steam function Night light Adjustable steam nozzle Ionizer Remote controller Automatic re-start function on return of mains voltage Timer Bluetooth Cod. EAN ml/h m3 W ml mm mm mm kg kg kg V-F-Hz ASTOMI SOUND 99408 8021183994087 45 20 18 IP X0 III 1 400,0 12 156 x 145 x 156 165 X 215 x 165 515 x 4500 x 345 0,70 0,90 12 external 100-240 - 1 - 50/60 CE AIR TREATMENT HEATING 237 238 FAN HEATERS 239 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS CALDO EASY CALDO EASY B Cod. 99411 CALDO EASY G Cod. 99410 FEATURES Needle heater ermal power max 2000 W 2 power settings 1000/2000 W Fan only function Mechanical controls Safety thermostat Room thermostat Indication light Turnover protection switch Anti-frost device Grip on rear Maximum heating volume: 60 m³ 2000W MAXIMUM POWER TURNOVER PROTECTION SWITCH SAFETY THERMOSTAT INDICATION LIGHT 3 SELECTABLE POWER SETTINGS Only fan - 2 power level. 240 HYDRONIC SYSTEMS AIR CONDITIONING ermal power Power settings Seasonal energy efficiency (reg. UE 2015/1188) Heating volume (max) Dimensions (W x H x D) Gift box Dimensions (W x H x D) Weight (without packing) Weight (with packing) Units per master gift box Master size Insulation class Degrees of protection provided by enclosures Fan speeds Power supply Conformity Mark Needles resistance Timer Environment thermostat Safety thermostat Ventilation function Wall support Oscillating function Anti-turn over switch Humidifier Ionizer Anti-ice function Power selector Power supply cable housing Cod. EAN W % m³ mm mm kg kg nr mm V-F-Hz CALDO EASY B CALDO EASY G 99411 99410 8021183994117 8021183994100 2000 0 / ONLY FAN / 1000 / 2000 36 60 222 x 233 x 134 230 x 240 x 140 1,2 1,4 12 485 x 440 x 500 II - 1 220-240V - 1 - 50HZ CE AIR TREATMENT HEATING 241 NEWCALDO CIRCLE 20 CALDO CIRCLE 20 A Cod. 99418 CALDO CIRCLE 20 R Cod. 99417 FEATURES Needle heater Selectable thermal power 1000/2000 W IP 21 type-approved against vertical dripping Fan only mode Design by Ercoli&Garlandini Safety thermostat Room thermostat Anti-freeze function Design by Ercoli&Garlandini 2000W MAXIMUM POWER IP 21 TYPE-APPROVED Against vertical dripping. 3 SELECTABLE POWER SETTINGS Only fan - 2 power level. DESIGNED IN ITALY 242 HYDRONIC SYSTEMS AIR CONDITIONING ermal power Power settings Heating volume (max) Dimensions (W x H x D) Gift box Dimensions (W x H x D) Weight (without packing) Weight (with packing) Units per master gift box Master size Insulation class Degrees of protection provided by enclosures Fan speeds Power supply Conformity Mark Needles resistance Timer Environment thermostat Safety thermostat Ventilation function Wall support Oscillating function Anti-turn over switch Humidifier Ionizer Anti-ice function Power selector Power supply cable housing CALDO CIRCLE 20 A CALDO CIRCLE 20 R Cod. 99418 99417 EAN 8021183994186 8021183994179 1000 + 1000 0 / ONLY FAN / 1000 / 2000 70 236x257x130 245x330x210 1,5 1,90 6 755x335x435 II IP21 2200+/-150 230V - 1 - 50Hz CE 1 AIR TREATMENT HEATING 243 NEWCALDO CIRCLE 22 CALDO CIRCLE 22 A Cod. 99416 CALDO CIRCLE 22 R Cod. 99415 FEATURES Needle heater Maximum power 2200 W Selectable thermal power 1200/2200 W IP 21 type-approved against vertical dripping Fan only mode Design by Ercoli&Garlandini Safety thermostat Room thermostat Anti-freeze function Design by Ercoli&Garlandini 2200W MAXIMUM POWER 3 SELECTABLE POWER SETTINGS Only fan - 2 power level. IP 21 TYPE-APPROVED Against vertical dripping. DESIGNED IN ITALY CABLE HOUSING 244 HYDRONIC SYSTEMS AIR CONDITIONING ermal power Power settings Heating volume (max) Dimensions (W x H x D) Gift box Dimensions (W x H x D) Weight (without packing) Weight (with packing) Units per master gift box Master size Insulation class Degrees of protection provided by enclosures Fan speeds Power supply Conformity Mark Needles resistance Timer Environment thermostat Safety thermostat Ventilation function Wall support Oscillating function Anti-turn over switch Humidifier Ionizer Anti-ice function Power selector Power supply cable housing Cod. EAN W m³ mm mm kg kg nr mm rpm V-F-Hz CALDO CIRCLE 22 A CALDO CIRCLE 22 R 99416 99415 8021183994162 8021183994155 2200 0 / ONLY FAN / 1200 / 2200 75 236x275x195 245x330x210 1,5 1,90 6 755x335x435 II IP21 2200+/-150 230V - 1 - 50Hz CE 1 AIR TREATMENT HEATING 245 NEWCALDO CIRCLE 22 H ION CALDO CIRCLE 22 H ION Cod. 99414 FEATURES Needle heater Selectable thermal power 1200-2200 W Integrated ionizer IP21 type-approved against vertical dripping Fan only mode Design by Ercoli & Garlandini Room thermostat Safety thermostat Anti-freeze function Design by Ercoli&Garlandini 2200W MAXIMUM POWER IONIZER IP 21 TYPE-APPROVED Against vertical dripping. CABLE HOUSING INCLINED BASE 246 HYDRONIC SYSTEMS AIR CONDITIONING ermal power Power settings Heating volume (max) Dimensions (W x H x D) Gift box Dimensions (W x H x D) Weight (without packing) Weight (with packing) Units per master gift box Degrees of protection provided by enclosures Fan speeds Power supply Conformity Mark Needles resistance Timer Environment thermostat Safety thermostat Ventilation function Wall support Oscillating function Anti-turn over switch Humidifier Ionizer Anti-ice function Power selector Power supply cable housing CALDO CIRCLE 22 H ION Cod. 99414 EAN 8021183994148 2200 0 / ONLY FAN / 1200 / 2200 75 236x275x188 245x330x210 1,5 1,90 6 IP21 1 230V - 1 - 50Hz CE 1 AIR TREATMENT HEATING 247 OBLÓ 2.2 Design by Dario Tanfoglio OBLO 2.2 Cod. 99574 FEATURES Needles resistance Superpower: max thermal output 2200 W 3 power settings (800-1400-2200W) Mechanical control IP 21 certification gainst water dripping Safety thermostat Room ermostat Anti-frost function Internal cord wrapper: the cord totally hides within the casing Max room volume: 70 m3 MATT FINISH Made with high quality plastic, its power is shielded in elegantly and attractively finished shells. e elegant combination of matte and gloss finishes enhances the smooth, rounded shapes of the product. WATER SAFETY: IP 21 IP 21 approved to ensure safety against vertical water dripping. anks to the special grille design and the shielding of the internal components the product can be used even in the bathroom. SUPER WARM Among the most powerful of its category, up to 2200 W. 248 HYDRONIC SYSTEMS ermal power ( min - max ) Heating volume (max) Dimensions (W x H x D) Weight (without packaging) IP21 certification Power supply Needle heater Mechanical controls Room thermostat Safety thermostat 24h Timer Fan only Function Anti-frost Function Handle 90° Oscillation Turnover protection switch Housign for power cable / cable winder Code EAN W m³ mm Kg V-F-Hz OBLO' 2.2 99574 8021183995749 800-1400-2200 70 228 x 317 x 195 1,5 230 - 1 - 50 AIR CONDITIONING AIR TREATMENT HEATING 249 CALDOSILENT ECO CALDOSILENTECO Cod.99451 FEATURES Needles resistance Superpower: max thermal output 2400 W 2 power settings (1200-2400W) Fan only function Mechanical control IP 21 certification gainst water dripping Safety thermostat Room ermostat Anti-frost function Handle Max room volume: 80 m3 supersilent Exclusive technology, designed in Italy Guaranteed hot and silence SUPER SILENT Llower sound pressure: up to 3dB (A) less than traditional models. 50%* lower perceived noise. WATER SAFETY: IP 21 IP 21 approved to ensure safety against vertical water dripping. anks to the special grille design and the shielding of the internal components the product can be used even in the bathroom. SUPER WARM Among the most powerful of its category, up to 2200 W. * Internal tests on the range Olimpia Splendid 250 HYDRONIC SYSTEMS AIR CONDITIONING ermal power ( min - max ) Power setting Heating volume (max) Dimensions (without packaging) (W x H x D) Dimensions (with packaging) (Larg. x Alt. x Prof.) Weight (without packaging) Weight (with packaging) Insulation class Protection level Ventilation speed Power supply Power cable Conformity Mark Needles resistance 24h Timer Room thermostat Safety thermostat Fan only Function Wall mount Oscillation Turnover protection switch Anti-frost function Power setting Housign for power cable / cable winder Cod. EAN W W m³ mm mm kg kg V-F-Hz CALDOSILENT ECO 99451 8021183994513 2400 0 / 1200 / 2400 80 267x343x251 285x360x265 2,7 3,0 II IP 21 1 230 - 1 - 50 2 x 1 CE AIR TREATMENT HEATING 251 CALDOSILENT CALDOSILENT Cod. 99452 FEATURES Needles resistance Superpower: max thermal output 2400 W 2 power settings (1200-2400W) Fan only function Mechanical control IP 21 certification gainst water dripping Oscillazione 90° Timer 24h Safety thermostat Room ermostat Anti-frost function Anti tipover switch Handle Max room volume: 80 m3 Silent System supersilent Exclusive technology, designed in Italy Guaranteed hot and silence SUPER SILENT Lower sound pressure: up to 3dB (A) less than traditional models. 50%* lower perceived noise. WATER SAFETY: IP 21 IP 21 approved to ensure safety against vertical water dripping. anks to the special grille design and the shielding of the internal components the product can be used even in the bathroom. SUPER WARM Among the most powerful of its category, up to 2200 W. TIMER 24h programmable timer. OSCILLATION 90° oscillation for amplified heat distribution. * Internal tests on the range Olimpia Splendid 252 HYDRONIC SYSTEMS AIR CONDITIONING ermal power ( min - max ) Power setting Heating volume (max) Dimensions (without packaging) (W x H x D) Dimensions (with packaging) (Larg. x Alt. x Prof.) Weight (without packaging) Weight (with packaging) Insulation class Protection level Ventilation speed Power supply Power cable Conformity Mark Needles resistance 24h Timer Room thermostat Safety thermostat Fan only Function Wall mount Oscillation Turnover protection switch Humidifier Anti-frost Function Power setting Housign for power cable / cable winder Code EAN W m³ mm mm kg kg V-F-Hz CALDOSILENT 99452 8021183994520 1200 + 1200 0 / 1200 / 2400 80 267x343x251 285X360X265 2,7 3,0 II IP 21 1 230 - 1 - 50 2 x 1 CE AIR TREATMENT HEATING 253 254 CERAMIC FAN HEATERS 255 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS CALDODESIGN CALDODESIGN CALDODESIGN S CALDODESIGN O Cod. 99447 Cod. 99404 Cod. 99402 FEATURES Max thermal output: 1800 W Ceramic Resistance Room ermostat Safety thermostat Fan only function Anti-frost function Power selection Tilt adjustment 2 LED indicator Mechanical control CERAMIC TECHNOLOGY Ceramic heating element modulates the emission of heat depending on the temperature, guaranteeing high levels of security. COMPACT TECHNOLOGY Small and compact, Caldodesign will blend smoothly into any context, thanks to its reduced dimensions. TILT ADJUSTMENT 256 HYDRONIC SYSTEMS AIR CONDITIONING ermal power ( min - max ) Power setting Dimensions (Larg. x Alt. x Prof.) Dimensions (with packaging) (Larg. x Alt. x Prof.) Units per master box Weight (without packaging) Weight (with packaging) Insulation class Protection level Fan speed Power supply Power cable Conformity Mark Ceramic resistance Timer Room thermostat Safety thermostat Fan only function Oscillation Turnover protection switch Anti-frost function Power setting Code EAN W mm mm kg kg V-F-Hz CALDODESIGN 99447 8021183994476 CALDODESIGN S 99404 8021183994049 1800 0 / 1000 / 1800 245 x 248 x 216 275 x 275 x 235 6 1,8 2,2 II IP X0 1 220-240 - 1 - 50 2 x 1 CE CALDODESIGN O 99402 8021183994025 AIR TREATMENT HEATING 257 CALDOSTILE M CALDOSTILE M Cod. 99448 FEATURES Max thermal output: 2000 W 2 power level (1200 - 2000 W) Ceramic Resistance Room ermostat Safety thermostat Only fan function Anti-frost function Power selection Mechanical control CERAMIC TECHNOLOGY Ceramic heating element modulates the emission of heat depending on the temperature, guaranteeing high levels of security. MECHANICAL CONTROL Easy to use thanks to intuitive and simple mechanical controls. ANTI-FROST FUNCTION 258 HYDRONIC SYSTEMS AIR CONDITIONING ermal power ( min - max ) Power setting Dimensions (Larg. x Alt. x Prof.) Dimensions (with packaging) (Larg. x Alt. x Prof.) Weight (without packaging) Weight (with packaging) Insulation class Protection level Fan speed Power supply Power cable Conformity Mark Ceramic resistance Timer Room thermostat Safety thermostat Fan only function Oscillation Turnover protection switch Anti-frost function Power setting LED indicators Tilt adjustment Code EAN W mm mm kg kg V-F-Hz CALDOSTILE M 99448 8021183994483 1200 + 800 0 / 1200 / 2000 210x305x158 240x335x188 1,4 1,8 II IP X0 1 220-240 - 1 - 50 2 x 1 CE AIR TREATMENT HEATING 259 CALDOSTILE D CALDOSTILE D Cod. 99449 FEATURES Max thermal output: 2000 W Ceramic Resistance Timer Display touch LCD Room ermostat Safety thermostat Only fan function 90° Oscillation Turnover protection switch Anti-frost function SOFT TOUCH DISPLAY Soft touch keyboard. REMOTE CONTROL OSCILLATION 90° oscillation for amplified heat distribution. TIMER CERAMIC TECHNOLOGY Ceramic heating element modulates the emission of heat depending on the temperature, guaranteeing high levels of security. 260 HYDRONIC SYSTEMS AIR CONDITIONING ermal power ( min - max ) Power setting Dimensions (Larg. x Alt. x Prof.) Dimensions (with packaging) (Larg. x Alt. x Prof.) Weight (without packaging) Weight (with packaging) Insulation class Protection level Fan speed Power supply Power cable Conformity Mark ceramic resistance Timer Room thermostat Safety thermostat Fan only function Oscillation Turnover protection switch Anti-frost function Power setting Remote control Code EAN W mm mm kg kg V-F-Hz CALDOSTILE D 99449 8021183994490 1200 + 800 0 / 1200 / 2000 238x337x173 268x367x203 1,8 2,2 II IP X0 1 220-240 - 1 - 50 2 x 1 CE AIR TREATMENT HEATING 261 CALDOSTILE DT CALDOSTILE DT Cod. 99450 FEATURES Max thermal output: 2200 W Ceramic Resistance Timer Display touch LCD Room ermostat Safety thermostat Only fan function Oscillation Turnover protection switch Anti-frost function Power setting Remote control SOFT TOUCH DISPLAY REMOTE CONTROL OSCILLATION 90° oscillation for amplified heat distribution. TIMER SUPER POWER Up to 2200 W. 262 HYDRONIC SYSTEMS AIR CONDITIONING ermal power ( min - max ) Power setting Dimensions (Larg. x Alt. x Prof.) Dimensions (with packaging) (Larg. x Alt. x Prof.) Weight (without packaging) Weight (with packaging) Insulation class Protection level Fan speed Power supply Power cable Conformity Mark Ceramic resistance Timer Room thermostat Safety thermostat Fan only function Oscillation Turnover protection switch Anti-frost function Power setting Remote control Code EAN W mm mm kg kg V-F-Hz CALDOSTILE DT 99450 8021183994506 1100 - 2200 0 / 1100 / 2200 215x548x215 245x578x245 2,6 3,2 II IP X0 1 220-240 - 1 - 50 2 x 1 CE AIR TREATMENT HEATING 263 RADICAL TORRE METAL RADICAL TORRE METAL Cod. 99519 FEATURES PTC high efficiency resistance Superpower: max thermal output: 2200 W 3 power settings (800-1400-2200W) Eco function LCD Display Digital Control 90° Oscillation 12h Timer Turnover protection switch Safety thermostat Room ermostat Anti-frost function Handle Max room volume: 70 m³ Design by Ercoli & Garlandini DIGITAL CONTROL Sleek electronic display, fully designed to ensure ease of use. e display is used to set the timer (12 h), select the power level or activate the ECO function. CERAMIC TECHNOLOGY Ceramic heating element modulates the emission of heat depending on the temperature, guaranteeing high levels of security. ECO FUNCTION It adjusts power absorption according to the temperature setting to reduce consumption. METALLIC FINISHING With elegant silver inserts. OSCILLATION 90° oscillation for amplified heat distribution. SUPER WARM Among the most powerful of its category, up to 2200 W. 264 HYDRONIC SYSTEMS ermal power ( min - max ) Heating volume (max) Dimensions (W x H x D) Weight (without packaging) Power supply PTC Heater Room thermostat Safety thermostat Mechanical controls Digital controls LCD Display Soft touch Keypad 12h Timer Remote control 90° Oscillation Eco Function Fan only Function Anti-frost Function Turnover protection switch Handle Code EAN W m³ mm Kg V-F-Hz RADICAL TORRE METAL 99519 8021183995190 ECO - 1400 - 2200 70 217 x 525 x 209 3,0 230 - 1 -50 AIR CONDITIONING AIR TREATMENT HEATING 265 CALDO UP T CALDO UP Cod. 99364 FEATURES Max thermal output : 2000 w Ceramic technology 3 settings: only fan/low/high Remote control LED Display 8h timer Anti-overheating protection Practical wall mount Automatic swing flap Light power indicator Weekly programming timer Window opening detector LED DISPLAY Advanced technology to facilitate use. REMOTE CONTROL To rapidly set all functions. LARGE FLAP To direct the flow of hot air. CERAMIC TECHNOLOGY Up to 2000 W. WEEKLY PROGRAMMING TIMER Timer programming up to 8h. 266 HYDRONIC SYSTEMS AIR CONDITIONING ermal power ( min - max ) Heating volume (max) Units per master gift box Dimensions (W x H x D) Dimensions (With packing) (W x H x D) Weight (without packing) Weight (with packing) Power supply PTC Heater Room thermostat Safety thermostat Power selector Mechanical controls Digital controls LCD Display Soft touch Keypad 12h Timer Remote control Adjustable flap Eco Function Fan only Function Anti-frost Function Turnover protection switch Handle Wall mount Cod. EAN W m³ mm mm Kg Kg V-F-Hz CALDO UP T 99364 8021183993646 1000 - 2000 65 4 560 x 185 x 145 595 x 225 x 170 2,8 3,1 220/240-1-50 AIR TREATMENT HEATING 267 NEWCALDO CRYSTAL CALDO CRYSTAL Cod. 99409 FEATURES ermal power max 2000 W Ceramic heater Flap swing can be remote controlled 8h timer Weekly timer with 3 daytime periods. Eco/boost/comfort/fan only function Front touch panel Multi-function remote control IP23 protection rating against falling liquids up to 60 degrees from vertical Ionizer Anti-overheating device Temperature indication Anti-frost device CERAMIC TECHNOLOGY Up to 2000 W. IONIZER For purer air. SAFETY SYSTEM Anti-frost mode/ Anti-overheating detector. MULTI-FUNCTION REMOTE CONTROL WEEKLY PROGRAMMING TIMER IP23 PROTECTION RATING Against vertical dripping, up to 60° from vertical. 268 HYDRONIC SYSTEMS AIR CONDITIONING ermal power Power settings Heating volume (max) Units per master gift box Dimensions (W x H x D) Gift box Dimensions (W x H x D) Master dimensions (W x H x D) Weight (without packing) Weight (with packing) Weight master Insulation class Degrees of protection provided by enclosures Fan speeds Conformity Mark Needles resistance Timer Weekly timer Environment thermostat Safety thermostat Ventilation function Wall support Oscillating function Anti-turn over switch Humidifier Anti-ice function Power selector Power supply cable housing CALDO CRYSTAL Cod. 99409 EAN 8021183996838 W 2000 0 / 1200 / 2000 m³ 60 6 mm 560 x 208 x 150 mm 630 x 255 x 190 mm 640 x 520 x 583 kg 3,5 kg 4,0 kg 25,0 II IP 23 1 CE AIR TREATMENT HEATING 269 270 THERMOCONVECTORS 271 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS CALEO CALEO Cod. 99553 FEATURES Max thermal output: 2000 W 3 power settings: 750 - 1250 - 2000 W Mechanical controls Safety thermostat Wall or floor installation Wall mounting kit included Max room volume: 60 m³ Design by Ercoli & Garlandini FAST HEATING e design of the grille in the upper part widens the convection range, making Caleo a very low inertia convector, ideal when a room needs to be heated very quickly. METAL FRAME e clean shape, lightness and solidity of Caleo are made possible by the painted metal frame and shell. COMPACT TECHNOLOGY Extremely compact shape and only 12 cm thick. DOUBLE USE Free-standing or wall installation. 272 HYDRONIC SYSTEMS ermal power (Min - Med - Max) Heating volume (max) Dimensions (W x H x D) Weight (without packaging) Power supply Room ermostat Safety ermostat Wall installation Eco function Anti-frost Function Turbo Function 24h Timer Code EAN W m³ mm Kg V-F-Hz CALEO 2 99553 8021183995534 750 - 1250 - 2000 60 638 x 475 x 120 4,3 230 - 1 - 50 AIR CONDITIONING AIR TREATMENT HEATING 273 CALEO T / CALEO TT CALEO T Cod. 99552 CALEO TT Cod. 99551 FEATURES Max thermal output: 2000 W 3 power settings: 1000 - 1000+fan 2000 +fan Mechanical controls Safety thermostat Wall or floor installation Turbo Function: auxiliary fan 24h Timer (only Caleo TT) Wall mounting kit included Max room volume: 60 m³ Design by Ercoli & Garlandini FAST HEATING e design of the grille in the upper part widens the convection range, making Caleo a very low inertia convector, ideal when a room needs to be heated very quickly. METAL FRAME e clean shape, lightness and solidity of Caleo are made possible by the painted metal frame and shell. COMPACT TECHNOLOGY Extremely compact shape and only 12 cm thick. TIMER 24h timer programming. (only TT version) TURBO FUNCTION e turbo mode with auxiliary ventilation maximizes heat distribution for an immediate heating and maximum comfort. DOUBLE USE Free-standing or wall installation. 274 HYDRONIC SYSTEMS ermal power (Min - Med - Max) Heating volume (max) Dimensions (W x H x D) Weight (without packaging) Power supply Room ermostat Safety ermostat Wall installation Eco function Anti-frost Function Turbo Function 24h Timer Code EAN W m³ mm Kg V-F-Hz CALEO 2 TURBO 99552 8021183995527 1000 - 1000+fan - 2000+fan 70 638 x 475 x 120 4,3 230 - 1 - 50 CALEO 2 TURBO TIMER 99551 8021183995510 1000 - 1000+fan - 2000+fan 70 638 x 475 x 120 4,3 230 - 1 - 50 AIR CONDITIONING AIR TREATMENT HEATING 275 276 RADIATORS 277 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS CALDORAD CALDORAD 7 CALDORAD 7 Cod. 99620 CALDORAD 9 Cod. 99619 CALDORAD 9TT Cod. 99617 CALDORAD 11 Cod. 99618 FEATURES 4 different versions: CaldoRad 7 (max thermal output 1500 W) CaldoRad 9 (max thermal output 2000 W) CaldoRad 11 (max thermal output 2500 W) CaldoRad 9 TT (max thermal output 2000 + 400 W) Mechanical controls Safety thermostat Room thermostat Turnover protection switch Anti-frost function Handles Wheels Cable winder 24h timer* CALDORAD 9 CALDORAD 9 TT CALDORAD 11 SUPER INERTIA e special engineering of the metal elements and openings on the sides, enable heat to be spread homogeneously and guarantee long heating maintenance times. Ideal for heating large rooms. ECO FUNCTION CaldoRad, thanks to the Eco function, is able to modulate the input power depending on the measured temperature, reducing the consumption and increasing the comfort levels. SILENT SYSTEM Oil-filled radiators can heat rooms in complete silence. TIMER* 24 h timer programming. (only 9 TT version) * Available only on model Caldorad 9TT 278 HYDRONIC SYSTEMS ermal power (Min - Med - Max) Heating volume (max) Dimensions (W x H x D) ickness Weight Oil Power supply 24h Timer Environment thermostat Safety thermostat Ventilation function Turnover protection switch Eco Function Anti-frost Function Wheels Handles Power supply cable housing Code EAN W m³ mm Kg l V-F-Hz CALDORAD 7 99620 8021183996203 ECO 700 - 800 - 1500 50 235 x 620 x 340 8,7 2,2 230 - 1 - 50 CALDORAD 9 99619 8021183996197 ECO 1000 - 1000 - 2000 50 235 x 620 x 420 10,4 2,8 230 - 1 - 50 CALDORAD 11 99618 8021183996180 ECO 1200-1300 -2500 75 235 x 620 x 500 12,3 3,3 230 - 1 - 50 CALDORAD 9TT 99617 8021183996173 ECO 1000-1000-2000 (+400) 75 235 x 620 x 420 11 2,8 230 - 1 - 50 AIR CONDITIONING AIR TREATMENT HEATING 279 CALDORAD 7/9 DIGITAL CALDORAD 7 DIGITAL Cod. 99623 CALDORAD 9 DIGITAL Cod. 99622 FEATURES 2 different versions: CaldoRad 7 Digital (max thermal output: 1500W) CaldoRad 9 Digital (max thermal output 2000W) Digital controls 2 power settings (from 700 to 2000 W) Display LCD 24h timer Handles Wheels Safety thermostat Room thermostat Anti turn over switch Cable winder CALDORAD 7 DIGITAL CALDORAD 9 DIGITAL SUPER INERTIA e special engineering of the metal elements and openings on the sides, enable heat to be spread homogeneously and guarantee long heating maintenance times. Ideal for heating large rooms. TIMER 24 h timer programming. SILENT SYSTEM Oil-filled radiators can heat rooms in complete silence. 280 HYDRONIC SYSTEMS ermal power (Min - Med - Max) Heating volume (max) Dimensions (W x H x D) ickness Weight Oil Power supply 24h Timer Environment thermostat Safety thermostat Ventilation function Turnover protection switch Eco Function Anti-frost Function Wheels Handles Power supply cable housing Code EAN W m³ mm Kg l V-F-Hz CALDORAD 7 DIGITAL 99623 8021183996234 700 - 1500 50 243 x 620 x 340 8,9 2,2 230 - 1 - 50 CALDORAD 9 DIGITAL 99622 8021183996227 1000 - 2000 50 235 x 620 x 420 10,6 2,8 230 - 1 - 50 AIR CONDITIONING AIR TREATMENT HEATING 281 282 INFRARED HEATERS 283 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS SOLARIA EVO SOLARIA EVO Cod. 99545 SOLARIA EVO S Cod. 99396 FEATURES 3 power settings (400 - 800 - 1200 W) 90° Oscillation Safety thermostat Anti turn over switch Handle Max room volume: 45 m3 HALOGEN TECHNOLOGY Maximum heating speed. Halogen technology guarantees uniform comfort and extreme rapidity. OSCILLATION 90° oscillation for amplified heat distribution. USER FRIENDLY Practical and ergonomic handle, for an even easier trasport. 284 HYDRONIC SYSTEMS ermal power Humidifier power absorption Heating volume (max) Dimensions (W x H x D) Weight Power supply Safety thermostat Oscillating function Turnover protection switch Handle Code EAN W m³ mm mm Kg V-F-Hz SOLARIA EVO SOLARIA EVO S 99545 8021183995459 99546 8021183993967 400 - 800 - 1200 45 585 x 325 x 222 618 x 325 x 167 1,8 220/240 - 1 50/60 AIR CONDITIONING AIR TREATMENT HEATING 285 CARBON BLACK CARBON BLACK Cod. 99579 FEATURES Max thermal output 1100 W 2 power settings (600 - 1100 W) Mechanical controls 90° Oscillation Safety thermostat Anti turn over switch Handle Max room volume: 45 m3 CARBON TECHNOLOGY e infrared lamps are made in carbon fibre, an ecological technology that makes the most of heating by minimizing light dispersion. OSCILLATION 90° oscillation for amplified heat distribution. 286 HYDRONIC SYSTEMS ermal power Humidifier power absorption Heating volume (max) Dimensions (W x H x D) Weight Power supply Safety thermostat Oscillating function Turnover protection switch Handle Code EAN W W m³ mm Kg V-F-Hz CARBON BLACK 99579 8021183995794 550 - 1100 45 320 x 640 x 240 2,2 220/240 - 1 50/60 AIR CONDITIONING AIR TREATMENT HEATING 287 SOLARIA CARBON SOLARIA CARBON Cod. 99610 FEATURES Max hermal output 1100 W 2 power settings (600 - 1100 W) Mechanical controls 90° Oscillation Radiation direction: the lamp can be inclined up to 80° orienting the heat upwards Safety thermostat Anti turn over switch Handle Max room volume: 45 m3 CARBON TECHNOLOGY e infrared lamps are made in carbon fibre, an ecological technology that makes the most of heating by minimizing light dispersion. OSCILLATION 90° oscillation for amplified heat distribution. ORIENTING e infrared lamp can be inclined up to 80 ° orienting the heat upwards, for greater heating comfort. 288 HYDRONIC SYSTEMS ermal power Humidifier power absorption Heating volume (max) Dimensions (W x H x D) Weight Power supply Safety thermostat Oscillating function Turnover protection switch Handle Code EAN W W m³ mm Kg V-F-Hz SOLARIA CARBON 99610 8021183996104 600 - 1100 45 456 x 690 x 170 3,2 230 - 1 - 50 AIR CONDITIONING AIR TREATMENT HEATING 289 290 GAS STOVES 291 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS NEWSTOVY INFRA / INFRA TURBO THERMO STOVY INFRA BLACK STOVY INFRA SILVER STOVY INFRA SILVER/WHITE STOVY INFRA TURBO THERMO Cod. 99387 Cod. 99386 Cod. 99385 Cod. 99384 STOVY INFRA BLACK STOVY INFRA SILVER FEATURES Max thermal output: 4200 W 3 power settings (1400 - 2800 - 4200 W) Fuel: LPG Crossflow fan: Pratica Infra Turbo ermo has a crossflow fan which allows faster and more uniform heating Enamelled steel body Space for 15 kg cylinder IMQ mark Pressure regulator Valve tap Gas hose and Pressure Regulator included Max room volume: 120 m3 PRATICA INFRA SILVER/WHITE STOVY INFRA TURBO THERMO MADE IN ITALY Guaranteed quality and safety. DOUBLE SAFETY Double safety system thanks to the atmosphere analyzer that: - automatically turns off the heater if the carbon dioxide level in the air reaches 1,5%; - automatically cuts off the gas flow in case of accidental switch off of the heater. IMQ MARK e IMQ mark is issued by the Italian Quality Mark Institute and guarantees conformity with the safety requirements of a product and of the materials it is made of. INFRARED TECHNOLOGY To heat faster and effectively, the radiant group is composed of ceramic plates, that can be managed independently and capable of delivering different powers of heat. e infrared technology allows heating without wasting energy. e infrared technology does not heat the air but only the surfaces, allowing considerable savings in consumption. 292 HYDRONIC SYSTEMS AIR CONDITIONING Fuel Gas supply pressure Nominal thermal flow - Pn (max-med-min) Rated consumption (max-med-min) Heating volume (min - max) Dimensions (H x W x D) Weight Weight (without packaging) Electrical heating power Infrared Technology Gas safety valve Pressure regulator Indoor thermostat Steel structure Pilot burner Safety system with atmosphere analyser Great movement wheels Piezoelectric ignition Wall fixing Fan Indicator light STOVY INFRA SCHWARZ STOVY INFRA SILBER STOVY INFRA SILBER/WEISS Code 99387 99386 99385 EAN 8021183993875 8021183993868 8021183993851 GPL GPL GPL mbar 30 - 37 30 - 37 30 - 37 KW 4,2 - 2,8 - 1,4 4,2 - 2,8 - 1,4 4,2 - 2,8 - 1,4 g / h 300 - 190 - 110 300 - 190 - 110 300 - 190 - 110 m³ 120 120 120 mm 780 x 430 x 330 780 x 430 x 330 780 x 430 x 330 Kg 13,6 13,6 13,6 12,4 12,4 12,4 W - - - STOVY INFRA TURBO THERMO 99384 8021183993844 GPL 30 - 37 4,2 - 2,8 - 1,4 300 - 190 - 110 140 780 x 430 x 330 15,3 14,1 1000 + 1000 AIR TREATMENT HEATING 293 INFRA METANO / SUPER INFRA METANO TURBO INFRA METANO BLUE Cod. 99897 INFRA METANO GRAY Cod. 99892 SUPER INFRA METANO TURBO Cod. 99827 INFRA METANO BLUE SUPER INFRA METANO TURBO FEATURES Max thermal output: 4200 W 3 power settings: Infra Metano versions (1400 - 2800 - 4000 W) Super Infra Metano version (1400 - 2800 4200 W) Fuel: Methane Crossflow fan:Super Infra Metano Turbo has a crossflow fan which allows faster and more uniform heating Enamelled steel body Wall or floor installation Pressure regulator Valve tap Max room volume: 120 m3 INFRA METANO GRAY INFRARED TECHNOLOGY To heat faster and effectively, the radiant group is composed of ceramic plates, that can be managed independently and capable of delivering different powers of heat. e infrared technology allows heating without wasting energy. e infrared technology does not heat the air but only the surfaces, allowing considerable savings in consumption. DOUBLE SAFETY Double safety system thanks to the atmosphere analyzer that: - automatically turns off the heater if the carbon dioxide level in the air reaches 1,5%; - automatically cuts off the gas flow in case of accidental switch off of the heater. MADE IN ITALY Guaranteed quality and safety. 294 HYDRONIC SYSTEMS Fuel Gas supply pressure Nominal thermal flow - Pn (max-med-min) Rated consumption (max-med-min) Heating volume (min - max) Dimensions (H x W x D) Weight Electrical heating power Infrared Technology Gas safety valve Pressure regulator Indoor thermostat Steel structure Pilot burner Safety system with atmosphere analyser Great movement wheels Piezoelectric ignition Wall fixing Fan Indicator light INFRA METANO BLUE INFRA METANO GRAY SUPER INFRA METANO TURBO Code 99897 99892 99827 EAN 8021183998979 8021183998924 8021183998276 Methane Methane Methane mbar 20 20 20 KW 4- 2,8 - 1,4 4- 2,8 - 1,4 4- 2,8 - 1,4 g / h 0,41 - 0,27 - 0,15 0,41 - 0,27 - 0,15 0,41 - 0,27 - 0,15 m³ 100 100 100 mm 630 x 405 x 130 630 x 405 x 130 630 x 405 x 130 Kg 11 11 11 W AIR CONDITIONING AIR TREATMENT HEATING 295 SG SERIES SG 60 HE Cod. 99401 MADE IN ITALY Guaranteed quality and safety. SG 80 HE SG 90 TURBO HE MADE IN ITALY Guaranteed quality and safety. SG 120 HE MADE IN ITALY Guaranteed quality and safety. 296 SG 125 TURBO HE FEATURES Max thermal output: 4000 W Fuel: Methane - LPG Body in porcelain finish steel Safety valve Room thermostat Stainless steel gas burner 3 colours available: white, grey and brown Max room volume: 125 - 230 m3 SG 80 HE Cod. 99400 SG 90 TURBO HE Cod. 99399 FEATURES Max thermal output: 8000 W - 9000 W Fuel: Methane - LPG Body in porcelain finish steel Safety valve Room thermostat Double safety thermostat Stainless steel gas burner Max room volume: 230 - 260 m3 SG 120 HE Cod. 99398 SG 125 TURBO HE Cod. 99397 FEATURES Max thermal output: 12000 W Fuel: Methane - LPG Body in porcelain finish steel Safety valve Room thermostat Double safety thermostat Max room volume: 335 m3 HYDRONIC SYSTEMS AIR CONDITIONING Appliance type Gas cathegory Gas set-up Gas supply pressure Direct heat output Rated heat output Maximum consumption Minimum consumption Number of Kanthal bars Pilot injector ( ø ) Minimum injector ( bypass ) Air adjustment Air necessary for combustion Drain pipe diameter Heating volume (min - max) Product dimensions (WxHxD) Weight (without packaging) Conformity Markings Alternative gas Gas supply pressure mbar Rated consumption Burner injector ( ø ) Pilot injector ( ø ) Minimum injector ( bypass ) Air adjustment Safety gas valve Room thermostat Steel structure Pilot burner Castor wheels Piezoelectric ignition" Adjustable power Fan Luminous indicator Code EAN mbar kW kW l/h l/h mm m³ / h mm m³ mm kg mbar g / h mm mm mm mm SG 60 HE 99401 8021183994018 B11 BS II2H3+ METANO ( G20 ) 20 5,1 5,1 634 202 1 0,36 ADJUSTABLE CLOSED 16 80 125 - 230 580 x 720 x 260 18 CE L.P.G. ( G30-G31 ) 30-37 630 1,40 0,19 0,60 10,0 SG 80 HE 99400 8021183994001 B11 BS II2H3+ METANO ( G20 ) 20 6,3 6,3 787 175 1 0,36 ADJUSTABLE CLOSED 16 80 125 - 230 720 x 720 x 260 26 CE L.P.G. ( G30-G31 ) 30-37 630 1,40 0,19 0,60 10,0 SG 90 TURBO HE 99399 8021183993998 B11 BS II2H3+ METANO ( G20 ) 20 7,3 7,3 906 193 0,36 ADJUSTABLE CLOSED 18 80 140 - 260 780 x 720 x 260 31 CE L.P.G. ( G30-G31 ) 30-37 700 1,45 0,19 0,60 CHIUSA SG120 HE 99398 8021183993981 B11 BS II2H3+ METANO ( G20 ) 20 8,9 8,9 1102 182 0,36 ADJUSTABLE CLOSED 16 100 125 - 230 720 x 720 x 260 26 CE L.P.G. ( G30-G31 ) 30-37 630 1,40 0,19 0,60 10,0 SG 125 TURBO HE 99397 8021183993974 B11 BS II2H3+ METANO ( G20 ) 20 0,36 ADJUSTABLE CLOSED 24 100 215 - 335 900 x 720 x 260 36 CE L.P.G. ( G30-G31 ) 30-37 945 1,70 0,19 0,70 10,0 AIR TREATMENT HEATING 297 298 PELLET STOVES 299 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS MIA e first modern pellet stove, stackable and customizable. . MIA IS UNIQUE, NOT ONLY IN ITS DESIGN but also in its technology and high-quality materials. MADE IN ITALY MIA, a warranty of quality and experience. HIGH EFFICIENCY Excellent performances: average productivity higher than 91% on the whole range. TOTAL CUSTOMIZATION MIA's combustion chamber is embedded in a structure which, thanks to the standardized dimensions, allows complete modularity with the whole range of available accessories. e front covers system allows MIA to suit any architectural style. Mia Stile is characterized by its contemporary design, with versatile and elegant shapes that suit any environment perfectly, from the most modern to the most classical. Mia Vertical is characterized by a simple aesthetic, with sharp lines and compact shapes, in a real Industrial style, for more urban tastes and minimal environments. 300 Mia Stile Mia Vertical HYDRONIC SYSTEMS A WORLD OF ACCESSORIES anks to the range of available accessories, every Mia stove is a unique piece, customtailored for the most diverse needs. All the accessories are compatible with all sizes and can be placed on both sides of the stove. ere are two basic modules, with the following dimensions: 40x40 or 80x40 cm, and they both can be combined with the shelves and doors. AIR CONDITIONING AIR TREATMENT HIGH QUALITY OF MATERIALS e fireplace and the brazier are made of thick inox steel, which ensures durability in time and makes maintenance extremely easy. e user-friendly display is completely integrated in the design thanks to the hidden closure mechanism. To complete the structure, there are a real leather lace with a laser-manufactured button that simplifies the opening of the structure's door, and interior design legs in a contemporary style. DESIGN OF EXCELLENCE Simplicity and lightness are the main feature of Mia, its modern design has been awarded in some of the most famous international Design contests. reddot design award 2015 MIA has been awarded the REDDOT DESI- Mia has been awarded the GOOD GN 2015 price, for the perfect integration DESIGN 2015 price, released by the between technology and design. prestigious Chicago University. 301 HEATING MIA 2 7,5 MIA, a stove with endless options. reddot design award 2015 MIA2 7,5 (STOVE UNIT ONLY) Cod. 99469 FEATURES Firebox thermal power ( min - max ): 3,4-7,3 KW Power ( min - max ): 3,11-6,8 KW Average Efficiency: 91,6% Heating volume: 80m² - 229m³ Operating autonomy: 13,9 h* Capacious tank: 15kg of pellet capacity, equal to 1 bag of pellets to guarantee a long operating time Programmable electronic control system Integrated display, adjustable and user-friendly Double door with magnetic closure Internal door seal in "Glass fiber" Multifunction remote control Covers available in the colors: PLUS Display with daily and weekly programming. Combustion chamber system with front access. Extremely compact dimensions, only 52 cm of depth. Extremely reduced consumption. TOTAL FLAT front aesthetic *at average functioning and 15kg of pellet 302 Mia Stile Mia Vertical HYDRONIC SYSTEMS MIA 2 9 reddot design award 2015 MIA2 9 (STOVE UNIT ONLY) Cod. 99477 FEATURES Firebox thermal power ( min-max ): 3,25-8,5 KW Power ( min-max ): 3,07-7,9 KW Average Efficiency: 92,3% Heating volume: 110m² - 300m³ Operating autonomy: 12,2 h* Capacious tank: 15kg of pellet capacity, equal to 1 bag of pellets to guarantee a long operating time Programmable electronic control system Integrated display, adjustable and user-friendly Double door with magnetic closure Internal door seal in "Glass fiber" Multifunction remote control Covers available in the colors: AIR CONDITIONING AIR TREATMENT HEATING PLUS Display with daily and weekly programming. Combustion chamber system with front access. Extremely compact dimensions, only 52 cm of depth. Extremely reduced consumption. TOTAL FLAT front aesthetic *at average functioning and 15kg of pellet Mia Stile Mia Vertical 303 MIA 2 11 reddot design award 2015 MIA2 11 (STOVE UNIT ONLY) Cod. 99476 FEATURES Firebox thermal power ( min-max ): 3,25-10 KW Power ( min-max ): 3,07-9,2 KW Average Efficiency: 91,5% Heating volume: 140m² - 380m³ Operating autonomy: 10,8 h* Capacious tank: 15kg of pellet capacity, equal to 1 bag of pellets to guarantee a long operating time Programmable electronic control system Integrated display, adjustable and user-friendly Double door with magnetic closure Internal door seal in "Glass fiber" Multifunction remote control Covers available in the colors: PLUS Display with daily and weekly programming. Combustion chamber system with front access. Extremely compact dimensions, only 52 cm of depth. Extremely reduced consumption. TOTAL FLAT front aesthetic *at average functioning and 15kg of pellet 304 Mia Stile Mia Vertical Product name Product code Firebox thermal power ( min - max ) Rated thermal power ( min - max ) Hourly consumption of wood ovules (min -max ) Efficiency ( minimum thermal power ) Efficiency ( maximum thermal power ) CO at 13% of oxygen (at mininum power) CO at 23% of oxygen (at maximum power) Flue temperature Mass fumes (min - max) Heating volume Dimensions (Height. X Width. X Depth.) Dimensions with packaging (Height. X Width. X Depth.) Weight (without door) Door weight Diameter of smokes discharge pipes Pellet ovules dimension Voltage Frequency Feed tank capacity Operating autonomy (minimum setting) Features Fire door with self-cleaning ceramic glass Digital control panel Electric ignition with resistance Pellet tank top loading Room temperature management Daily and weekly ignition programmable management Remote control Back and exchanger in cast iron Double combustion Forced draft Hot air ducting with possibility of partialization Art. Code COVER STILE ORANGE B0690 COVER STILE WHITE B0691 COVER STILE SILVER B0692 COVER VERTICAL ORANGE B0694 COVER VERTICAL WHITE B0695 KW KW Kg / h % % mg/m3 mg/m3 °C g / s m3 mm mm kg kg Ø mm Ø mm V Hz kg h MIA2 7,5 99469 3,38 - 7,29 3,11 - 6,66 0,7 - 1,5 91,68 91,26 400 202 87 - 142 4 - 5 229 1000x455x521 1170x610x570 63,0 73,0 80 6 230 50 15 20 MIA2 9 99477 2,09 - 7,29 2,00 - 7,64 0,4 - 1,8 95,48 89,84 178 209 52,3 - 138,2 2,7 - 6,9 300 1050x455x520 1190x610x570 73,0 83,0 80 6 230 50 15 30 MIA2 11 99476 2,09 - 10,0 2,00 - 8,88 0,4 - 2,1 95,48 88,78 178 161 52,3 - 154,2 2,7 - 7,8 380 1050x455x520 1190x610x570 73,0 83,0 80 6 230 50 15 34 Art. Code COVER VERTICAL SILVER B0696 MODULE 40X40X53 B0697 Art. Code SHELF 80 B0701 MODULE PORT-PELLET 40X40X53 B0702 MODULE 80X40X53 B0698 HANDRAIL B0703 DOOR 37,5x37,5 B0699 SCOOP KIT B0704 SHELF 40 B0700 305 HEATING AIR TREATMENT AIR CONDITIONING HYDRONIC SYSTEMS Energy Label C M Y CM MY CY CMY K DOUBLE DUCT AIR CONDITIONERS (UNICO) AIR INVERTER 10 HP C M Y CM MY CY CMY K SINGLE DUCT AIR CONDITIONERS (PORTABLE) DOLCECLIMA SILENT 11 A+ 23 26 1 20 31 1 54 26 31 0,8 61 Energy efficiency class from A+++ to D Energy efficiency class from A+++ to D Double duct, single duct, fixed and wall spilt air conditioner Reference Regulation: EUROPEAN REGULATION (EU) N. 626/2011 MONOSPLIT AIR CONDITIONER MULTISPLIT AIR CONDITIONER OS-CENEH09EI/OS-SEAN+E++H+ 09AE+I+++ SEER A++++ SCOP ++++ +++ A A A +++ A+++ A++ A+ A+++ A++ A++ A+ ++ AA++ A++ A+ A++ A+ A A A+ B C B C A B D D B C kW 2,9 SEER 6,5 kWh/annum 153 C kW 2,7 SCOP 4,9 2,2 4,0 XXD kWh/annum 758 762 X D E E F 53dB F F G G G 61dB ENERGIA · · · ENERGIJA · ENERGY · ENERGIE 626/2011 Energy efficiency class from A+++ to D 306 OS-CEMEH26EI OS-SENEH09EI+OS-SENEH09EI+OS-SENEH0++9+E+ A A ++++ SEER A++++ SCOP ++++ +++ A A A +++ A+++ A++ A+ A+++ A++ A++ A+ A++ A++ A++ A+ A+ A A A+ B C B C A B D D B C kW 8,1 SEER 6,1 kWh/annum 460 C kW X SCOP X kWh/annum X D 5,6 3,8 XXD 2035 X E E F 53dB F F G G G 67dB ENERGIA · · · ENERGIJA · ENERGY · ENERGIE 626/2011 Energy efficiency class from A+++ to D AIR WATER LOW TEMPERATURE 35°C HEAT PUMPS (SHERPA) AIR WATER HIGH TEMPERATURE 55°C HEAT PUMPS (SHERPA) SHERPA MONOBLOC 15 I II 55 °C 35 °C SHERPA MONOBLOC 15 / 01678 A++ A+ A++ A++ A+ A B C kW 14.52 9.05 8.38 D s % 119 127 175 E kWh/annum 11188 5748 2508 F G 14.52 9.05 68 d8.B3A8 dB kW 17.25 10.75 d9B.9A6 kW SHERPA MONOBLOC 15 I II 55 °C 35 °C A++ A+ A B C D E F G dB A++ A+ 14.52 9.05 8.38 kW 17.25 10.75 9.96 kW 68 dB 2015 811/2013 Energy efficiency class from A++ to G PELLET STOVES (MIA) EENNEERRGG 68 dB 2015 811/2013 ENERG Energy efficiency class from A++ to G ENERG 2015/1187 2015/1187 MIA 2 - 11 8,9 kW 2EN0E1R7GIA · · ENE · ENERGUA · ENERGY · ENERG2H0E1·5E/N1E1R8G7I 2015/1186 ENERGIA · · ENE · ENERGUA · ENERGY · ENERGHE · ENERGI 2017 2015/1186 2015/1187 Energy efficiency class from A++ to G Air-water heat pumps Reference Regulation: EUROPEAN REGULATION (EU) N. 811/2013 Pellet stove Reference Regulation: EUROPEAN REGULATION (EU) N. 2015/1186 ENERGIA · · ENE · ENERGUA · ENERGY · ENERGHE · ENERGI 2015/1186 ENERGIA · · ENE · ENERGUA · ENERGY · ENERGHE · ENERGI 2015/1186 307 Technical data and design characteristics of the products may change. Olimpia Splendid reserves the right to modify them at any time. DTP0925 OLIMPIA SPLENDID GROUP Via Industriale 1/3 25060 Cellatica (BS) - Italy via Guido Rossa 1/3 42044 Gualtieri (RE) - Italy OLIMPIA SPLENDID FRANCE S.A.R.L. 49 bis Avenue de l'Europe Parc de la Malnoue 77184 Emerainville Paris, France OLIMPIA SPLENDID IBERICA S.L. Calle Luxemburgo, número 2, 28820, Coslada Madrid, Spain OLIMPIA SPLENDID AIR CONDITIONING (SHANGHAI) CO., LTD. Room 803, Block C, No. 685 Huaxu Rd (North Area of E-LINK WORLD), Qingpu District, 201702 Shanghai, China OLIMPIA SPLENDID BRASIL Av. Angelica 2223 - Sala 602 Consolaçao CEP: 01.227-200 - Sao Paulo - SP OLIMPIA SPLENDID USA Inc. 514 South 5th Ave., Mt. Vernon, NY 10550 USA info@olimpiasplendid.com www.olimpiasplendid.comCreo Normalizer JTP